From 2573f0e5d6f37f1a663bd472055babc97cfb3959 Mon Sep 17 00:00:00 2001 From: José Fonseca Date: Thu, 28 Feb 2008 15:53:13 +0900 Subject: Convert crlf->lf line endings. Windows/DOS users should enable core.autocrlf from now on. --- docs/README.WIN32 | 326 +++++++++++++++++++++++++++--------------------------- 1 file changed, 163 insertions(+), 163 deletions(-) (limited to 'docs') diff --git a/docs/README.WIN32 b/docs/README.WIN32 index ce595076bd..97e1ffb7a7 100644 --- a/docs/README.WIN32 +++ b/docs/README.WIN32 @@ -1,163 +1,163 @@ -File: docs/README.WIN32 - -Last updated: Apr 25, 2007 - Karl Schultz - kschultz@users.sourceforge.net - -Quick Start ------ ----- - -Unzip the MesaLib, MesaGLUT, and MesaDemos ZIP files into the same -directory. The libs and demos build separately, so if you do not care -about the demos or GLUT, you only need to unzip MesaLib. If you unzip -more than one ZIP file, they all need to be unzipped into the same -directory. Don't worry, you will not overwrite anything. - -The Windows build system uses Microsoft Visual Studio. Project files -for a specific version of Visual Studio are in their own directory in -the top-level "windows" directory. For example, Visual Studio 8 files -are in windows/VC8. - -Support has been dropped for versions of Visual Studio prior to 8. The -main reason is because Microsoft now provides a free compiler and -developer environment. Visual Studio Express can be found at - -http://msdn.microsoft.com/vstudio/express/visualc/default.aspx - -You'll also need the Platform SDK. Instructions for obtaining and -using the SDK with Visual Studio Express can be found at - -http://msdn.microsoft.com/vstudio/express/visualc/usingpsdk/ - -If you are stuck using VC6 or VC7, you may start with these project -files, but you may need to modify them to reflect changes in the -Mesa source code tree. If you sucessfully update the project files, -please submit them to the author of this document so that they may -be included in the next distribution. - -The project files to build the core Mesa library, Windows Mesa -drivers, OSMesa, and GLU are in the mesa directory. The project files -to build GLUT and some demo programs are in the progs directory. - -Makefiles are no longer shipped or supported, but can be generated -from the projects using Visual Studio. - - -Windows Drivers -------- ------- - -At this time, only the GDI driver is known to work. Most of the demos -in progs/demos should work with this driver. - -Source code also exists in the tree for other drivers in -src/mesa/drivers/windows, but the status of this code is unknown. - -The GDI driver operates basically by writing pixel spans into a DIB -section and then blitting the DIB to the window. The driver was -recently cleaned up and rewitten and so may have bugs or may be -missing some functionality. The older versions of the CVS source may -be useful in figuring out any problems, or report them to me. - -To build Mesa with the GDI driver, build the mesa, gdi, and glu -projects in the Visual Studio workspace found at - - windows/VC8/mesa/mesa.sln - -The osmesa DLL can also be built with the osmesa project. - -The build system creates a lib top-level directory and copies -resulting LIB and DLL files to this lib directory. The files are: - - OPENGL32.LIB, GLU32.LIB, OSMESA32.LIB - OPENGL32.DLL, GLU32.DLL, OSMESA32.DLL - -If the MesaDemos ZIP file was extracted, the DLL files are also copied -to the demos directory. This facilitates running the demos as described -below. - - -GLUT and Demos ----- --- ----- - -A Visual Studio workspace can be found at - - windows/VC8/progs/progs.sln - -It can be used to build GLUT and a few demos. The GLUT lib and DLL -are copied to the top-level lib directory, along with the Mesa libs. - -The demo build system expects to find the LIB files in the top level -lib directory, so you must build the Mesa libs first. The demo -executables are placed in the demos directory, because some of them -rely on data files found there. Also, the Mesa lib DLL's were copied -there by the Mesa lib build process. Therefore, you should be able to -simply run the demo executables from the demo directory. - -If you want to run the demos from the Visual Studio, you may have to -change the startup directory and explicitly state where the executables are. - -You may also build all the demo programs by using a makefile. Go to -the progs/demos directory and make sure you have executed VCVARS32.BAT -or whatever setup script is appropriate for your compiler. Then, - - nmake -f Makefile.win - -should build all the demos. - - -Build System Notes ------ ------ ----- - -VC6 (not actively supported) ---- - -Visual Studio 6 does not recognize files with the .cc extension as C++ -language files, without a lot of unnatural tweaking. So, the VC6 -build process uses custom build steps to compile these files in the -GLU library. - -Two additional configurations are provided, Debug x86 and Release x86 -that activate the shader code compilation by defining SLANG_86. It is -unknown if and how this works. - -VC7 (not actively supported) ---- - -The above-mentioned .cc problem does not exist in this version. - -VC8 ---- - -No notes. - - -General -------- - -After building, you can copy the above DLL files to a place in your -PATH such as $SystemRoot/SYSTEM32. If you don't like putting things -in a system directory, place them in the same directory as the -executable(s). Be careful about accidentially overwriting files of -the same name in the SYSTEM32 directory. - -The DLL files are built so that the external entry points use the -stdcall calling convention. - -Static LIB files are not built. The LIB files that are built with are -the linker import files associated with the DLL files. - -The si-glu sources are used to build the GLU libs. This was done -mainly to get the better tessellator code. - -To build "mangled" Mesa, add the preprocessor define USE_MGL_NAMESPACE -to the project settings. You will also need to edit src/mesa.def to -change all the gl* symbols to mgl*. Because this is easy to do with a -global replace operation in a text editor, no additional mangled -version of mesa.def is maintained or shipped. - -If you have a Windows-related build problem or question, it is -probably better to direct it to me (kschultz@users.sourceforge.net), -rather than directly to the other Mesa developers. I will help you as -much as I can. I also monitor the Mesa mailing lists and will answer -questions in this area there as well. - - -Karl Schultz +File: docs/README.WIN32 + +Last updated: Apr 25, 2007 - Karl Schultz - kschultz@users.sourceforge.net + +Quick Start +----- ----- + +Unzip the MesaLib, MesaGLUT, and MesaDemos ZIP files into the same +directory. The libs and demos build separately, so if you do not care +about the demos or GLUT, you only need to unzip MesaLib. If you unzip +more than one ZIP file, they all need to be unzipped into the same +directory. Don't worry, you will not overwrite anything. + +The Windows build system uses Microsoft Visual Studio. Project files +for a specific version of Visual Studio are in their own directory in +the top-level "windows" directory. For example, Visual Studio 8 files +are in windows/VC8. + +Support has been dropped for versions of Visual Studio prior to 8. The +main reason is because Microsoft now provides a free compiler and +developer environment. Visual Studio Express can be found at + +http://msdn.microsoft.com/vstudio/express/visualc/default.aspx + +You'll also need the Platform SDK. Instructions for obtaining and +using the SDK with Visual Studio Express can be found at + +http://msdn.microsoft.com/vstudio/express/visualc/usingpsdk/ + +If you are stuck using VC6 or VC7, you may start with these project +files, but you may need to modify them to reflect changes in the +Mesa source code tree. If you sucessfully update the project files, +please submit them to the author of this document so that they may +be included in the next distribution. + +The project files to build the core Mesa library, Windows Mesa +drivers, OSMesa, and GLU are in the mesa directory. The project files +to build GLUT and some demo programs are in the progs directory. + +Makefiles are no longer shipped or supported, but can be generated +from the projects using Visual Studio. + + +Windows Drivers +------- ------- + +At this time, only the GDI driver is known to work. Most of the demos +in progs/demos should work with this driver. + +Source code also exists in the tree for other drivers in +src/mesa/drivers/windows, but the status of this code is unknown. + +The GDI driver operates basically by writing pixel spans into a DIB +section and then blitting the DIB to the window. The driver was +recently cleaned up and rewitten and so may have bugs or may be +missing some functionality. The older versions of the CVS source may +be useful in figuring out any problems, or report them to me. + +To build Mesa with the GDI driver, build the mesa, gdi, and glu +projects in the Visual Studio workspace found at + + windows/VC8/mesa/mesa.sln + +The osmesa DLL can also be built with the osmesa project. + +The build system creates a lib top-level directory and copies +resulting LIB and DLL files to this lib directory. The files are: + + OPENGL32.LIB, GLU32.LIB, OSMESA32.LIB + OPENGL32.DLL, GLU32.DLL, OSMESA32.DLL + +If the MesaDemos ZIP file was extracted, the DLL files are also copied +to the demos directory. This facilitates running the demos as described +below. + + +GLUT and Demos +---- --- ----- + +A Visual Studio workspace can be found at + + windows/VC8/progs/progs.sln + +It can be used to build GLUT and a few demos. The GLUT lib and DLL +are copied to the top-level lib directory, along with the Mesa libs. + +The demo build system expects to find the LIB files in the top level +lib directory, so you must build the Mesa libs first. The demo +executables are placed in the demos directory, because some of them +rely on data files found there. Also, the Mesa lib DLL's were copied +there by the Mesa lib build process. Therefore, you should be able to +simply run the demo executables from the demo directory. + +If you want to run the demos from the Visual Studio, you may have to +change the startup directory and explicitly state where the executables are. + +You may also build all the demo programs by using a makefile. Go to +the progs/demos directory and make sure you have executed VCVARS32.BAT +or whatever setup script is appropriate for your compiler. Then, + + nmake -f Makefile.win + +should build all the demos. + + +Build System Notes +----- ------ ----- + +VC6 (not actively supported) +--- + +Visual Studio 6 does not recognize files with the .cc extension as C++ +language files, without a lot of unnatural tweaking. So, the VC6 +build process uses custom build steps to compile these files in the +GLU library. + +Two additional configurations are provided, Debug x86 and Release x86 +that activate the shader code compilation by defining SLANG_86. It is +unknown if and how this works. + +VC7 (not actively supported) +--- + +The above-mentioned .cc problem does not exist in this version. + +VC8 +--- + +No notes. + + +General +------- + +After building, you can copy the above DLL files to a place in your +PATH such as $SystemRoot/SYSTEM32. If you don't like putting things +in a system directory, place them in the same directory as the +executable(s). Be careful about accidentially overwriting files of +the same name in the SYSTEM32 directory. + +The DLL files are built so that the external entry points use the +stdcall calling convention. + +Static LIB files are not built. The LIB files that are built with are +the linker import files associated with the DLL files. + +The si-glu sources are used to build the GLU libs. This was done +mainly to get the better tessellator code. + +To build "mangled" Mesa, add the preprocessor define USE_MGL_NAMESPACE +to the project settings. You will also need to edit src/mesa.def to +change all the gl* symbols to mgl*. Because this is easy to do with a +global replace operation in a text editor, no additional mangled +version of mesa.def is maintained or shipped. + +If you have a Windows-related build problem or question, it is +probably better to direct it to me (kschultz@users.sourceforge.net), +rather than directly to the other Mesa developers. I will help you as +much as I can. I also monitor the Mesa mailing lists and will answer +questions in this area there as well. + + +Karl Schultz -- cgit v1.2.3 From 77ce568ff704e6cdcfaa557965c894752d19e462 Mon Sep 17 00:00:00 2001 From: José Fonseca Date: Mon, 26 May 2008 20:14:40 +0900 Subject: Remove CVS keywords. --- docs/MESA_packed_depth_stencil.spec | 1 - docs/MESA_program_debug.spec | 1 - docs/MESA_resize_buffers.spec | 1 - docs/MESA_shader_debug.spec | 1 - docs/MESA_sprite_point.spec | 1 - docs/MESA_texture_array.spec | 1 - docs/MESA_trace.spec | 1 - docs/MESA_window_pos.spec | 1 - docs/README.BEOS | 1 - docs/README.QUAKE | 1 - docs/RELNOTES-3.1 | 1 - docs/RELNOTES-3.2 | 1 - docs/RELNOTES-3.2.1 | 1 - docs/RELNOTES-3.3 | 1 - docs/RELNOTES-3.4 | 1 - docs/RELNOTES-3.4.1 | 1 - docs/RELNOTES-3.4.2 | 1 - docs/RELNOTES-3.5 | 1 - docs/RELNOTES-4.0 | 1 - docs/RELNOTES-4.0.1 | 1 - docs/RELNOTES-4.0.2 | 1 - docs/RELNOTES-4.0.3 | 1 - docs/RELNOTES-4.1 | 1 - docs/RELNOTES-5.0 | 1 - docs/RELNOTES-5.0.1 | 1 - docs/RELNOTES-5.0.2 | 1 - docs/RELNOTES-6.0 | 1 - docs/RELNOTES-6.0.1 | 1 - docs/RELNOTES-6.1 | 1 - docs/RELNOTES-6.2 | 1 - docs/RELNOTES-6.2.1 | 1 - docs/RELNOTES-6.3 | 1 - docs/RELNOTES-6.3.1 | 1 - docs/RELNOTES-6.3.2 | 1 - docs/RELNOTES-6.4 | 1 - docs/news.html | 1 - include/GL/internal/sarea.h | 2 -- progs/beos/demo.cpp | 1 - progs/ggi/gears.c | 1 - progs/miniglx/glfbdevtest.c | 1 - progs/miniglx/manytex.c | 1 - progs/miniglx/sample_server.c | 1 - progs/miniglx/sample_server2.c | 1 - progs/miniglx/texline.c | 1 - progs/tests/Makefile.win | 1 - progs/tests/antialias.c | 1 - progs/tests/cva.c | 1 - progs/tests/getprocaddress.py | 1 - progs/tests/jkrahntest.c | 1 - progs/tests/manytex.c | 1 - progs/tests/multipal.c | 1 - progs/tests/multiwindow.c | 2 -- progs/tests/sharedtex.c | 1 - progs/tests/texline.c | 1 - progs/tests/texrect.c | 1 - progs/tests/texwrap.c | 1 - progs/util/README | 1 - progs/util/glstate.c | 2 -- progs/util/glstate.h | 2 -- progs/util/sampleMakefile | 2 -- progs/windml/ugldrawpix.c | 1 - progs/windml/ugltexcyl.c | 1 - progs/xdemos/vgears.c | 1 - src/gallium/winsys/dri/intel/server/i830_common.h | 1 - src/gallium/winsys/dri/intel/server/i830_dri.h | 1 - src/glu/mini/all.h | 1 - src/glu/mini/glu.c | 1 - src/glu/mini/gluP.h | 1 - src/glu/mini/mipmap.c | 1 - src/glu/mini/nurbs.c | 1 - src/glu/mini/nurbs.h | 1 - src/glu/mini/nurbscrv.c | 1 - src/glu/mini/polytest.c | 1 - src/glu/mini/project.c | 1 - src/glu/mini/quadric.c | 1 - src/glu/mini/tess.c | 1 - src/glu/mini/tess.h | 1 - src/glu/mini/tesselat.c | 1 - src/glu/sgi/dummy.cc | 1 - src/glu/sgi/libnurbs/interface/bezierEval.h | 2 -- src/glu/sgi/libnurbs/interface/bezierPatch.cc | 2 -- src/glu/sgi/libnurbs/interface/bezierPatch.h | 2 -- src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc | 2 -- src/glu/sgi/libnurbs/interface/bezierPatchMesh.h | 2 -- src/glu/sgi/libnurbs/interface/glcurveval.cc | 2 -- src/glu/sgi/libnurbs/interface/glimports.h | 2 -- src/glu/sgi/libnurbs/interface/glinterface.cc | 2 -- src/glu/sgi/libnurbs/interface/glrenderer.h | 2 -- src/glu/sgi/libnurbs/interface/incurveeval.cc | 2 -- src/glu/sgi/libnurbs/interface/insurfeval.cc | 2 -- src/glu/sgi/libnurbs/interface/mystdio.h | 2 -- src/glu/sgi/libnurbs/interface/mystdlib.h | 2 -- src/glu/sgi/libnurbs/internals/arc.h | 2 -- src/glu/sgi/libnurbs/internals/arcsorter.cc | 2 -- src/glu/sgi/libnurbs/internals/arcsorter.h | 2 -- src/glu/sgi/libnurbs/internals/arctess.h | 2 -- src/glu/sgi/libnurbs/internals/backend.cc | 2 -- src/glu/sgi/libnurbs/internals/backend.h | 2 -- src/glu/sgi/libnurbs/internals/basiccrveval.h | 2 -- src/glu/sgi/libnurbs/internals/basicsurfeval.h | 2 -- src/glu/sgi/libnurbs/internals/bezierarc.h | 2 -- src/glu/sgi/libnurbs/internals/bin.cc | 2 -- src/glu/sgi/libnurbs/internals/bin.h | 2 -- src/glu/sgi/libnurbs/internals/bufpool.cc | 2 -- src/glu/sgi/libnurbs/internals/bufpool.h | 2 -- src/glu/sgi/libnurbs/internals/cachingeval.cc | 2 -- src/glu/sgi/libnurbs/internals/cachingeval.h | 2 -- src/glu/sgi/libnurbs/internals/ccw.cc | 2 -- src/glu/sgi/libnurbs/internals/coveandtiler.h | 2 -- src/glu/sgi/libnurbs/internals/curve.cc | 2 -- src/glu/sgi/libnurbs/internals/curve.h | 2 -- src/glu/sgi/libnurbs/internals/curvelist.cc | 2 -- src/glu/sgi/libnurbs/internals/curvelist.h | 2 -- src/glu/sgi/libnurbs/internals/curvesub.cc | 2 -- src/glu/sgi/libnurbs/internals/dataTransform.cc | 2 -- src/glu/sgi/libnurbs/internals/dataTransform.h | 2 -- src/glu/sgi/libnurbs/internals/defines.h | 2 -- src/glu/sgi/libnurbs/internals/displaylist.cc | 2 -- src/glu/sgi/libnurbs/internals/displaylist.h | 2 -- src/glu/sgi/libnurbs/internals/displaymode.h | 2 -- src/glu/sgi/libnurbs/internals/flist.cc | 2 -- src/glu/sgi/libnurbs/internals/flist.h | 2 -- src/glu/sgi/libnurbs/internals/flistsorter.cc | 2 -- src/glu/sgi/libnurbs/internals/flistsorter.h | 2 -- src/glu/sgi/libnurbs/internals/gridline.h | 2 -- src/glu/sgi/libnurbs/internals/gridtrimvertex.h | 2 -- src/glu/sgi/libnurbs/internals/gridvertex.h | 2 -- src/glu/sgi/libnurbs/internals/hull.cc | 2 -- src/glu/sgi/libnurbs/internals/hull.h | 2 -- src/glu/sgi/libnurbs/internals/intersect.cc | 2 -- src/glu/sgi/libnurbs/internals/jarcloc.h | 2 -- src/glu/sgi/libnurbs/internals/knotvector.h | 2 -- src/glu/sgi/libnurbs/internals/mapdesc.cc | 2 -- src/glu/sgi/libnurbs/internals/mapdesc.h | 2 -- src/glu/sgi/libnurbs/internals/mapdescv.cc | 2 -- src/glu/sgi/libnurbs/internals/maplist.cc | 2 -- src/glu/sgi/libnurbs/internals/maplist.h | 2 -- src/glu/sgi/libnurbs/internals/mesher.cc | 2 -- src/glu/sgi/libnurbs/internals/mesher.h | 2 -- src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc | 2 -- src/glu/sgi/libnurbs/internals/monotonizer.cc | 2 -- src/glu/sgi/libnurbs/internals/monotonizer.h | 1 - src/glu/sgi/libnurbs/internals/myassert.h | 2 -- src/glu/sgi/libnurbs/internals/mycode.cc | 2 -- src/glu/sgi/libnurbs/internals/mystring.h | 2 -- src/glu/sgi/libnurbs/internals/nurbsconsts.h | 2 -- src/glu/sgi/libnurbs/internals/nurbstess.cc | 2 -- src/glu/sgi/libnurbs/internals/patch.cc | 2 -- src/glu/sgi/libnurbs/internals/patch.h | 2 -- src/glu/sgi/libnurbs/internals/patchlist.cc | 2 -- src/glu/sgi/libnurbs/internals/patchlist.h | 2 -- src/glu/sgi/libnurbs/internals/pwlarc.h | 2 -- src/glu/sgi/libnurbs/internals/quilt.cc | 2 -- src/glu/sgi/libnurbs/internals/quilt.h | 2 -- src/glu/sgi/libnurbs/internals/reader.cc | 2 -- src/glu/sgi/libnurbs/internals/reader.h | 2 -- src/glu/sgi/libnurbs/internals/renderhints.cc | 2 -- src/glu/sgi/libnurbs/internals/renderhints.h | 2 -- src/glu/sgi/libnurbs/internals/simplemath.h | 2 -- src/glu/sgi/libnurbs/internals/slicer.cc | 2 -- src/glu/sgi/libnurbs/internals/slicer.h | 2 -- src/glu/sgi/libnurbs/internals/sorter.cc | 2 -- src/glu/sgi/libnurbs/internals/sorter.h | 2 -- src/glu/sgi/libnurbs/internals/splitarcs.cc | 2 -- src/glu/sgi/libnurbs/internals/subdivider.h | 2 -- src/glu/sgi/libnurbs/internals/tobezier.cc | 2 -- src/glu/sgi/libnurbs/internals/trimline.cc | 2 -- src/glu/sgi/libnurbs/internals/trimline.h | 2 -- src/glu/sgi/libnurbs/internals/trimregion.cc | 2 -- src/glu/sgi/libnurbs/internals/trimregion.h | 2 -- src/glu/sgi/libnurbs/internals/trimvertex.h | 2 -- src/glu/sgi/libnurbs/internals/trimvertpool.cc | 2 -- src/glu/sgi/libnurbs/internals/trimvertpool.h | 2 -- src/glu/sgi/libnurbs/internals/types.h | 2 -- src/glu/sgi/libnurbs/internals/uarray.cc | 2 -- src/glu/sgi/libnurbs/internals/uarray.h | 2 -- src/glu/sgi/libnurbs/internals/varray.cc | 2 -- src/glu/sgi/libnurbs/internals/varray.h | 2 -- src/glu/sgi/libnurbs/nurbtess/definitions.h | 2 -- src/glu/sgi/libnurbs/nurbtess/directedLine.h | 2 -- src/glu/sgi/libnurbs/nurbtess/glimports.h | 2 -- src/glu/sgi/libnurbs/nurbtess/gridWrap.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/gridWrap.h | 2 -- src/glu/sgi/libnurbs/nurbtess/monoChain.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/monoChain.h | 2 -- src/glu/sgi/libnurbs/nurbtess/monoPolyPart.cc | 1 - src/glu/sgi/libnurbs/nurbtess/monoPolyPart.h | 1 - src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h | 2 -- src/glu/sgi/libnurbs/nurbtess/mystdio.h | 2 -- src/glu/sgi/libnurbs/nurbtess/mystdlib.h | 2 -- src/glu/sgi/libnurbs/nurbtess/partitionX.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/partitionX.h | 2 -- src/glu/sgi/libnurbs/nurbtess/partitionY.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/partitionY.h | 2 -- src/glu/sgi/libnurbs/nurbtess/polyDBG.h | 2 -- src/glu/sgi/libnurbs/nurbtess/polyUtil.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/polyUtil.h | 2 -- src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/primitiveStream.h | 2 -- src/glu/sgi/libnurbs/nurbtess/quicksort.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/quicksort.h | 2 -- src/glu/sgi/libnurbs/nurbtess/rectBlock.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/rectBlock.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleComp.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleComp.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h | 2 -- src/glu/sgi/libnurbs/nurbtess/sampledLine.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/sampledLine.h | 2 -- src/glu/sgi/libnurbs/nurbtess/searchTree.cc | 2 -- src/glu/sgi/libnurbs/nurbtess/searchTree.h | 2 -- src/glu/sgi/libnurbs/nurbtess/zlassert.h | 2 -- src/glu/sgi/libtess/README | 1 - src/glu/sgi/libtess/alg-outline | 1 - src/glu/sgi/libtess/dict-list.h | 2 -- src/glu/sgi/libtess/dict.c | 2 -- src/glu/sgi/libtess/dict.h | 2 -- src/glu/sgi/libtess/geom.c | 2 -- src/glu/sgi/libtess/memalloc.c | 2 -- src/glu/sgi/libtess/memalloc.h | 2 -- src/glu/sgi/libtess/mesh.c | 2 -- src/glu/sgi/libtess/mesh.h | 2 -- src/glu/sgi/libtess/normal.h | 2 -- src/glu/sgi/libtess/priorityq-heap.c | 2 -- src/glu/sgi/libtess/priorityq-heap.h | 2 -- src/glu/sgi/libtess/priorityq-sort.h | 2 -- src/glu/sgi/libtess/priorityq.c | 2 -- src/glu/sgi/libtess/priorityq.h | 2 -- src/glu/sgi/libtess/render.c | 2 -- src/glu/sgi/libtess/render.h | 2 -- src/glu/sgi/libtess/sweep.h | 2 -- src/glu/sgi/libtess/tess.h | 2 -- src/glu/sgi/libtess/tessmono.c | 2 -- src/glu/sgi/libtess/tessmono.h | 2 -- src/glu/sgi/libutil/error.c | 2 -- src/glu/sgi/libutil/glue.c | 2 -- src/glu/sgi/libutil/gluint.h | 2 -- src/glu/sgi/libutil/project.c | 2 -- src/glu/sgi/libutil/registry.c | 2 -- src/glut/beos/beos_x11.cpp | 1 - src/glut/ggi/debug.h | 2 +- src/glut/glx/stroke.h | 1 - src/glut/glx/win32_x11.c | 1 - src/glx/mini/miniglx_events.c | 1 - src/glx/x11/XF86dri.c | 1 - src/glx/x11/clientattrib.c | 1 - src/glx/x11/compsize.c | 1 - src/glx/x11/dri_glx.c | 1 - src/glx/x11/eval.c | 1 - src/glx/x11/glxclient.h | 1 - src/glx/x11/glxcmds.c | 1 - src/glx/x11/glxext.c | 1 - src/glx/x11/indirect_init.h | 1 - src/glx/x11/packrender.h | 1 - src/glx/x11/packsingle.h | 1 - src/glx/x11/pixel.c | 1 - src/glx/x11/pixelstore.c | 1 - src/glx/x11/render2.c | 1 - src/glx/x11/renderpix.c | 1 - src/glx/x11/single2.c | 1 - src/glx/x11/singlepix.c | 1 - src/glx/x11/vertarr.c | 1 - src/glx/x11/xf86dri.h | 1 - src/glx/x11/xf86dristr.h | 1 - src/glx/x11/xfont.c | 1 - src/mesa/drivers/dri/common/stenciltmp.h | 1 - src/mesa/drivers/dri/common/texmem.c | 1 - src/mesa/drivers/dri/common/texmem.h | 1 - src/mesa/drivers/dri/common/utils.h | 1 - src/mesa/drivers/dri/common/vblank.c | 1 - src/mesa/drivers/dri/common/vblank.h | 1 - src/mesa/drivers/dri/ffb/ffb_bitmap.c | 2 +- src/mesa/drivers/dri/ffb/ffb_bitmap.h | 1 - src/mesa/drivers/dri/ffb/ffb_clear.c | 2 +- src/mesa/drivers/dri/ffb/ffb_context.h | 1 - src/mesa/drivers/dri/ffb/ffb_dd.c | 2 +- src/mesa/drivers/dri/ffb/ffb_dd.h | 2 +- src/mesa/drivers/dri/ffb/ffb_depth.c | 2 +- src/mesa/drivers/dri/ffb/ffb_depth.h | 1 - src/mesa/drivers/dri/ffb/ffb_fifo.h | 1 - src/mesa/drivers/dri/ffb/ffb_lines.c | 2 +- src/mesa/drivers/dri/ffb/ffb_lines.h | 1 - src/mesa/drivers/dri/ffb/ffb_linetmp.h | 1 - src/mesa/drivers/dri/ffb/ffb_lock.h | 1 - src/mesa/drivers/dri/ffb/ffb_points.c | 2 +- src/mesa/drivers/dri/ffb/ffb_points.h | 1 - src/mesa/drivers/dri/ffb/ffb_pointtmp.h | 1 - src/mesa/drivers/dri/ffb/ffb_rendertmp.h | 1 - src/mesa/drivers/dri/ffb/ffb_span.c | 2 +- src/mesa/drivers/dri/ffb/ffb_span.h | 1 - src/mesa/drivers/dri/ffb/ffb_state.c | 2 +- src/mesa/drivers/dri/ffb/ffb_state.h | 1 - src/mesa/drivers/dri/ffb/ffb_stencil.c | 2 +- src/mesa/drivers/dri/ffb/ffb_stencil.h | 1 - src/mesa/drivers/dri/ffb/ffb_tex.c | 2 +- src/mesa/drivers/dri/ffb/ffb_tex.h | 2 +- src/mesa/drivers/dri/ffb/ffb_tris.c | 2 +- src/mesa/drivers/dri/ffb/ffb_tris.h | 1 - src/mesa/drivers/dri/ffb/ffb_tritmp.h | 1 - src/mesa/drivers/dri/ffb/ffb_vb.c | 2 +- src/mesa/drivers/dri/ffb/ffb_vb.h | 1 - src/mesa/drivers/dri/ffb/ffb_vbtmp.h | 1 - src/mesa/drivers/dri/ffb/ffb_vtxfmt.c | 2 +- src/mesa/drivers/dri/ffb/ffb_vtxfmt.h | 1 - src/mesa/drivers/dri/ffb/ffb_xmesa.c | 2 +- src/mesa/drivers/dri/ffb/ffb_xmesa.h | 1 - src/mesa/drivers/dri/ffb/server/ffb_dac.h | 1 - src/mesa/drivers/dri/ffb/server/ffb_drishare.h | 1 - src/mesa/drivers/dri/ffb/server/ffb_regs.h | 1 - src/mesa/drivers/dri/gamma/gamma_client.h | 1 - src/mesa/drivers/dri/gamma/gamma_context.h | 1 - src/mesa/drivers/dri/gamma/gamma_inithw.c | 1 - src/mesa/drivers/dri/gamma/gamma_lock.c | 1 - src/mesa/drivers/dri/gamma/gamma_macros.h | 1 - src/mesa/drivers/dri/gamma/gamma_regs.h | 1 - src/mesa/drivers/dri/gamma/gamma_span.c | 1 - src/mesa/drivers/dri/gamma/gamma_state.c | 1 - src/mesa/drivers/dri/gamma/gamma_tex.c | 1 - src/mesa/drivers/dri/gamma/gamma_texmem.c | 1 - src/mesa/drivers/dri/gamma/gamma_texstate.c | 1 - src/mesa/drivers/dri/gamma/gamma_tritmp.h | 1 - src/mesa/drivers/dri/gamma/gamma_vb.c | 1 - src/mesa/drivers/dri/gamma/gamma_xmesa.c | 1 - src/mesa/drivers/dri/gamma/server/glint_common.h | 1 - src/mesa/drivers/dri/gamma/server/glint_dri.h | 1 - src/mesa/drivers/dri/i810/i810_3d_reg.h | 1 - src/mesa/drivers/dri/i810/i810context.c | 1 - src/mesa/drivers/dri/i810/i810context.h | 1 - src/mesa/drivers/dri/i810/i810ioctl.c | 1 - src/mesa/drivers/dri/i810/i810ioctl.h | 1 - src/mesa/drivers/dri/i810/i810screen.c | 1 - src/mesa/drivers/dri/i810/i810state.c | 1 - src/mesa/drivers/dri/i810/i810tex.c | 1 - src/mesa/drivers/dri/i810/i810tris.c | 1 - src/mesa/drivers/dri/i810/i810tris.h | 1 - src/mesa/drivers/dri/i810/i810vb.c | 1 - src/mesa/drivers/dri/i810/i810vb.h | 1 - src/mesa/drivers/dri/i810/server/i810_common.h | 1 - src/mesa/drivers/dri/i810/server/i810_dri.h | 1 - src/mesa/drivers/dri/i810/server/i810_reg.h | 1 - src/mesa/drivers/dri/i915/server/i830_common.h | 1 - src/mesa/drivers/dri/i915/server/i830_dri.h | 1 - src/mesa/drivers/dri/i965/server/i830_common.h | 1 - src/mesa/drivers/dri/i965/server/i830_dri.h | 1 - src/mesa/drivers/dri/mach64/mach64_context.c | 2 +- src/mesa/drivers/dri/mach64/mach64_context.h | 2 +- src/mesa/drivers/dri/mach64/mach64_dd.c | 2 +- src/mesa/drivers/dri/mach64/mach64_dd.h | 2 +- src/mesa/drivers/dri/mach64/mach64_ioctl.c | 2 +- src/mesa/drivers/dri/mach64/mach64_ioctl.h | 2 +- src/mesa/drivers/dri/mach64/mach64_lock.c | 2 +- src/mesa/drivers/dri/mach64/mach64_lock.h | 2 +- src/mesa/drivers/dri/mach64/mach64_native_vb.c | 2 +- src/mesa/drivers/dri/mach64/mach64_native_vbtmp.h | 2 +- src/mesa/drivers/dri/mach64/mach64_reg.h | 2 +- src/mesa/drivers/dri/mach64/mach64_screen.c | 2 +- src/mesa/drivers/dri/mach64/mach64_screen.h | 2 +- src/mesa/drivers/dri/mach64/mach64_span.c | 2 +- src/mesa/drivers/dri/mach64/mach64_span.h | 2 +- src/mesa/drivers/dri/mach64/mach64_state.c | 2 +- src/mesa/drivers/dri/mach64/mach64_state.h | 2 +- src/mesa/drivers/dri/mach64/mach64_tex.c | 2 +- src/mesa/drivers/dri/mach64/mach64_tex.h | 2 +- src/mesa/drivers/dri/mach64/mach64_texmem.c | 2 +- src/mesa/drivers/dri/mach64/mach64_texstate.c | 2 +- src/mesa/drivers/dri/mach64/mach64_tris.c | 2 +- src/mesa/drivers/dri/mach64/mach64_tris.h | 2 +- src/mesa/drivers/dri/mach64/mach64_vb.c | 2 +- src/mesa/drivers/dri/mach64/mach64_vb.h | 2 +- src/mesa/drivers/dri/mach64/mach64_vbtmp.h | 2 +- src/mesa/drivers/dri/mach64/server/mach64_dri.h | 2 +- src/mesa/drivers/dri/mga/mga_texstate.c | 1 - src/mesa/drivers/dri/mga/mga_xmesa.c | 1 - src/mesa/drivers/dri/mga/mga_xmesa.h | 1 - src/mesa/drivers/dri/mga/mgacontext.h | 1 - src/mesa/drivers/dri/mga/mgadd.c | 1 - src/mesa/drivers/dri/mga/mgadd.h | 1 - src/mesa/drivers/dri/mga/mgaioctl.h | 1 - src/mesa/drivers/dri/mga/mgapixel.c | 1 - src/mesa/drivers/dri/mga/mgapixel.h | 1 - src/mesa/drivers/dri/mga/mgaregs.h | 1 - src/mesa/drivers/dri/mga/mgarender.c | 1 - src/mesa/drivers/dri/mga/mgaspan.h | 1 - src/mesa/drivers/dri/mga/mgastate.h | 1 - src/mesa/drivers/dri/mga/mgatex.c | 1 - src/mesa/drivers/dri/mga/mgatex.h | 1 - src/mesa/drivers/dri/mga/mgatexmem.c | 1 - src/mesa/drivers/dri/mga/mgatris.c | 1 - src/mesa/drivers/dri/mga/mgatris.h | 1 - src/mesa/drivers/dri/mga/mgavb.c | 1 - src/mesa/drivers/dri/mga/mgavb.h | 1 - src/mesa/drivers/dri/mga/server/mga.h | 1 - src/mesa/drivers/dri/mga/server/mga_bios.h | 2 -- src/mesa/drivers/dri/mga/server/mga_dri.c | 1 - src/mesa/drivers/dri/mga/server/mga_dri.h | 1 - src/mesa/drivers/dri/mga/server/mga_macros.h | 1 - src/mesa/drivers/dri/mga/server/mga_reg.h | 2 -- src/mesa/drivers/dri/r128/r128_context.c | 1 - src/mesa/drivers/dri/r128/r128_context.h | 1 - src/mesa/drivers/dri/r128/r128_dd.c | 1 - src/mesa/drivers/dri/r128/r128_dd.h | 1 - src/mesa/drivers/dri/r128/r128_ioctl.c | 1 - src/mesa/drivers/dri/r128/r128_ioctl.h | 1 - src/mesa/drivers/dri/r128/r128_lock.c | 1 - src/mesa/drivers/dri/r128/r128_lock.h | 1 - src/mesa/drivers/dri/r128/r128_screen.c | 1 - src/mesa/drivers/dri/r128/r128_screen.h | 1 - src/mesa/drivers/dri/r128/r128_span.c | 1 - src/mesa/drivers/dri/r128/r128_span.h | 1 - src/mesa/drivers/dri/r128/r128_state.c | 1 - src/mesa/drivers/dri/r128/r128_state.h | 1 - src/mesa/drivers/dri/r128/r128_tex.c | 1 - src/mesa/drivers/dri/r128/r128_tex.h | 1 - src/mesa/drivers/dri/r128/r128_texmem.c | 1 - src/mesa/drivers/dri/r128/r128_texobj.h | 1 - src/mesa/drivers/dri/r128/r128_texstate.c | 1 - src/mesa/drivers/dri/r128/r128_tris.c | 2 +- src/mesa/drivers/dri/r128/r128_tris.h | 1 - src/mesa/drivers/dri/r128/server/r128.h | 1 - src/mesa/drivers/dri/r128/server/r128_dri.c | 1 - src/mesa/drivers/dri/r128/server/r128_dri.h | 1 - src/mesa/drivers/dri/r128/server/r128_macros.h | 1 - src/mesa/drivers/dri/r128/server/r128_reg.h | 1 - src/mesa/drivers/dri/r128/server/r128_version.h | 1 - src/mesa/drivers/dri/radeon/radeon_compat.c | 1 - src/mesa/drivers/dri/radeon/radeon_context.c | 1 - src/mesa/drivers/dri/radeon/radeon_ioctl.c | 1 - src/mesa/drivers/dri/radeon/radeon_ioctl.h | 1 - src/mesa/drivers/dri/radeon/radeon_lighting.c | 1 - src/mesa/drivers/dri/radeon/radeon_maos.h | 1 - src/mesa/drivers/dri/radeon/radeon_maos_arrays.c | 1 - src/mesa/drivers/dri/radeon/radeon_maos_verts.c | 1 - src/mesa/drivers/dri/radeon/radeon_sanity.c | 1 - src/mesa/drivers/dri/radeon/radeon_screen.c | 1 - src/mesa/drivers/dri/radeon/radeon_screen.h | 1 - src/mesa/drivers/dri/radeon/radeon_state.c | 1 - src/mesa/drivers/dri/radeon/radeon_state.h | 1 - src/mesa/drivers/dri/radeon/radeon_state_init.c | 1 - src/mesa/drivers/dri/radeon/radeon_swtcl.c | 1 - src/mesa/drivers/dri/radeon/radeon_swtcl.h | 1 - src/mesa/drivers/dri/radeon/radeon_tcl.c | 1 - src/mesa/drivers/dri/radeon/radeon_tcl.h | 1 - src/mesa/drivers/dri/radeon/radeon_tex.c | 1 - src/mesa/drivers/dri/radeon/radeon_tex.h | 1 - src/mesa/drivers/dri/radeon/radeon_texmem.c | 1 - src/mesa/drivers/dri/radeon/radeon_texstate.c | 1 - src/mesa/drivers/dri/radeon/server/radeon.h | 1 - src/mesa/drivers/dri/radeon/server/radeon_dri.h | 1 - src/mesa/drivers/dri/radeon/server/radeon_macros.h | 1 - src/mesa/drivers/dri/radeon/server/radeon_reg.h | 1 - src/mesa/drivers/dri/savage/savagetris.c | 2 +- src/mesa/drivers/dri/savage/savagetris.h | 1 - src/mesa/drivers/dri/sis/server/sis_common.h | 1 - src/mesa/drivers/dri/sis/server/sis_dri.h | 1 - src/mesa/drivers/dri/sis/sis_alloc.c | 1 - src/mesa/drivers/dri/sis/sis_alloc.h | 1 - src/mesa/drivers/dri/sis/sis_clear.c | 1 - src/mesa/drivers/dri/sis/sis_context.c | 1 - src/mesa/drivers/dri/sis/sis_context.h | 1 - src/mesa/drivers/dri/sis/sis_dd.c | 1 - src/mesa/drivers/dri/sis/sis_dd.h | 1 - src/mesa/drivers/dri/sis/sis_fog.c | 1 - src/mesa/drivers/dri/sis/sis_lock.c | 1 - src/mesa/drivers/dri/sis/sis_lock.h | 1 - src/mesa/drivers/dri/sis/sis_reg.h | 1 - src/mesa/drivers/dri/sis/sis_screen.c | 1 - src/mesa/drivers/dri/sis/sis_screen.h | 1 - src/mesa/drivers/dri/sis/sis_span.c | 1 - src/mesa/drivers/dri/sis/sis_span.h | 1 - src/mesa/drivers/dri/sis/sis_state.c | 1 - src/mesa/drivers/dri/sis/sis_state.h | 1 - src/mesa/drivers/dri/sis/sis_stencil.c | 1 - src/mesa/drivers/dri/sis/sis_stencil.h | 1 - src/mesa/drivers/dri/sis/sis_tex.c | 1 - src/mesa/drivers/dri/sis/sis_tex.h | 1 - src/mesa/drivers/dri/sis/sis_texstate.c | 1 - src/mesa/drivers/dri/sis/sis_tris.h | 1 - src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fastpath.S | 1 - src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fasttmp.h | 1 - src/mesa/drivers/dri/tdfx/dri_glide.h | 1 - src/mesa/drivers/dri/tdfx/server/tdfx_dri.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_context.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_dd.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_glide.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_lock.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_lock.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_pixels.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_pixels.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_render.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_render.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_screen.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_screen.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_span.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_span.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_state.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_state.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_tex.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_tex.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_texman.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_texman.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_texstate.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_texstate.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_tris.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_tris.h | 1 - src/mesa/drivers/dri/tdfx/tdfx_vb.c | 1 - src/mesa/drivers/dri/tdfx/tdfx_vb.h | 1 - src/mesa/drivers/dri/unichrome/server/via_dri.c | 1 - src/mesa/drivers/dri/unichrome/server/via_driver.h | 1 - src/mesa/drivers/dri/unichrome/server/via_priv.h | 1 - src/mesa/drivers/ggi/default/genkgi.h | 2 +- src/mesa/drivers/ggi/default/genkgi_mode.c | 2 +- src/mesa/drivers/ggi/default/genkgi_visual.c | 2 +- src/mesa/drivers/ggi/include/ggi/mesa/debug.h | 2 +- src/mesa/drivers/svga/svgamesa.c | 1 - src/mesa/drivers/svga/svgamesa15.c | 1 - src/mesa/drivers/svga/svgamesa15.h | 1 - src/mesa/drivers/svga/svgamesa16.c | 1 - src/mesa/drivers/svga/svgamesa16.h | 1 - src/mesa/drivers/svga/svgamesa24.c | 1 - src/mesa/drivers/svga/svgamesa24.h | 1 - src/mesa/drivers/svga/svgamesa32.c | 1 - src/mesa/drivers/svga/svgamesa32.h | 1 - src/mesa/drivers/svga/svgamesa8.c | 1 - src/mesa/drivers/svga/svgamesa8.h | 1 - src/mesa/drivers/svga/svgapix.h | 1 - src/mesa/drivers/windows/gdi/wgl.c | 1 - src/mesa/drivers/windows/gldirect/dx7/gld_vb_mesa_render_dx7.c | 1 - src/mesa/drivers/windows/gldirect/dx8/gld_vb_mesa_render_dx8.c | 1 - src/mesa/drivers/windows/gldirect/dx9/gld_vb_mesa_render_dx9.c | 1 - src/mesa/drivers/windows/gldirect/gld_debug_clip.c | 1 - src/mesa/drivers/windows/gldirect/gld_debug_norm.c | 1 - src/mesa/drivers/windows/gldirect/gld_debug_xform.c | 1 - src/mesa/drivers/windows/gldirect/mesasw/colors.h | 7 ++----- src/mesa/glapi/mesadef.py | 1 - src/mesa/sparc/norm.S | 1 - src/mesa/sparc/sparc.h | 1 - src/mesa/sparc/xform.S | 1 - src/mesa/x86-64/x86-64.c | 1 - src/mesa/x86-64/x86-64.h | 1 - src/mesa/x86-64/xform4.S | 1 - src/mesa/x86/3dnow.c | 1 - src/mesa/x86/3dnow.h | 1 - src/mesa/x86/3dnow_normal.S | 1 - src/mesa/x86/3dnow_xform1.S | 1 - src/mesa/x86/3dnow_xform2.S | 1 - src/mesa/x86/3dnow_xform3.S | 1 - src/mesa/x86/3dnow_xform4.S | 1 - src/mesa/x86/clip_args.h | 1 - src/mesa/x86/common_x86_asm.h | 1 - src/mesa/x86/common_x86_features.h | 1 - src/mesa/x86/common_x86_macros.h | 1 - src/mesa/x86/norm_args.h | 1 - src/mesa/x86/sse.h | 1 - src/mesa/x86/sse_normal.S | 1 - src/mesa/x86/sse_xform1.S | 1 - src/mesa/x86/sse_xform2.S | 1 - src/mesa/x86/sse_xform3.S | 1 - src/mesa/x86/sse_xform4.S | 1 - src/mesa/x86/x86.c | 1 - src/mesa/x86/x86.h | 1 - src/mesa/x86/x86_cliptest.S | 1 - src/mesa/x86/x86_xform2.S | 1 - src/mesa/x86/x86_xform3.S | 1 - src/mesa/x86/x86_xform4.S | 1 - src/mesa/x86/xform_args.h | 1 - 572 files changed, 52 insertions(+), 745 deletions(-) (limited to 'docs') diff --git a/docs/MESA_packed_depth_stencil.spec b/docs/MESA_packed_depth_stencil.spec index 4f7ab1e28c..112b730ecc 100644 --- a/docs/MESA_packed_depth_stencil.spec +++ b/docs/MESA_packed_depth_stencil.spec @@ -17,7 +17,6 @@ Status Version - $Id: MESA_packed_depth_stencil.spec,v 1.2 2003/09/19 14:58:21 brianp Exp $ Number diff --git a/docs/MESA_program_debug.spec b/docs/MESA_program_debug.spec index 391d39fa70..7694fdcc42 100644 --- a/docs/MESA_program_debug.spec +++ b/docs/MESA_program_debug.spec @@ -18,7 +18,6 @@ Version Last Modified Date: July 20, 2003 Author Revision: 1.0 - $Date: 2004/03/25 01:42:41 $ $Revision: 1.4 $ Number diff --git a/docs/MESA_resize_buffers.spec b/docs/MESA_resize_buffers.spec index f79d29c405..533d017c9a 100644 --- a/docs/MESA_resize_buffers.spec +++ b/docs/MESA_resize_buffers.spec @@ -16,7 +16,6 @@ Status Version - $Id: MESA_resize_buffers.spec,v 1.3 2004/03/25 01:42:42 brianp Exp $ Number diff --git a/docs/MESA_shader_debug.spec b/docs/MESA_shader_debug.spec index dbd22b3c66..1f7d42ac91 100644 --- a/docs/MESA_shader_debug.spec +++ b/docs/MESA_shader_debug.spec @@ -19,7 +19,6 @@ Version Last Modified Date: July 30, 2006 Author Revision: 0.2 - $Date: 2006/07/30 14:28:38 $ $Revision: 1.2 $ Number diff --git a/docs/MESA_sprite_point.spec b/docs/MESA_sprite_point.spec index 9422ff5729..b50d78e9e7 100644 --- a/docs/MESA_sprite_point.spec +++ b/docs/MESA_sprite_point.spec @@ -16,7 +16,6 @@ Status Version - $Id: MESA_sprite_point.spec,v 1.2 2003/09/19 14:58:21 brianp Exp $ Number diff --git a/docs/MESA_texture_array.spec b/docs/MESA_texture_array.spec index d3b7752115..9dee65b045 100644 --- a/docs/MESA_texture_array.spec +++ b/docs/MESA_texture_array.spec @@ -20,7 +20,6 @@ Status Version - $Date: 2007/05/16$ $Revision: 0.4$ Number diff --git a/docs/MESA_trace.spec b/docs/MESA_trace.spec index f0a79c7df9..dc4166e6b6 100644 --- a/docs/MESA_trace.spec +++ b/docs/MESA_trace.spec @@ -17,7 +17,6 @@ Status Version - $Id: MESA_trace.spec,v 1.4 2004/03/25 01:42:42 brianp Exp $ Number diff --git a/docs/MESA_window_pos.spec b/docs/MESA_window_pos.spec index eb1d0d1f06..4d01f1814c 100644 --- a/docs/MESA_window_pos.spec +++ b/docs/MESA_window_pos.spec @@ -16,7 +16,6 @@ Status Version - $Id: MESA_window_pos.spec,v 1.4 2004/03/25 01:42:42 brianp Exp $ Number diff --git a/docs/README.BEOS b/docs/README.BEOS index 5847730af0..efd84e888c 100644 --- a/docs/README.BEOS +++ b/docs/README.BEOS @@ -134,4 +134,3 @@ as of February, 1999. ---------------------------------------------------------------------- -$Id: README.BEOS,v 1.12 2004/10/13 00:35:55 phoudoin Exp $ diff --git a/docs/README.QUAKE b/docs/README.QUAKE index 5a13b7a498..e90c76a083 100644 --- a/docs/README.QUAKE +++ b/docs/README.QUAKE @@ -205,4 +205,3 @@ http://www.linuxgames.com/quake2/ ---------------------------------------------------------------------- -$Id: README.QUAKE,v 1.3 1998/08/23 15:26:26 brianp Exp $ diff --git a/docs/RELNOTES-3.1 b/docs/RELNOTES-3.1 index 4d6e3c2f44..65324eb496 100644 --- a/docs/RELNOTES-3.1 +++ b/docs/RELNOTES-3.1 @@ -143,4 +143,3 @@ code). Anyone want to help? ---------------------------------------------------------------------- -$Id: RELNOTES-3.1,v 1.2 2000/04/07 17:08:06 brianp Exp $ diff --git a/docs/RELNOTES-3.2 b/docs/RELNOTES-3.2 index 7737c28e80..ec7d4f8dc3 100644 --- a/docs/RELNOTES-3.2 +++ b/docs/RELNOTES-3.2 @@ -9,4 +9,3 @@ have been added. For a list of bug fixes please read the VERSIONS file. ---------------------------------------------------------------------- -$Id: RELNOTES-3.2,v 1.2 2000/04/07 17:08:06 brianp Exp $ diff --git a/docs/RELNOTES-3.2.1 b/docs/RELNOTES-3.2.1 index 2ad5b9046a..d34efcc867 100644 --- a/docs/RELNOTES-3.2.1 +++ b/docs/RELNOTES-3.2.1 @@ -29,4 +29,3 @@ GLU library. ---------------------------------------------------------------------- -$Id: RELNOTES-3.2.1,v 1.2 2000/07/21 16:32:33 brianp Exp $ diff --git a/docs/RELNOTES-3.3 b/docs/RELNOTES-3.3 index 362a74ee31..3850767bb1 100644 --- a/docs/RELNOTES-3.3 +++ b/docs/RELNOTES-3.3 @@ -268,4 +268,3 @@ image convolution. This will (hopefully) be done for Mesa 3.5/3.6. ---------------------------------------------------------------------- -$Id: RELNOTES-3.3,v 1.8 2000/07/21 16:26:41 brianp Exp $ diff --git a/docs/RELNOTES-3.4 b/docs/RELNOTES-3.4 index 4aa607a37c..657ccdaab6 100644 --- a/docs/RELNOTES-3.4 +++ b/docs/RELNOTES-3.4 @@ -19,4 +19,3 @@ see the VERSIONS file. ---------------------------------------------------------------------- -$Id: RELNOTES-3.4,v 1.2 2002/03/23 02:37:17 brianp Exp $ diff --git a/docs/RELNOTES-3.4.1 b/docs/RELNOTES-3.4.1 index 18443507c2..73d75c64d2 100644 --- a/docs/RELNOTES-3.4.1 +++ b/docs/RELNOTES-3.4.1 @@ -19,4 +19,3 @@ the Mesa 3.4 release. For details, see the VERSIONS file. ---------------------------------------------------------------------- -$Id: RELNOTES-3.4.1,v 1.2 2001/05/23 14:45:01 brianp Exp $ diff --git a/docs/RELNOTES-3.4.2 b/docs/RELNOTES-3.4.2 index 894ed199ff..9caea900d8 100644 --- a/docs/RELNOTES-3.4.2 +++ b/docs/RELNOTES-3.4.2 @@ -19,4 +19,3 @@ the Mesa 3.4.1 release. For details, see the VERSIONS file. ---------------------------------------------------------------------- -$Id: RELNOTES-3.4.2,v 1.2 2001/05/23 14:45:01 brianp Exp $ diff --git a/docs/RELNOTES-3.5 b/docs/RELNOTES-3.5 index 52097a1cd6..b2aa1b852e 100644 --- a/docs/RELNOTES-3.5 +++ b/docs/RELNOTES-3.5 @@ -225,4 +225,3 @@ In the future I hope to implement support for 32-bit, floating point color channels. ---------------------------------------------------------------------- -$Id: RELNOTES-3.5,v 1.14 2001/06/20 19:02:48 brianp Exp $ diff --git a/docs/RELNOTES-4.0 b/docs/RELNOTES-4.0 index e4249cfa17..2f729db158 100644 --- a/docs/RELNOTES-4.0 +++ b/docs/RELNOTES-4.0 @@ -160,4 +160,3 @@ See the VERSIONS file for more details about bug fixes, etc. in Mesa 4.0. ---------------------------------------------------------------------- -$Id: RELNOTES-4.0,v 3.2 2001/10/17 14:59:21 brianp Exp $ diff --git a/docs/RELNOTES-4.0.1 b/docs/RELNOTES-4.0.1 index b4d7efca81..e84df6bf89 100644 --- a/docs/RELNOTES-4.0.1 +++ b/docs/RELNOTES-4.0.1 @@ -19,4 +19,3 @@ Mesa 4.0.1 only contains bug fixes since version 4.0. See the docs/VERSIONS file for the list of bug fixes. ---------------------------------------------------------------------- -$Id: RELNOTES-4.0.1,v 1.2 2001/12/18 14:08:23 brianp Exp $ diff --git a/docs/RELNOTES-4.0.2 b/docs/RELNOTES-4.0.2 index 1b7eaaa8fe..b476956ba2 100644 --- a/docs/RELNOTES-4.0.2 +++ b/docs/RELNOTES-4.0.2 @@ -47,4 +47,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-4.0.2,v 1.2 2002/03/23 02:38:39 brianp Exp $ diff --git a/docs/RELNOTES-4.0.3 b/docs/RELNOTES-4.0.3 index c69b6a279e..0b3e34befe 100644 --- a/docs/RELNOTES-4.0.3 +++ b/docs/RELNOTES-4.0.3 @@ -49,4 +49,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-4.0.3,v 1.2 2002/06/26 02:36:34 brianp Exp $ diff --git a/docs/RELNOTES-4.1 b/docs/RELNOTES-4.1 index 92cf9196f0..24e9299eb2 100644 --- a/docs/RELNOTES-4.1 +++ b/docs/RELNOTES-4.1 @@ -305,4 +305,3 @@ are some things to change: ---------------------------------------------------------------------- -$Id: RELNOTES-4.1,v 1.22 2002/10/29 15:06:37 brianp Exp $ diff --git a/docs/RELNOTES-5.0 b/docs/RELNOTES-5.0 index 565e4ad78e..1b22996d83 100644 --- a/docs/RELNOTES-5.0 +++ b/docs/RELNOTES-5.0 @@ -82,4 +82,3 @@ driver call the _mesa_enable_1_4_extensions() function. ---------------------------------------------------------------------- -$Id: RELNOTES-5.0,v 3.2 2002/11/13 15:33:51 brianp Exp $ diff --git a/docs/RELNOTES-5.0.1 b/docs/RELNOTES-5.0.1 index 8d72cc44c1..f37e9c4a7f 100644 --- a/docs/RELNOTES-5.0.1 +++ b/docs/RELNOTES-5.0.1 @@ -43,4 +43,3 @@ driver call the _mesa_enable_1_4_extensions() function. ---------------------------------------------------------------------- -$Id: RELNOTES-5.0.1,v 3.1 2003/03/30 16:17:54 brianp Exp $ diff --git a/docs/RELNOTES-5.0.2 b/docs/RELNOTES-5.0.2 index cfc9ad04fd..d0e05b2c73 100644 --- a/docs/RELNOTES-5.0.2 +++ b/docs/RELNOTES-5.0.2 @@ -43,4 +43,3 @@ driver call the _mesa_enable_1_4_extensions() function. ---------------------------------------------------------------------- -$Id: RELNOTES-5.0.2,v 1.1 2003/09/04 23:10:38 brianp Exp $ diff --git a/docs/RELNOTES-6.0 b/docs/RELNOTES-6.0 index de01a879a4..1a3c2fb1aa 100644 --- a/docs/RELNOTES-6.0 +++ b/docs/RELNOTES-6.0 @@ -84,4 +84,3 @@ See the VERSIONS file for more details about bug fixes, etc. in Mesa 6.0. ---------------------------------------------------------------------- -$Id: RELNOTES-6.0,v 1.3 2004/01/15 15:47:57 brianp Exp $ diff --git a/docs/RELNOTES-6.0.1 b/docs/RELNOTES-6.0.1 index e72d9fe891..1444b9fc87 100644 --- a/docs/RELNOTES-6.0.1 +++ b/docs/RELNOTES-6.0.1 @@ -47,4 +47,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.0.1,v 3.1 2004/04/02 23:37:02 brianp Exp $ diff --git a/docs/RELNOTES-6.1 b/docs/RELNOTES-6.1 index 830f1e47e7..8de64d1f1c 100644 --- a/docs/RELNOTES-6.1 +++ b/docs/RELNOTES-6.1 @@ -109,4 +109,3 @@ See the VERSIONS file for more details about bug fixes, etc. in Mesa 6.1. ---------------------------------------------------------------------- -$Id: RELNOTES-6.1,v 3.5 2004/08/17 22:58:23 brianp Exp $ diff --git a/docs/RELNOTES-6.2 b/docs/RELNOTES-6.2 index 4043a5655e..06cfba0c75 100644 --- a/docs/RELNOTES-6.2 +++ b/docs/RELNOTES-6.2 @@ -49,4 +49,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.2,v 3.4 2004/10/02 15:43:14 brianp Exp $ diff --git a/docs/RELNOTES-6.2.1 b/docs/RELNOTES-6.2.1 index d72560e5af..c7baa5d421 100644 --- a/docs/RELNOTES-6.2.1 +++ b/docs/RELNOTES-6.2.1 @@ -47,4 +47,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.2.1,v 3.1 2004/12/09 23:21:36 brianp Exp $ diff --git a/docs/RELNOTES-6.3 b/docs/RELNOTES-6.3 index dde335eec1..6b4dfaaf9a 100644 --- a/docs/RELNOTES-6.3 +++ b/docs/RELNOTES-6.3 @@ -112,4 +112,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.3,v 3.13 2005/07/21 15:57:29 brianp Exp $ diff --git a/docs/RELNOTES-6.3.1 b/docs/RELNOTES-6.3.1 index cc6e8be1b2..eacc952aeb 100644 --- a/docs/RELNOTES-6.3.1 +++ b/docs/RELNOTES-6.3.1 @@ -46,4 +46,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.3.1,v 3.1 2005/07/21 18:45:54 brianp Exp $ diff --git a/docs/RELNOTES-6.3.2 b/docs/RELNOTES-6.3.2 index f2d47bff19..e5243ef783 100644 --- a/docs/RELNOTES-6.3.2 +++ b/docs/RELNOTES-6.3.2 @@ -34,4 +34,3 @@ D3D needs updating ---------------------------------------------------------------------- -$Id: RELNOTES-6.3.2,v 3.2 2005/08/19 16:57:50 brianp Exp $ diff --git a/docs/RELNOTES-6.4 b/docs/RELNOTES-6.4 index a12600c3c8..1a945a1039 100644 --- a/docs/RELNOTES-6.4 +++ b/docs/RELNOTES-6.4 @@ -47,4 +47,3 @@ in Mesa 6.3. ---------------------------------------------------------------------- -$Id: RELNOTES-6.4,v 3.1 2005/10/24 23:33:27 brianp Exp $ diff --git a/docs/news.html b/docs/news.html index 58aca31858..b766ce7c75 100644 --- a/docs/news.html +++ b/docs/news.html @@ -1117,6 +1117,5 @@ source code.

-$Id: news.html,v 3.33 2006/12/02 18:18:41 brianp Exp $ diff --git a/include/GL/internal/sarea.h b/include/GL/internal/sarea.h index 77c16e0efe..a0d6084f31 100644 --- a/include/GL/internal/sarea.h +++ b/include/GL/internal/sarea.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/GL/dri/sarea.h,v 1.11 2002/10/30 12:52:03 alanh Exp $ */ /** * \file sarea.h * SAREA definitions. @@ -34,7 +33,6 @@ * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/programs/Xserver/GL/dri/sarea.h,v 1.11 2002/10/30 12:52:03 alanh Exp $ */ #ifndef _SAREA_H_ #define _SAREA_H_ diff --git a/progs/beos/demo.cpp b/progs/beos/demo.cpp index 6b0b9576d6..ae29bb80b2 100644 --- a/progs/beos/demo.cpp +++ b/progs/beos/demo.cpp @@ -1,4 +1,3 @@ -// $Id: demo.cpp,v 1.2 2004/08/14 09:59:16 phoudoin Exp $ // Simple BeOS GLView demo // Written by Brian Paul diff --git a/progs/ggi/gears.c b/progs/ggi/gears.c index ac2e9f2a6e..2b3231d8ae 100644 --- a/progs/ggi/gears.c +++ b/progs/ggi/gears.c @@ -1,4 +1,3 @@ -/* $Id: gears.c,v 1.3 1999/08/22 08:56:50 jtaylor Exp $ */ /* * 3-D gear wheels. This program is in the public domain. diff --git a/progs/miniglx/glfbdevtest.c b/progs/miniglx/glfbdevtest.c index c82ca6e5f6..d4efb96930 100644 --- a/progs/miniglx/glfbdevtest.c +++ b/progs/miniglx/glfbdevtest.c @@ -1,4 +1,3 @@ -/* $Id: glfbdevtest.c,v 1.1 2003/08/06 17:47:15 keithw Exp $ */ /* * Test the GLFBDev interface. Only tested with radeonfb driver!!!! diff --git a/progs/miniglx/manytex.c b/progs/miniglx/manytex.c index 36fa10d222..74b06649f6 100644 --- a/progs/miniglx/manytex.c +++ b/progs/miniglx/manytex.c @@ -1,4 +1,3 @@ -/* $Id: manytex.c,v 1.2 2003/08/23 01:28:59 jonsmirl Exp $ */ /* * test handling of many texture maps diff --git a/progs/miniglx/sample_server.c b/progs/miniglx/sample_server.c index 039c04fa40..62456eca25 100644 --- a/progs/miniglx/sample_server.c +++ b/progs/miniglx/sample_server.c @@ -1,4 +1,3 @@ -/* $Id: sample_server.c,v 1.1 2003/08/06 17:47:15 keithw Exp $ */ /* * Sample server that just keeps first available window mapped. diff --git a/progs/miniglx/sample_server2.c b/progs/miniglx/sample_server2.c index 58effcf484..efd382a6d9 100644 --- a/progs/miniglx/sample_server2.c +++ b/progs/miniglx/sample_server2.c @@ -1,4 +1,3 @@ -/* $Id: sample_server2.c,v 1.2 2003/08/23 01:28:59 jonsmirl Exp $ */ /* * Sample server that just keeps first available window mapped. diff --git a/progs/miniglx/texline.c b/progs/miniglx/texline.c index d2a97d2876..098077f247 100644 --- a/progs/miniglx/texline.c +++ b/progs/miniglx/texline.c @@ -1,4 +1,3 @@ -/* $Id: texline.c,v 1.1 2003/08/06 17:47:15 keithw Exp $ */ /* * Test textured lines. diff --git a/progs/tests/Makefile.win b/progs/tests/Makefile.win index 0de6c42e39..d42e3cb654 100644 --- a/progs/tests/Makefile.win +++ b/progs/tests/Makefile.win @@ -1,4 +1,3 @@ -# $Id: Makefile.win,v 1.1 2002/01/16 01:03:25 kschultz Exp $ # Mesa 3-D graphics library # Version: 3.5 diff --git a/progs/tests/antialias.c b/progs/tests/antialias.c index 79b5ab75c5..3a83c34b8d 100644 --- a/progs/tests/antialias.c +++ b/progs/tests/antialias.c @@ -1,4 +1,3 @@ -/* $Id: antialias.c,v 1.2 2003/03/29 16:42:57 brianp Exp $ */ /* * Test multisampling and polygon smoothing. diff --git a/progs/tests/cva.c b/progs/tests/cva.c index c7677990bf..a47b2a9319 100644 --- a/progs/tests/cva.c +++ b/progs/tests/cva.c @@ -1,4 +1,3 @@ -/* $Id: cva.c,v 1.8 2006/11/22 19:37:21 sroland Exp $ */ /* * Trivial CVA test, good for testing driver fastpaths (especially diff --git a/progs/tests/getprocaddress.py b/progs/tests/getprocaddress.py index d16b2d93d0..8adfc51bd6 100644 --- a/progs/tests/getprocaddress.py +++ b/progs/tests/getprocaddress.py @@ -1,6 +1,5 @@ #!/usr/bin/env python -# $Id: getprocaddress.py,v 1.7 2005/06/21 23:42:43 idr Exp $ # Helper for the getprocaddress.c test. diff --git a/progs/tests/jkrahntest.c b/progs/tests/jkrahntest.c index 85bda8d015..08660b8932 100644 --- a/progs/tests/jkrahntest.c +++ b/progs/tests/jkrahntest.c @@ -1,4 +1,3 @@ -/* $Id: jkrahntest.c,v 1.2 2006/01/30 17:12:10 brianp Exp $ */ /* This is a good test for glXSwapBuffers on non-current windows, * and the glXCopyContext function. Fixed several Mesa/DRI bugs with diff --git a/progs/tests/manytex.c b/progs/tests/manytex.c index 900e5834fe..83c8676657 100644 --- a/progs/tests/manytex.c +++ b/progs/tests/manytex.c @@ -1,4 +1,3 @@ -/* $Id: manytex.c,v 1.5 2005/09/15 01:58:39 brianp Exp $ */ /* * test handling of many texture maps diff --git a/progs/tests/multipal.c b/progs/tests/multipal.c index c824b38703..52818fca7e 100644 --- a/progs/tests/multipal.c +++ b/progs/tests/multipal.c @@ -1,4 +1,3 @@ -/* $Id: multipal.c,v 1.6 2003/12/08 09:03:36 joukj Exp $ */ /* * Test multitexture and paletted textures. diff --git a/progs/tests/multiwindow.c b/progs/tests/multiwindow.c index e004b0336c..b069bea91c 100644 --- a/progs/tests/multiwindow.c +++ b/progs/tests/multiwindow.c @@ -1,4 +1,3 @@ -/* $Id: multiwindow.c,v 1.1 2001/08/21 14:25:31 brianp Exp $ */ /* * A skeleton/template GLUT program @@ -8,7 +7,6 @@ /* - * $Log: multiwindow.c,v $ * Revision 1.1 2001/08/21 14:25:31 brianp * simple multi-window GLUT test prog * diff --git a/progs/tests/sharedtex.c b/progs/tests/sharedtex.c index 7be90d67f5..c07ebd719c 100644 --- a/progs/tests/sharedtex.c +++ b/progs/tests/sharedtex.c @@ -1,4 +1,3 @@ -/* $Id: sharedtex.c,v 1.2 2002/01/16 14:32:46 joukj Exp $ */ /* * Test sharing of display lists and texture objects between GLX contests. diff --git a/progs/tests/texline.c b/progs/tests/texline.c index 3d59d9ac26..ee16ed40df 100644 --- a/progs/tests/texline.c +++ b/progs/tests/texline.c @@ -1,4 +1,3 @@ -/* $Id: texline.c,v 1.5 2004/01/28 10:07:48 keithw Exp $ */ /* * Test textured lines. diff --git a/progs/tests/texrect.c b/progs/tests/texrect.c index 61c1fdd6b4..43edc49180 100644 --- a/progs/tests/texrect.c +++ b/progs/tests/texrect.c @@ -1,4 +1,3 @@ -/* $Id: texrect.c,v 1.5 2004/05/06 20:27:32 brianp Exp $ */ /* GL_NV_texture_rectangle test * diff --git a/progs/tests/texwrap.c b/progs/tests/texwrap.c index 6e9fbe0c70..8143256f8a 100644 --- a/progs/tests/texwrap.c +++ b/progs/tests/texwrap.c @@ -1,4 +1,3 @@ -/* $Id: texwrap.c,v 1.8 2005/08/25 03:09:12 brianp Exp $ */ /* * Test texture wrap modes. diff --git a/progs/util/README b/progs/util/README index ca89d34bd3..ea71ebd2b9 100644 --- a/progs/util/README +++ b/progs/util/README @@ -19,4 +19,3 @@ imagesgi.cpp,.h - read SGI image files more to come... ---------------------------------------------------------------------- -$Id: README,v 1.1 1999/08/19 00:55:42 jtg Exp $ diff --git a/progs/util/glstate.c b/progs/util/glstate.c index 4c5db13ec7..21d7e4552d 100644 --- a/progs/util/glstate.c +++ b/progs/util/glstate.c @@ -1,4 +1,3 @@ -/* $Id: glstate.c,v 1.1 1999/08/19 00:55:42 jtg Exp $ */ /* * Print GL state information (for debugging) @@ -21,7 +20,6 @@ /* - * $Log: glstate.c,v $ * Revision 1.1 1999/08/19 00:55:42 jtg * Initial revision * diff --git a/progs/util/glstate.h b/progs/util/glstate.h index 1aa4d21d8e..9216382b7b 100644 --- a/progs/util/glstate.h +++ b/progs/util/glstate.h @@ -1,4 +1,3 @@ -/* $Id: glstate.h,v 1.1 1999/08/19 00:55:42 jtg Exp $ */ /* * Print GL state information (for debugging) @@ -21,7 +20,6 @@ /* - * $Log: glstate.h,v $ * Revision 1.1 1999/08/19 00:55:42 jtg * Initial revision * diff --git a/progs/util/sampleMakefile b/progs/util/sampleMakefile index ebb57ff3dd..71ec150b88 100644 --- a/progs/util/sampleMakefile +++ b/progs/util/sampleMakefile @@ -1,11 +1,9 @@ -# $Id: sampleMakefile,v 1.1 1999/08/19 00:55:42 jtg Exp $ # Sample makefile for compiling OpenGL/Mesa applications on Unix. # This example assumes Linux with gcc. # This makefile is in the public domain -# $Log: sampleMakefile,v $ # Revision 1.1 1999/08/19 00:55:42 jtg # Initial revision # diff --git a/progs/windml/ugldrawpix.c b/progs/windml/ugldrawpix.c index b33be2c6ae..154fe55970 100644 --- a/progs/windml/ugldrawpix.c +++ b/progs/windml/ugldrawpix.c @@ -7,7 +7,6 @@ */ /* - * $Log: ugldrawpix.c,v $ * Revision 1.2 2001/09/10 19:21:13 brianp * WindML updates (Stephane Raimbault) * diff --git a/progs/windml/ugltexcyl.c b/progs/windml/ugltexcyl.c index d2fe687b92..db66d1ff67 100644 --- a/progs/windml/ugltexcyl.c +++ b/progs/windml/ugltexcyl.c @@ -7,7 +7,6 @@ */ /* - * $Log: ugltexcyl.c,v $ * Revision 1.2 2001/09/10 19:21:13 brianp * WindML updates (Stephane Raimbault) * diff --git a/progs/xdemos/vgears.c b/progs/xdemos/vgears.c index 13d030a8be..f579e8b421 100644 --- a/progs/xdemos/vgears.c +++ b/progs/xdemos/vgears.c @@ -1,4 +1,3 @@ -/* $ID$ */ /* * Spinning gears demo for Linux SVGA/Mesa interface in 32K color mode. diff --git a/src/gallium/winsys/dri/intel/server/i830_common.h b/src/gallium/winsys/dri/intel/server/i830_common.h index f1fd3939ab..f84f453309 100644 --- a/src/gallium/winsys/dri/intel/server/i830_common.h +++ b/src/gallium/winsys/dri/intel/server/i830_common.h @@ -26,7 +26,6 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_common.h,v 1.1 2002/09/11 00:29:32 dawes Exp $ */ #ifndef _I830_COMMON_H_ #define _I830_COMMON_H_ diff --git a/src/gallium/winsys/dri/intel/server/i830_dri.h b/src/gallium/winsys/dri/intel/server/i830_dri.h index c2a3af8cbf..685de4a551 100644 --- a/src/gallium/winsys/dri/intel/server/i830_dri.h +++ b/src/gallium/winsys/dri/intel/server/i830_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_dri.h,v 1.4 2002/10/30 12:52:18 alanh Exp $ */ #ifndef _I830_DRI_H #define _I830_DRI_H diff --git a/src/glu/mini/all.h b/src/glu/mini/all.h index d626bee937..874c935925 100644 --- a/src/glu/mini/all.h +++ b/src/glu/mini/all.h @@ -1,4 +1,3 @@ -/* $Id: all.h,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/glu.c b/src/glu/mini/glu.c index 5c7722c5f0..31429e3343 100644 --- a/src/glu/mini/glu.c +++ b/src/glu/mini/glu.c @@ -1,4 +1,3 @@ -/* $Id: glu.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/gluP.h b/src/glu/mini/gluP.h index 85fbc33c62..a39edce41f 100644 --- a/src/glu/mini/gluP.h +++ b/src/glu/mini/gluP.h @@ -1,4 +1,3 @@ -/* $Id: gluP.h,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/mipmap.c b/src/glu/mini/mipmap.c index 97297729e7..a655d214e3 100644 --- a/src/glu/mini/mipmap.c +++ b/src/glu/mini/mipmap.c @@ -1,4 +1,3 @@ -/* $Id: mipmap.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/nurbs.c b/src/glu/mini/nurbs.c index 93c0dd3ce2..9f39cacb41 100644 --- a/src/glu/mini/nurbs.c +++ b/src/glu/mini/nurbs.c @@ -1,4 +1,3 @@ -/* $Id: nurbs.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/nurbs.h b/src/glu/mini/nurbs.h index c9c9c094f1..3642e213a8 100644 --- a/src/glu/mini/nurbs.h +++ b/src/glu/mini/nurbs.h @@ -1,4 +1,3 @@ -/* $Id: nurbs.h,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/nurbscrv.c b/src/glu/mini/nurbscrv.c index 62d91b46d3..e80468fdb0 100644 --- a/src/glu/mini/nurbscrv.c +++ b/src/glu/mini/nurbscrv.c @@ -1,4 +1,3 @@ -/* $Id: nurbscrv.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/polytest.c b/src/glu/mini/polytest.c index 52f272a3cb..1ff966f61c 100644 --- a/src/glu/mini/polytest.c +++ b/src/glu/mini/polytest.c @@ -1,4 +1,3 @@ -/* $Id: polytest.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/project.c b/src/glu/mini/project.c index a2747de55f..6fa03267e5 100644 --- a/src/glu/mini/project.c +++ b/src/glu/mini/project.c @@ -1,4 +1,3 @@ -/* $Id: project.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/quadric.c b/src/glu/mini/quadric.c index 015552e123..0484890ef6 100644 --- a/src/glu/mini/quadric.c +++ b/src/glu/mini/quadric.c @@ -1,4 +1,3 @@ -/* $Id: quadric.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/tess.c b/src/glu/mini/tess.c index 1a384239be..341d29bae3 100644 --- a/src/glu/mini/tess.c +++ b/src/glu/mini/tess.c @@ -1,4 +1,3 @@ -/* $Id: tess.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/tess.h b/src/glu/mini/tess.h index 908e20972c..4e51dddd37 100644 --- a/src/glu/mini/tess.h +++ b/src/glu/mini/tess.h @@ -1,4 +1,3 @@ -/* $Id: tess.h,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/mini/tesselat.c b/src/glu/mini/tesselat.c index a1102e6e5a..47d230073f 100644 --- a/src/glu/mini/tesselat.c +++ b/src/glu/mini/tesselat.c @@ -1,4 +1,3 @@ -/* $Id: tesselat.c,v 1.2 2003/08/22 20:11:43 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/glu/sgi/dummy.cc b/src/glu/sgi/dummy.cc index fac5a63b76..bd905a2608 100644 --- a/src/glu/sgi/dummy.cc +++ b/src/glu/sgi/dummy.cc @@ -1,4 +1,3 @@ -/* $Id: dummy.cc,v 1.1 2001/03/18 13:06:19 pesco Exp $ */ /* * This file contains nothing. It's just there so there's at least a single * source file for libGLU.la in this directory. diff --git a/src/glu/sgi/libnurbs/interface/bezierEval.h b/src/glu/sgi/libnurbs/interface/bezierEval.h index 1a9f3c78e7..adecfe9b2f 100644 --- a/src/glu/sgi/libnurbs/interface/bezierEval.h +++ b/src/glu/sgi/libnurbs/interface/bezierEval.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/bezierEval.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef _BEZIEREVAL_H diff --git a/src/glu/sgi/libnurbs/interface/bezierPatch.cc b/src/glu/sgi/libnurbs/interface/bezierPatch.cc index 836ae94e0a..fa1daed52e 100644 --- a/src/glu/sgi/libnurbs/interface/bezierPatch.cc +++ b/src/glu/sgi/libnurbs/interface/bezierPatch.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/bezierPatch.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/interface/bezierPatch.h b/src/glu/sgi/libnurbs/interface/bezierPatch.h index 31c97ba08f..ad0f8b0d2a 100644 --- a/src/glu/sgi/libnurbs/interface/bezierPatch.h +++ b/src/glu/sgi/libnurbs/interface/bezierPatch.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/bezierPatch.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef _BEZIERPATCH_H diff --git a/src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc b/src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc index 9ff416ad6e..3dc16313ff 100644 --- a/src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc +++ b/src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/bezierPatchMesh.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/interface/bezierPatchMesh.h b/src/glu/sgi/libnurbs/interface/bezierPatchMesh.h index 74cf098858..2ab24dff5b 100644 --- a/src/glu/sgi/libnurbs/interface/bezierPatchMesh.h +++ b/src/glu/sgi/libnurbs/interface/bezierPatchMesh.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/bezierPatchMesh.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef _BEZIERPATCHMESH_H diff --git a/src/glu/sgi/libnurbs/interface/glcurveval.cc b/src/glu/sgi/libnurbs/interface/glcurveval.cc index 32e4704137..b6591dba0d 100644 --- a/src/glu/sgi/libnurbs/interface/glcurveval.cc +++ b/src/glu/sgi/libnurbs/interface/glcurveval.cc @@ -35,8 +35,6 @@ /* * glcurveval.c++ * - * $Date: 2006/03/29 18:46:46 $ $Revision: 1.7 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/glcurveval.cc,v 1.7 2006/03/29 18:46:46 brianp Exp $ */ /* Polynomial Evaluator Interface */ diff --git a/src/glu/sgi/libnurbs/interface/glimports.h b/src/glu/sgi/libnurbs/interface/glimports.h index 9a9d3e32c9..2c307f63e8 100644 --- a/src/glu/sgi/libnurbs/interface/glimports.h +++ b/src/glu/sgi/libnurbs/interface/glimports.h @@ -35,8 +35,6 @@ /* * glimports.h * - * $Date: 2001/03/19 17:52:02 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/glimports.h,v 1.3 2001/03/19 17:52:02 pesco Exp $ */ #ifndef __gluimports_h_ diff --git a/src/glu/sgi/libnurbs/interface/glinterface.cc b/src/glu/sgi/libnurbs/interface/glinterface.cc index dfd16d1722..ba64bcd2dc 100644 --- a/src/glu/sgi/libnurbs/interface/glinterface.cc +++ b/src/glu/sgi/libnurbs/interface/glinterface.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/07/16 15:46:42 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/glinterface.cc,v 1.2 2001/07/16 15:46:42 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/interface/glrenderer.h b/src/glu/sgi/libnurbs/interface/glrenderer.h index 30f07632a4..8fc23125e0 100644 --- a/src/glu/sgi/libnurbs/interface/glrenderer.h +++ b/src/glu/sgi/libnurbs/interface/glrenderer.h @@ -35,8 +35,6 @@ /* * glrenderer.h * - * $Date: 2004/02/26 14:58:11 $ $Revision: 1.4 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/glrenderer.h,v 1.4 2004/02/26 14:58:11 brianp Exp $ */ #ifndef __gluglrenderer_h_ diff --git a/src/glu/sgi/libnurbs/interface/incurveeval.cc b/src/glu/sgi/libnurbs/interface/incurveeval.cc index 336cca0508..96ea8896ae 100644 --- a/src/glu/sgi/libnurbs/interface/incurveeval.cc +++ b/src/glu/sgi/libnurbs/interface/incurveeval.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2004/05/12 15:29:36 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/incurveeval.cc,v 1.2 2004/05/12 15:29:36 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/interface/insurfeval.cc b/src/glu/sgi/libnurbs/interface/insurfeval.cc index b314699c7a..78d8bece13 100644 --- a/src/glu/sgi/libnurbs/interface/insurfeval.cc +++ b/src/glu/sgi/libnurbs/interface/insurfeval.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2004/05/12 15:29:36 $ $Revision: 1.3 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/insurfeval.cc,v 1.3 2004/05/12 15:29:36 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/interface/mystdio.h b/src/glu/sgi/libnurbs/interface/mystdio.h index 6d737257f7..e9947ea393 100644 --- a/src/glu/sgi/libnurbs/interface/mystdio.h +++ b/src/glu/sgi/libnurbs/interface/mystdio.h @@ -35,8 +35,6 @@ /* * mystdio.h * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.4 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/mystdio.h,v 1.4 2006/03/14 15:08:52 brianp Exp $ */ #ifndef __glumystdio_h_ diff --git a/src/glu/sgi/libnurbs/interface/mystdlib.h b/src/glu/sgi/libnurbs/interface/mystdlib.h index 0ebbc1299f..2520b41e0a 100644 --- a/src/glu/sgi/libnurbs/interface/mystdlib.h +++ b/src/glu/sgi/libnurbs/interface/mystdlib.h @@ -35,8 +35,6 @@ /* * mystdlib.h * - * $Date: 2001/03/19 17:52:02 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/interface/mystdlib.h,v 1.3 2001/03/19 17:52:02 pesco Exp $ */ #ifndef __glumystdlib_h_ diff --git a/src/glu/sgi/libnurbs/internals/arc.h b/src/glu/sgi/libnurbs/internals/arc.h index b700a1e826..bbed33c649 100644 --- a/src/glu/sgi/libnurbs/internals/arc.h +++ b/src/glu/sgi/libnurbs/internals/arc.h @@ -35,8 +35,6 @@ /* * arc.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/arc.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __gluarc_h_ diff --git a/src/glu/sgi/libnurbs/internals/arcsorter.cc b/src/glu/sgi/libnurbs/internals/arcsorter.cc index 1a7f4c6911..1f85cb7108 100644 --- a/src/glu/sgi/libnurbs/internals/arcsorter.cc +++ b/src/glu/sgi/libnurbs/internals/arcsorter.cc @@ -35,8 +35,6 @@ /* * arcsorter.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/arcsorter.cc,v 1.2 2006/03/14 15:08:52 brianp Exp $ */ #ifndef __gluarcsorter_c_ diff --git a/src/glu/sgi/libnurbs/internals/arcsorter.h b/src/glu/sgi/libnurbs/internals/arcsorter.h index 989f80a43c..1025d30b5d 100644 --- a/src/glu/sgi/libnurbs/internals/arcsorter.h +++ b/src/glu/sgi/libnurbs/internals/arcsorter.h @@ -35,8 +35,6 @@ /* * arcsorter.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/arcsorter.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __gluarcsorter_h_ diff --git a/src/glu/sgi/libnurbs/internals/arctess.h b/src/glu/sgi/libnurbs/internals/arctess.h index fc42ea5eb7..d3ea2071ea 100644 --- a/src/glu/sgi/libnurbs/internals/arctess.h +++ b/src/glu/sgi/libnurbs/internals/arctess.h @@ -35,8 +35,6 @@ /* * arctess.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/arctess.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __gluarctess_h_ diff --git a/src/glu/sgi/libnurbs/internals/backend.cc b/src/glu/sgi/libnurbs/internals/backend.cc index 97775a9768..69c46b2d52 100644 --- a/src/glu/sgi/libnurbs/internals/backend.cc +++ b/src/glu/sgi/libnurbs/internals/backend.cc @@ -35,8 +35,6 @@ /* * backend.c++ * - * $Date: 2004/05/12 15:29:36 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/backend.cc,v 1.2 2004/05/12 15:29:36 brianp Exp $ */ /* Bezier surface backend diff --git a/src/glu/sgi/libnurbs/internals/backend.h b/src/glu/sgi/libnurbs/internals/backend.h index c1f00b1a01..fb03859f27 100644 --- a/src/glu/sgi/libnurbs/internals/backend.h +++ b/src/glu/sgi/libnurbs/internals/backend.h @@ -35,8 +35,6 @@ /* * backend.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/backend.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __glubackend_h_ diff --git a/src/glu/sgi/libnurbs/internals/basiccrveval.h b/src/glu/sgi/libnurbs/internals/basiccrveval.h index 0a5f66c201..41abedbb20 100644 --- a/src/glu/sgi/libnurbs/internals/basiccrveval.h +++ b/src/glu/sgi/libnurbs/internals/basiccrveval.h @@ -35,8 +35,6 @@ /* * basiccurveeval.h * - * $Date: 2006/03/29 18:54:00 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/basiccrveval.h,v 1.2 2006/03/29 18:54:00 brianp Exp $ */ #ifndef __glubasiccrveval_h_ diff --git a/src/glu/sgi/libnurbs/internals/basicsurfeval.h b/src/glu/sgi/libnurbs/internals/basicsurfeval.h index a67ded97b5..2fe76ad67d 100644 --- a/src/glu/sgi/libnurbs/internals/basicsurfeval.h +++ b/src/glu/sgi/libnurbs/internals/basicsurfeval.h @@ -35,8 +35,6 @@ /* * basicsurfeval.h * - * $Date: 2006/03/29 18:54:00 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/basicsurfeval.h,v 1.2 2006/03/29 18:54:00 brianp Exp $ */ #ifndef __glubasicsurfeval_h_ diff --git a/src/glu/sgi/libnurbs/internals/bezierarc.h b/src/glu/sgi/libnurbs/internals/bezierarc.h index 64dd31d87d..a6d5a13ee6 100644 --- a/src/glu/sgi/libnurbs/internals/bezierarc.h +++ b/src/glu/sgi/libnurbs/internals/bezierarc.h @@ -35,8 +35,6 @@ /* * bezierarc.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/bezierarc.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __glubezierarc_h diff --git a/src/glu/sgi/libnurbs/internals/bin.cc b/src/glu/sgi/libnurbs/internals/bin.cc index ed427567f9..54b406147b 100644 --- a/src/glu/sgi/libnurbs/internals/bin.cc +++ b/src/glu/sgi/libnurbs/internals/bin.cc @@ -35,8 +35,6 @@ /* * bin.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/bin.cc,v 1.3 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/bin.h b/src/glu/sgi/libnurbs/internals/bin.h index 17d146fdf1..ecdf9b83b8 100644 --- a/src/glu/sgi/libnurbs/internals/bin.h +++ b/src/glu/sgi/libnurbs/internals/bin.h @@ -35,8 +35,6 @@ /* * bin.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/bin.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __glubin_h_ diff --git a/src/glu/sgi/libnurbs/internals/bufpool.cc b/src/glu/sgi/libnurbs/internals/bufpool.cc index d8d9c23db3..f60f7dc7b1 100644 --- a/src/glu/sgi/libnurbs/internals/bufpool.cc +++ b/src/glu/sgi/libnurbs/internals/bufpool.cc @@ -35,8 +35,6 @@ /* * bufpool.c++ * - * $Date: 2004/05/12 15:29:36 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/bufpool.cc,v 1.2 2004/05/12 15:29:36 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/bufpool.h b/src/glu/sgi/libnurbs/internals/bufpool.h index 02e4ff247b..8eaafc4fd0 100644 --- a/src/glu/sgi/libnurbs/internals/bufpool.h +++ b/src/glu/sgi/libnurbs/internals/bufpool.h @@ -35,8 +35,6 @@ /* * bufpool.h * - * $Date: 2006/03/29 18:46:46 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/bufpool.h,v 1.3 2006/03/29 18:46:46 brianp Exp $ */ #ifndef __glubufpool_h_ diff --git a/src/glu/sgi/libnurbs/internals/cachingeval.cc b/src/glu/sgi/libnurbs/internals/cachingeval.cc index 7245ee3a18..3fab38c106 100644 --- a/src/glu/sgi/libnurbs/internals/cachingeval.cc +++ b/src/glu/sgi/libnurbs/internals/cachingeval.cc @@ -35,8 +35,6 @@ /* * cachingeval.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/cachingeval.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "cachingeval.h" diff --git a/src/glu/sgi/libnurbs/internals/cachingeval.h b/src/glu/sgi/libnurbs/internals/cachingeval.h index 578391707a..cb4c83501a 100644 --- a/src/glu/sgi/libnurbs/internals/cachingeval.h +++ b/src/glu/sgi/libnurbs/internals/cachingeval.h @@ -35,8 +35,6 @@ /* * cachingeval.h * - * $Date: 2006/03/29 18:54:00 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/cachingeval.h,v 1.2 2006/03/29 18:54:00 brianp Exp $ */ #ifndef __glucachingval_h_ diff --git a/src/glu/sgi/libnurbs/internals/ccw.cc b/src/glu/sgi/libnurbs/internals/ccw.cc index b1bb6276f7..eb01b7781a 100644 --- a/src/glu/sgi/libnurbs/internals/ccw.cc +++ b/src/glu/sgi/libnurbs/internals/ccw.cc @@ -35,8 +35,6 @@ /* * ccw.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/ccw.cc,v 1.3 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/coveandtiler.h b/src/glu/sgi/libnurbs/internals/coveandtiler.h index 4f4077e208..bb682b75c7 100644 --- a/src/glu/sgi/libnurbs/internals/coveandtiler.h +++ b/src/glu/sgi/libnurbs/internals/coveandtiler.h @@ -35,8 +35,6 @@ /* * coveandtiler.h * - * $Date: 2001/07/16 15:46:42 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/coveandtiler.h,v 1.2 2001/07/16 15:46:42 brianp Exp $ */ #ifndef __glucoveandtiler_h diff --git a/src/glu/sgi/libnurbs/internals/curve.cc b/src/glu/sgi/libnurbs/internals/curve.cc index 5517afa2db..33e2752643 100644 --- a/src/glu/sgi/libnurbs/internals/curve.cc +++ b/src/glu/sgi/libnurbs/internals/curve.cc @@ -35,8 +35,6 @@ /* * curve.c++ * - * $Date: 2004/05/12 15:29:36 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/curve.cc,v 1.3 2004/05/12 15:29:36 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/curve.h b/src/glu/sgi/libnurbs/internals/curve.h index 7b7bd3dc89..6f7b1de9c0 100644 --- a/src/glu/sgi/libnurbs/internals/curve.h +++ b/src/glu/sgi/libnurbs/internals/curve.h @@ -35,8 +35,6 @@ /* * curve.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/curve.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __glucurve_h_ diff --git a/src/glu/sgi/libnurbs/internals/curvelist.cc b/src/glu/sgi/libnurbs/internals/curvelist.cc index e763c62945..872eb5816d 100644 --- a/src/glu/sgi/libnurbs/internals/curvelist.cc +++ b/src/glu/sgi/libnurbs/internals/curvelist.cc @@ -35,8 +35,6 @@ /* * curvelist.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/curvelist.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/curvelist.h b/src/glu/sgi/libnurbs/internals/curvelist.h index d285fb5b98..afbaa353ec 100644 --- a/src/glu/sgi/libnurbs/internals/curvelist.h +++ b/src/glu/sgi/libnurbs/internals/curvelist.h @@ -35,8 +35,6 @@ /* * curvelist.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/curvelist.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __glucurvelist_h_ diff --git a/src/glu/sgi/libnurbs/internals/curvesub.cc b/src/glu/sgi/libnurbs/internals/curvesub.cc index 11b15e4174..f85acc269a 100644 --- a/src/glu/sgi/libnurbs/internals/curvesub.cc +++ b/src/glu/sgi/libnurbs/internals/curvesub.cc @@ -35,8 +35,6 @@ /* * curvesub.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/curvesub.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/dataTransform.cc b/src/glu/sgi/libnurbs/internals/dataTransform.cc index 822da02228..55c0fbb159 100644 --- a/src/glu/sgi/libnurbs/internals/dataTransform.cc +++ b/src/glu/sgi/libnurbs/internals/dataTransform.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2005/10/28 13:09:23 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/dataTransform.cc,v 1.2 2005/10/28 13:09:23 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/dataTransform.h b/src/glu/sgi/libnurbs/internals/dataTransform.h index 1032896f13..08730e174e 100644 --- a/src/glu/sgi/libnurbs/internals/dataTransform.h +++ b/src/glu/sgi/libnurbs/internals/dataTransform.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/dataTransform.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef _DATA_TRANSFORM_H diff --git a/src/glu/sgi/libnurbs/internals/defines.h b/src/glu/sgi/libnurbs/internals/defines.h index 77b6088acc..aae1682e39 100644 --- a/src/glu/sgi/libnurbs/internals/defines.h +++ b/src/glu/sgi/libnurbs/internals/defines.h @@ -35,8 +35,6 @@ /* * defines.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/defines.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __gludefines_h_ diff --git a/src/glu/sgi/libnurbs/internals/displaylist.cc b/src/glu/sgi/libnurbs/internals/displaylist.cc index 4b39a8991d..48593c6371 100644 --- a/src/glu/sgi/libnurbs/internals/displaylist.cc +++ b/src/glu/sgi/libnurbs/internals/displaylist.cc @@ -35,8 +35,6 @@ /* * displaylist.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/displaylist.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/displaylist.h b/src/glu/sgi/libnurbs/internals/displaylist.h index 13cadaeae8..4bd6d76384 100644 --- a/src/glu/sgi/libnurbs/internals/displaylist.h +++ b/src/glu/sgi/libnurbs/internals/displaylist.h @@ -35,8 +35,6 @@ /* * displaylist.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/displaylist.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __gludisplaylist_h_ diff --git a/src/glu/sgi/libnurbs/internals/displaymode.h b/src/glu/sgi/libnurbs/internals/displaymode.h index 791434e6d2..9289b99b89 100644 --- a/src/glu/sgi/libnurbs/internals/displaymode.h +++ b/src/glu/sgi/libnurbs/internals/displaymode.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/displaymode.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __gludisplaymode_h_ diff --git a/src/glu/sgi/libnurbs/internals/flist.cc b/src/glu/sgi/libnurbs/internals/flist.cc index 21414fd736..d3162b9f5f 100644 --- a/src/glu/sgi/libnurbs/internals/flist.cc +++ b/src/glu/sgi/libnurbs/internals/flist.cc @@ -35,8 +35,6 @@ /* * flist.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/flist.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/flist.h b/src/glu/sgi/libnurbs/internals/flist.h index 8450caad45..a643db52b8 100644 --- a/src/glu/sgi/libnurbs/internals/flist.h +++ b/src/glu/sgi/libnurbs/internals/flist.h @@ -35,8 +35,6 @@ /* * flist.h * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/flist.h,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #ifndef __gluflist_h_ diff --git a/src/glu/sgi/libnurbs/internals/flistsorter.cc b/src/glu/sgi/libnurbs/internals/flistsorter.cc index 730613224c..d49bdea3e0 100644 --- a/src/glu/sgi/libnurbs/internals/flistsorter.cc +++ b/src/glu/sgi/libnurbs/internals/flistsorter.cc @@ -35,8 +35,6 @@ /* * flistsorter.c++ * - * $Date: 2001/03/17 00:25:40 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/flistsorter.cc,v 1.1 2001/03/17 00:25:40 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/flistsorter.h b/src/glu/sgi/libnurbs/internals/flistsorter.h index 753ed255b5..d9fe81a85f 100644 --- a/src/glu/sgi/libnurbs/internals/flistsorter.h +++ b/src/glu/sgi/libnurbs/internals/flistsorter.h @@ -35,8 +35,6 @@ /* * flistsorter.h * - * $Date: 2006/03/29 18:54:00 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/flistsorter.h,v 1.2 2006/03/29 18:54:00 brianp Exp $ */ #ifndef __gluflistsorter_h_ diff --git a/src/glu/sgi/libnurbs/internals/gridline.h b/src/glu/sgi/libnurbs/internals/gridline.h index 32b70bbb29..eaa8797217 100644 --- a/src/glu/sgi/libnurbs/internals/gridline.h +++ b/src/glu/sgi/libnurbs/internals/gridline.h @@ -35,8 +35,6 @@ /* * gridline.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/gridline.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glugridline_h_ diff --git a/src/glu/sgi/libnurbs/internals/gridtrimvertex.h b/src/glu/sgi/libnurbs/internals/gridtrimvertex.h index 70a7029c54..72f737a9dc 100644 --- a/src/glu/sgi/libnurbs/internals/gridtrimvertex.h +++ b/src/glu/sgi/libnurbs/internals/gridtrimvertex.h @@ -35,8 +35,6 @@ /* * gridtrimvertex.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/gridtrimvertex.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glugridtrimvertex_h_ diff --git a/src/glu/sgi/libnurbs/internals/gridvertex.h b/src/glu/sgi/libnurbs/internals/gridvertex.h index 2eac57386a..23035a00c5 100644 --- a/src/glu/sgi/libnurbs/internals/gridvertex.h +++ b/src/glu/sgi/libnurbs/internals/gridvertex.h @@ -35,8 +35,6 @@ /* * gridvertex.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/gridvertex.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glugridvertex_h_ diff --git a/src/glu/sgi/libnurbs/internals/hull.cc b/src/glu/sgi/libnurbs/internals/hull.cc index 75f7c160d6..389ba66fb8 100644 --- a/src/glu/sgi/libnurbs/internals/hull.cc +++ b/src/glu/sgi/libnurbs/internals/hull.cc @@ -35,8 +35,6 @@ /* * hull.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/hull.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/hull.h b/src/glu/sgi/libnurbs/internals/hull.h index 34f1593a3e..30ffd6bac3 100644 --- a/src/glu/sgi/libnurbs/internals/hull.h +++ b/src/glu/sgi/libnurbs/internals/hull.h @@ -35,8 +35,6 @@ /* * hull.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/hull.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __gluhull_h_ diff --git a/src/glu/sgi/libnurbs/internals/intersect.cc b/src/glu/sgi/libnurbs/internals/intersect.cc index 6fb7e3239b..b39ea2121e 100644 --- a/src/glu/sgi/libnurbs/internals/intersect.cc +++ b/src/glu/sgi/libnurbs/internals/intersect.cc @@ -35,8 +35,6 @@ /* * intersect.c++ * - * $Date: 2005/10/28 13:09:23 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/intersect.cc,v 1.3 2005/10/28 13:09:23 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/jarcloc.h b/src/glu/sgi/libnurbs/internals/jarcloc.h index 785234f6c0..3582a607a7 100644 --- a/src/glu/sgi/libnurbs/internals/jarcloc.h +++ b/src/glu/sgi/libnurbs/internals/jarcloc.h @@ -35,8 +35,6 @@ /* * jarcloc.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/jarcloc.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glujarcloc_h_ diff --git a/src/glu/sgi/libnurbs/internals/knotvector.h b/src/glu/sgi/libnurbs/internals/knotvector.h index bb1e593326..508fc4f345 100644 --- a/src/glu/sgi/libnurbs/internals/knotvector.h +++ b/src/glu/sgi/libnurbs/internals/knotvector.h @@ -35,8 +35,6 @@ /* * knotvector.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/knotvector.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __gluknotvector_h_ diff --git a/src/glu/sgi/libnurbs/internals/mapdesc.cc b/src/glu/sgi/libnurbs/internals/mapdesc.cc index 14d01582b0..d59f8fd395 100644 --- a/src/glu/sgi/libnurbs/internals/mapdesc.cc +++ b/src/glu/sgi/libnurbs/internals/mapdesc.cc @@ -35,8 +35,6 @@ /* * mapdesc.c++ * - * $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mapdesc.cc,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/mapdesc.h b/src/glu/sgi/libnurbs/internals/mapdesc.h index 3c4ef6ff6c..fe5d650a2a 100644 --- a/src/glu/sgi/libnurbs/internals/mapdesc.h +++ b/src/glu/sgi/libnurbs/internals/mapdesc.h @@ -35,8 +35,6 @@ /* * mapdesc.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mapdesc.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glumapdesc_h_ diff --git a/src/glu/sgi/libnurbs/internals/mapdescv.cc b/src/glu/sgi/libnurbs/internals/mapdescv.cc index 6e4bb40c90..35b38b141b 100644 --- a/src/glu/sgi/libnurbs/internals/mapdescv.cc +++ b/src/glu/sgi/libnurbs/internals/mapdescv.cc @@ -35,8 +35,6 @@ /* * mapdescv.c++ * - * $Date: 2004/05/12 15:29:36 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mapdescv.cc,v 1.3 2004/05/12 15:29:36 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/maplist.cc b/src/glu/sgi/libnurbs/internals/maplist.cc index 44f8666b7a..f944d1529e 100644 --- a/src/glu/sgi/libnurbs/internals/maplist.cc +++ b/src/glu/sgi/libnurbs/internals/maplist.cc @@ -35,8 +35,6 @@ /* * maplist.c++ * - * $Date: 2005/10/28 13:09:23 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/maplist.cc,v 1.2 2005/10/28 13:09:23 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/maplist.h b/src/glu/sgi/libnurbs/internals/maplist.h index ca92def8ca..e86253966d 100644 --- a/src/glu/sgi/libnurbs/internals/maplist.h +++ b/src/glu/sgi/libnurbs/internals/maplist.h @@ -35,8 +35,6 @@ /* * maplist.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/maplist.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glumaplist_h_ diff --git a/src/glu/sgi/libnurbs/internals/mesher.cc b/src/glu/sgi/libnurbs/internals/mesher.cc index 1178eeb516..9cc436adbf 100644 --- a/src/glu/sgi/libnurbs/internals/mesher.cc +++ b/src/glu/sgi/libnurbs/internals/mesher.cc @@ -35,8 +35,6 @@ /* * mesher.c++ * - * $Date: 2001/11/29 16:16:55 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mesher.cc,v 1.3 2001/11/29 16:16:55 kschultz Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/mesher.h b/src/glu/sgi/libnurbs/internals/mesher.h index e4cb4466bc..b9f74f3819 100644 --- a/src/glu/sgi/libnurbs/internals/mesher.h +++ b/src/glu/sgi/libnurbs/internals/mesher.h @@ -35,8 +35,6 @@ /* * mesher.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mesher.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __glumesher_h_ diff --git a/src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc b/src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc index b08cd91570..2830cc743c 100644 --- a/src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc +++ b/src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2005/10/28 13:09:23 $ $Revision: 1.3 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/monoTriangulationBackend.cc,v 1.3 2005/10/28 13:09:23 brianp Exp $ */ #include "monoTriangulation.h" diff --git a/src/glu/sgi/libnurbs/internals/monotonizer.cc b/src/glu/sgi/libnurbs/internals/monotonizer.cc index 7b6685dd06..5845d310ba 100644 --- a/src/glu/sgi/libnurbs/internals/monotonizer.cc +++ b/src/glu/sgi/libnurbs/internals/monotonizer.cc @@ -35,8 +35,6 @@ /* * monotonizer.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/monotonizer.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/monotonizer.h b/src/glu/sgi/libnurbs/internals/monotonizer.h index f516207cb5..7282a8c491 100644 --- a/src/glu/sgi/libnurbs/internals/monotonizer.h +++ b/src/glu/sgi/libnurbs/internals/monotonizer.h @@ -35,7 +35,6 @@ /* * monotonizer.h * - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/monotonizer.h,v 1.2 2006/04/03 22:23:52 ajax Exp $ */ #ifndef __glumonotonizer_h_ diff --git a/src/glu/sgi/libnurbs/internals/myassert.h b/src/glu/sgi/libnurbs/internals/myassert.h index e222c7e43e..9b5ee0f353 100644 --- a/src/glu/sgi/libnurbs/internals/myassert.h +++ b/src/glu/sgi/libnurbs/internals/myassert.h @@ -35,8 +35,6 @@ /* * myassert.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/myassert.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glumyassert_h_ diff --git a/src/glu/sgi/libnurbs/internals/mycode.cc b/src/glu/sgi/libnurbs/internals/mycode.cc index c49f64fa21..3625cacd74 100644 --- a/src/glu/sgi/libnurbs/internals/mycode.cc +++ b/src/glu/sgi/libnurbs/internals/mycode.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mycode.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "mymath.h" diff --git a/src/glu/sgi/libnurbs/internals/mystring.h b/src/glu/sgi/libnurbs/internals/mystring.h index 8b9032bf23..fedf32f114 100644 --- a/src/glu/sgi/libnurbs/internals/mystring.h +++ b/src/glu/sgi/libnurbs/internals/mystring.h @@ -35,8 +35,6 @@ /* * mystring.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/mystring.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glumystring_h_ diff --git a/src/glu/sgi/libnurbs/internals/nurbsconsts.h b/src/glu/sgi/libnurbs/internals/nurbsconsts.h index 7b9dcc39cd..30277d6892 100644 --- a/src/glu/sgi/libnurbs/internals/nurbsconsts.h +++ b/src/glu/sgi/libnurbs/internals/nurbsconsts.h @@ -35,8 +35,6 @@ /* * nurbsconsts.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/nurbsconsts.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glunurbsconsts_h_ diff --git a/src/glu/sgi/libnurbs/internals/nurbstess.cc b/src/glu/sgi/libnurbs/internals/nurbstess.cc index adf7c74626..a5bd060fb0 100644 --- a/src/glu/sgi/libnurbs/internals/nurbstess.cc +++ b/src/glu/sgi/libnurbs/internals/nurbstess.cc @@ -35,8 +35,6 @@ /* * nurbstess.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/nurbstess.cc,v 1.2 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/patch.cc b/src/glu/sgi/libnurbs/internals/patch.cc index 4a524f1de2..808baa69e4 100644 --- a/src/glu/sgi/libnurbs/internals/patch.cc +++ b/src/glu/sgi/libnurbs/internals/patch.cc @@ -35,8 +35,6 @@ /* * patch.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.4 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/patch.cc,v 1.4 2006/03/14 15:08:52 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/patch.h b/src/glu/sgi/libnurbs/internals/patch.h index a214b571f9..d42613b67e 100644 --- a/src/glu/sgi/libnurbs/internals/patch.h +++ b/src/glu/sgi/libnurbs/internals/patch.h @@ -35,8 +35,6 @@ /* * patch.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/patch.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glupatch_h_ diff --git a/src/glu/sgi/libnurbs/internals/patchlist.cc b/src/glu/sgi/libnurbs/internals/patchlist.cc index a640893f1b..989d2dd00a 100644 --- a/src/glu/sgi/libnurbs/internals/patchlist.cc +++ b/src/glu/sgi/libnurbs/internals/patchlist.cc @@ -35,8 +35,6 @@ /* * patchlist.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/patchlist.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/patchlist.h b/src/glu/sgi/libnurbs/internals/patchlist.h index 9fb3795c09..04701c292b 100644 --- a/src/glu/sgi/libnurbs/internals/patchlist.h +++ b/src/glu/sgi/libnurbs/internals/patchlist.h @@ -35,8 +35,6 @@ /* * patchlist.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/patchlist.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glupatchlist_h_ diff --git a/src/glu/sgi/libnurbs/internals/pwlarc.h b/src/glu/sgi/libnurbs/internals/pwlarc.h index 83b7c3f813..b0422b4ded 100644 --- a/src/glu/sgi/libnurbs/internals/pwlarc.h +++ b/src/glu/sgi/libnurbs/internals/pwlarc.h @@ -35,8 +35,6 @@ /* * pwlarc.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/pwlarc.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glupwlarc_h_ diff --git a/src/glu/sgi/libnurbs/internals/quilt.cc b/src/glu/sgi/libnurbs/internals/quilt.cc index f693b370ba..4fc58b7473 100644 --- a/src/glu/sgi/libnurbs/internals/quilt.cc +++ b/src/glu/sgi/libnurbs/internals/quilt.cc @@ -35,8 +35,6 @@ /* * quilt.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/quilt.cc,v 1.3 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/quilt.h b/src/glu/sgi/libnurbs/internals/quilt.h index 336c2574d2..a23c3c11b1 100644 --- a/src/glu/sgi/libnurbs/internals/quilt.h +++ b/src/glu/sgi/libnurbs/internals/quilt.h @@ -35,8 +35,6 @@ /* * quilt.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/quilt.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __gluquilt_h_ diff --git a/src/glu/sgi/libnurbs/internals/reader.cc b/src/glu/sgi/libnurbs/internals/reader.cc index 271a32fbc1..6135eef60e 100644 --- a/src/glu/sgi/libnurbs/internals/reader.cc +++ b/src/glu/sgi/libnurbs/internals/reader.cc @@ -35,8 +35,6 @@ /* * reader.c++ * - * $Date: 2002/11/01 23:35:07 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/reader.cc,v 1.2 2002/11/01 23:35:07 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/reader.h b/src/glu/sgi/libnurbs/internals/reader.h index ac86f8a29f..c826d3812f 100644 --- a/src/glu/sgi/libnurbs/internals/reader.h +++ b/src/glu/sgi/libnurbs/internals/reader.h @@ -35,8 +35,6 @@ /* * reader.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/reader.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __glureader_h_ diff --git a/src/glu/sgi/libnurbs/internals/renderhints.cc b/src/glu/sgi/libnurbs/internals/renderhints.cc index 6a9d37e013..a3aa62d42c 100644 --- a/src/glu/sgi/libnurbs/internals/renderhints.cc +++ b/src/glu/sgi/libnurbs/internals/renderhints.cc @@ -35,8 +35,6 @@ /* * renderhints.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/renderhints.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/renderhints.h b/src/glu/sgi/libnurbs/internals/renderhints.h index efa959e3ab..e248422925 100644 --- a/src/glu/sgi/libnurbs/internals/renderhints.h +++ b/src/glu/sgi/libnurbs/internals/renderhints.h @@ -35,8 +35,6 @@ /* * renderhints.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/renderhints.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glurenderhints_h_ diff --git a/src/glu/sgi/libnurbs/internals/simplemath.h b/src/glu/sgi/libnurbs/internals/simplemath.h index f2efee35f1..195471e23e 100644 --- a/src/glu/sgi/libnurbs/internals/simplemath.h +++ b/src/glu/sgi/libnurbs/internals/simplemath.h @@ -35,8 +35,6 @@ /* * simplemath.h * - * $Date: 2002/11/01 23:35:07 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/simplemath.h,v 1.2 2002/11/01 23:35:07 brianp Exp $ */ #ifndef __glusimplemath_h_ diff --git a/src/glu/sgi/libnurbs/internals/slicer.cc b/src/glu/sgi/libnurbs/internals/slicer.cc index 3fc7e2723a..27d2a650d1 100644 --- a/src/glu/sgi/libnurbs/internals/slicer.cc +++ b/src/glu/sgi/libnurbs/internals/slicer.cc @@ -35,8 +35,6 @@ /* * slicer.c++ * - * $Date: 2005/10/28 13:09:23 $ $Revision: 1.5 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/slicer.cc,v 1.5 2005/10/28 13:09:23 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/internals/slicer.h b/src/glu/sgi/libnurbs/internals/slicer.h index 6027eaa1c0..6700024ba2 100644 --- a/src/glu/sgi/libnurbs/internals/slicer.h +++ b/src/glu/sgi/libnurbs/internals/slicer.h @@ -35,8 +35,6 @@ /* * slicer.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/slicer.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __gluslicer_h_ diff --git a/src/glu/sgi/libnurbs/internals/sorter.cc b/src/glu/sgi/libnurbs/internals/sorter.cc index bf13a68d72..7a79941492 100644 --- a/src/glu/sgi/libnurbs/internals/sorter.cc +++ b/src/glu/sgi/libnurbs/internals/sorter.cc @@ -35,8 +35,6 @@ /* * sorter.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/sorter.cc,v 1.3 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/sorter.h b/src/glu/sgi/libnurbs/internals/sorter.h index e9c98affa7..0f6b43be37 100644 --- a/src/glu/sgi/libnurbs/internals/sorter.h +++ b/src/glu/sgi/libnurbs/internals/sorter.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2006/03/29 18:54:00 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/sorter.h,v 1.2 2006/03/29 18:54:00 brianp Exp $ */ #ifndef __glusorter_h_ diff --git a/src/glu/sgi/libnurbs/internals/splitarcs.cc b/src/glu/sgi/libnurbs/internals/splitarcs.cc index 716f6b9aae..1f79d543fb 100644 --- a/src/glu/sgi/libnurbs/internals/splitarcs.cc +++ b/src/glu/sgi/libnurbs/internals/splitarcs.cc @@ -35,8 +35,6 @@ /* * splitarcs.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/splitarcs.cc,v 1.2 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/subdivider.h b/src/glu/sgi/libnurbs/internals/subdivider.h index 48aff36b44..37970d6942 100644 --- a/src/glu/sgi/libnurbs/internals/subdivider.h +++ b/src/glu/sgi/libnurbs/internals/subdivider.h @@ -35,8 +35,6 @@ /* * subdivider.h * - * $Date: 2001/08/07 17:34:11 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/subdivider.h,v 1.2 2001/08/07 17:34:11 brianp Exp $ */ #ifndef __glusubdivider_h_ diff --git a/src/glu/sgi/libnurbs/internals/tobezier.cc b/src/glu/sgi/libnurbs/internals/tobezier.cc index 95ef3b68b4..531f26bc78 100644 --- a/src/glu/sgi/libnurbs/internals/tobezier.cc +++ b/src/glu/sgi/libnurbs/internals/tobezier.cc @@ -35,8 +35,6 @@ /* * tobezier.c++ * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/tobezier.cc,v 1.2 2006/03/14 15:08:52 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/trimline.cc b/src/glu/sgi/libnurbs/internals/trimline.cc index 231369b6ef..61f34cd38a 100644 --- a/src/glu/sgi/libnurbs/internals/trimline.cc +++ b/src/glu/sgi/libnurbs/internals/trimline.cc @@ -35,8 +35,6 @@ /* * trimline.c++ * - * $Date: 2005/10/28 13:09:23 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimline.cc,v 1.2 2005/10/28 13:09:23 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/trimline.h b/src/glu/sgi/libnurbs/internals/trimline.h index d28574d3e5..5d52e30aba 100644 --- a/src/glu/sgi/libnurbs/internals/trimline.h +++ b/src/glu/sgi/libnurbs/internals/trimline.h @@ -35,8 +35,6 @@ /* * trimline.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimline.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glutrimline_h_ diff --git a/src/glu/sgi/libnurbs/internals/trimregion.cc b/src/glu/sgi/libnurbs/internals/trimregion.cc index 64b4ffc10e..efe7893569 100644 --- a/src/glu/sgi/libnurbs/internals/trimregion.cc +++ b/src/glu/sgi/libnurbs/internals/trimregion.cc @@ -35,8 +35,6 @@ /* * trimregion.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimregion.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/trimregion.h b/src/glu/sgi/libnurbs/internals/trimregion.h index 263b8d4719..6534a8c1da 100644 --- a/src/glu/sgi/libnurbs/internals/trimregion.h +++ b/src/glu/sgi/libnurbs/internals/trimregion.h @@ -35,8 +35,6 @@ /* * trimregion.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimregion.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glutrimregion_h_ diff --git a/src/glu/sgi/libnurbs/internals/trimvertex.h b/src/glu/sgi/libnurbs/internals/trimvertex.h index 8ded26a648..85f1162167 100644 --- a/src/glu/sgi/libnurbs/internals/trimvertex.h +++ b/src/glu/sgi/libnurbs/internals/trimvertex.h @@ -35,8 +35,6 @@ /* * trimvertex.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimvertex.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glutrimvertex_h_ diff --git a/src/glu/sgi/libnurbs/internals/trimvertpool.cc b/src/glu/sgi/libnurbs/internals/trimvertpool.cc index 7c12ab3999..3e5bd70380 100644 --- a/src/glu/sgi/libnurbs/internals/trimvertpool.cc +++ b/src/glu/sgi/libnurbs/internals/trimvertpool.cc @@ -35,8 +35,6 @@ /* * trimvertexpool.c++ * - * $Date: 2003/05/08 15:47:00 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimvertpool.cc,v 1.2 2003/05/08 15:47:00 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/trimvertpool.h b/src/glu/sgi/libnurbs/internals/trimvertpool.h index deb8d4c534..2420e8cca4 100644 --- a/src/glu/sgi/libnurbs/internals/trimvertpool.h +++ b/src/glu/sgi/libnurbs/internals/trimvertpool.h @@ -35,8 +35,6 @@ /* * trimvertexpool.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/trimvertpool.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glutrimvertpool_h_ diff --git a/src/glu/sgi/libnurbs/internals/types.h b/src/glu/sgi/libnurbs/internals/types.h index d8e7751d0b..3f89e52593 100644 --- a/src/glu/sgi/libnurbs/internals/types.h +++ b/src/glu/sgi/libnurbs/internals/types.h @@ -35,8 +35,6 @@ /* * types.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/types.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __glutypes_h_ diff --git a/src/glu/sgi/libnurbs/internals/uarray.cc b/src/glu/sgi/libnurbs/internals/uarray.cc index 0cc3c8d273..f0e2364373 100644 --- a/src/glu/sgi/libnurbs/internals/uarray.cc +++ b/src/glu/sgi/libnurbs/internals/uarray.cc @@ -35,8 +35,6 @@ /* * uarray.c++ * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/uarray.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/uarray.h b/src/glu/sgi/libnurbs/internals/uarray.h index e7a7e00d10..908b8ccfc8 100644 --- a/src/glu/sgi/libnurbs/internals/uarray.h +++ b/src/glu/sgi/libnurbs/internals/uarray.h @@ -35,8 +35,6 @@ /* * uarray.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/uarray.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __gluuarray_h_ diff --git a/src/glu/sgi/libnurbs/internals/varray.cc b/src/glu/sgi/libnurbs/internals/varray.cc index 969bba080e..31cc73a9d0 100644 --- a/src/glu/sgi/libnurbs/internals/varray.cc +++ b/src/glu/sgi/libnurbs/internals/varray.cc @@ -35,8 +35,6 @@ /* * varray.c++ * - * $Date: 2002/11/01 23:35:07 $ $Revision: 1.2 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/varray.cc,v 1.2 2002/11/01 23:35:07 brianp Exp $ */ #include "glimports.h" diff --git a/src/glu/sgi/libnurbs/internals/varray.h b/src/glu/sgi/libnurbs/internals/varray.h index 5fb2541425..8408f27bae 100644 --- a/src/glu/sgi/libnurbs/internals/varray.h +++ b/src/glu/sgi/libnurbs/internals/varray.h @@ -35,8 +35,6 @@ /* * varray.h * - * $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/internals/varray.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __gluvarray_h_ diff --git a/src/glu/sgi/libnurbs/nurbtess/definitions.h b/src/glu/sgi/libnurbs/nurbtess/definitions.h index 216d479b1a..8dcbf20050 100644 --- a/src/glu/sgi/libnurbs/nurbtess/definitions.h +++ b/src/glu/sgi/libnurbs/nurbtess/definitions.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/definitions.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _DEFINITIONS_H diff --git a/src/glu/sgi/libnurbs/nurbtess/directedLine.h b/src/glu/sgi/libnurbs/nurbtess/directedLine.h index 009295e61e..9d68183ad3 100644 --- a/src/glu/sgi/libnurbs/nurbtess/directedLine.h +++ b/src/glu/sgi/libnurbs/nurbtess/directedLine.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/directedLine.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _DIRECTEDLINE_H diff --git a/src/glu/sgi/libnurbs/nurbtess/glimports.h b/src/glu/sgi/libnurbs/nurbtess/glimports.h index cb370218c0..2c307f63e8 100644 --- a/src/glu/sgi/libnurbs/nurbtess/glimports.h +++ b/src/glu/sgi/libnurbs/nurbtess/glimports.h @@ -35,8 +35,6 @@ /* * glimports.h * - * $Date: 2001/03/19 17:52:03 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/glimports.h,v 1.3 2001/03/19 17:52:03 pesco Exp $ */ #ifndef __gluimports_h_ diff --git a/src/glu/sgi/libnurbs/nurbtess/gridWrap.cc b/src/glu/sgi/libnurbs/nurbtess/gridWrap.cc index 6df10c4385..3c92039bae 100644 --- a/src/glu/sgi/libnurbs/nurbtess/gridWrap.cc +++ b/src/glu/sgi/libnurbs/nurbtess/gridWrap.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/gridWrap.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/nurbtess/gridWrap.h b/src/glu/sgi/libnurbs/nurbtess/gridWrap.h index 1c8237fe27..723988d2d0 100644 --- a/src/glu/sgi/libnurbs/nurbtess/gridWrap.h +++ b/src/glu/sgi/libnurbs/nurbtess/gridWrap.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/gridWrap.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _GRIDWRAP_H diff --git a/src/glu/sgi/libnurbs/nurbtess/monoChain.cc b/src/glu/sgi/libnurbs/nurbtess/monoChain.cc index dccbb2bbc0..814bf32fae 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoChain.cc +++ b/src/glu/sgi/libnurbs/nurbtess/monoChain.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2005/10/28 13:09:23 $ $Revision: 1.3 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/monoChain.cc,v 1.3 2005/10/28 13:09:23 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/nurbtess/monoChain.h b/src/glu/sgi/libnurbs/nurbtess/monoChain.h index e25b18028c..0302ff9ce2 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoChain.h +++ b/src/glu/sgi/libnurbs/nurbtess/monoChain.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/monoChain.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _MONO_CHAIN_H diff --git a/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.cc b/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.cc index 6405d277fe..8391205bf7 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.cc +++ b/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.cc @@ -31,7 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* *monoPolyPart.C diff --git a/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.h b/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.h index b760862dcb..51a664de34 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.h +++ b/src/glu/sgi/libnurbs/nurbtess/monoPolyPart.h @@ -31,7 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* *monoPolyPart.h diff --git a/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc b/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc index d168374c98..8e8d49dda7 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc +++ b/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2006/03/29 18:46:46 $ $Revision: 1.5 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.cc,v 1.5 2006/03/29 18:46:46 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h b/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h index 002549ecbd..86b8b7164b 100644 --- a/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h +++ b/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/monoTriangulation.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _MONO_TRIANGULATION_H diff --git a/src/glu/sgi/libnurbs/nurbtess/mystdio.h b/src/glu/sgi/libnurbs/nurbtess/mystdio.h index a7594eecd6..e9947ea393 100644 --- a/src/glu/sgi/libnurbs/nurbtess/mystdio.h +++ b/src/glu/sgi/libnurbs/nurbtess/mystdio.h @@ -35,8 +35,6 @@ /* * mystdio.h * - * $Date: 2006/03/14 15:08:52 $ $Revision: 1.4 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/mystdio.h,v 1.4 2006/03/14 15:08:52 brianp Exp $ */ #ifndef __glumystdio_h_ diff --git a/src/glu/sgi/libnurbs/nurbtess/mystdlib.h b/src/glu/sgi/libnurbs/nurbtess/mystdlib.h index d28e70bd51..2520b41e0a 100644 --- a/src/glu/sgi/libnurbs/nurbtess/mystdlib.h +++ b/src/glu/sgi/libnurbs/nurbtess/mystdlib.h @@ -35,8 +35,6 @@ /* * mystdlib.h * - * $Date: 2001/03/19 17:52:03 $ $Revision: 1.3 $ - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/mystdlib.h,v 1.3 2001/03/19 17:52:03 pesco Exp $ */ #ifndef __glumystdlib_h_ diff --git a/src/glu/sgi/libnurbs/nurbtess/partitionX.cc b/src/glu/sgi/libnurbs/nurbtess/partitionX.cc index bfe77123c4..e25e30b0f3 100644 --- a/src/glu/sgi/libnurbs/nurbtess/partitionX.cc +++ b/src/glu/sgi/libnurbs/nurbtess/partitionX.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/partitionX.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/partitionX.h b/src/glu/sgi/libnurbs/nurbtess/partitionX.h index cd18f0eb02..bef724fe1f 100644 --- a/src/glu/sgi/libnurbs/nurbtess/partitionX.h +++ b/src/glu/sgi/libnurbs/nurbtess/partitionX.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/partitionX.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _PARTITIONX_H diff --git a/src/glu/sgi/libnurbs/nurbtess/partitionY.cc b/src/glu/sgi/libnurbs/nurbtess/partitionY.cc index 216ac07e06..297c629976 100644 --- a/src/glu/sgi/libnurbs/nurbtess/partitionY.cc +++ b/src/glu/sgi/libnurbs/nurbtess/partitionY.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/partitionY.cc,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/partitionY.h b/src/glu/sgi/libnurbs/nurbtess/partitionY.h index b810693a5c..7e62aeaa9d 100644 --- a/src/glu/sgi/libnurbs/nurbtess/partitionY.h +++ b/src/glu/sgi/libnurbs/nurbtess/partitionY.h @@ -31,7 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* *partitionY.h: @@ -53,7 +52,6 @@ *A vertex is an interior cusp if it is a cusp and a reflex. *A vertex is an exterior cusp if it is a cusp but not a reflex. * - * $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/partitionY.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _PARTITIONY_H diff --git a/src/glu/sgi/libnurbs/nurbtess/polyDBG.h b/src/glu/sgi/libnurbs/nurbtess/polyDBG.h index a5125a50d1..832fe05093 100644 --- a/src/glu/sgi/libnurbs/nurbtess/polyDBG.h +++ b/src/glu/sgi/libnurbs/nurbtess/polyDBG.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/polyDBG.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _POLYDBG_H diff --git a/src/glu/sgi/libnurbs/nurbtess/polyUtil.cc b/src/glu/sgi/libnurbs/nurbtess/polyUtil.cc index 1a17bcc78a..f9a27f402c 100644 --- a/src/glu/sgi/libnurbs/nurbtess/polyUtil.cc +++ b/src/glu/sgi/libnurbs/nurbtess/polyUtil.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/polyUtil.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/polyUtil.h b/src/glu/sgi/libnurbs/nurbtess/polyUtil.h index 19c76d37d3..010838a9cc 100644 --- a/src/glu/sgi/libnurbs/nurbtess/polyUtil.h +++ b/src/glu/sgi/libnurbs/nurbtess/polyUtil.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/polyUtil.h,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #ifndef _POLYUTIL_H diff --git a/src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc b/src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc index 2d54b155ee..26d05342f9 100644 --- a/src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc +++ b/src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/primitiveStream.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/nurbtess/primitiveStream.h b/src/glu/sgi/libnurbs/nurbtess/primitiveStream.h index 438d4ad6b0..8063dcd622 100644 --- a/src/glu/sgi/libnurbs/nurbtess/primitiveStream.h +++ b/src/glu/sgi/libnurbs/nurbtess/primitiveStream.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/primitiveStream.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ /*we do not use the constans GL_... so that this file is independent of diff --git a/src/glu/sgi/libnurbs/nurbtess/quicksort.cc b/src/glu/sgi/libnurbs/nurbtess/quicksort.cc index f411aaa82a..9d0b290b39 100644 --- a/src/glu/sgi/libnurbs/nurbtess/quicksort.cc +++ b/src/glu/sgi/libnurbs/nurbtess/quicksort.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2002/04/17 19:30:41 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/quicksort.cc,v 1.2 2002/04/17 19:30:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/quicksort.h b/src/glu/sgi/libnurbs/nurbtess/quicksort.h index af245615b3..1a32188ee1 100644 --- a/src/glu/sgi/libnurbs/nurbtess/quicksort.h +++ b/src/glu/sgi/libnurbs/nurbtess/quicksort.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/quicksort.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _QUICKSORT_H diff --git a/src/glu/sgi/libnurbs/nurbtess/rectBlock.cc b/src/glu/sgi/libnurbs/nurbtess/rectBlock.cc index 932683ccac..f457b15733 100644 --- a/src/glu/sgi/libnurbs/nurbtess/rectBlock.cc +++ b/src/glu/sgi/libnurbs/nurbtess/rectBlock.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/rectBlock.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/nurbtess/rectBlock.h b/src/glu/sgi/libnurbs/nurbtess/rectBlock.h index d98b5a03e1..ce546442df 100644 --- a/src/glu/sgi/libnurbs/nurbtess/rectBlock.h +++ b/src/glu/sgi/libnurbs/nurbtess/rectBlock.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/rectBlock.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _RECTBLOCK_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleComp.cc b/src/glu/sgi/libnurbs/nurbtess/sampleComp.cc index b58de10af7..861c71bb38 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleComp.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampleComp.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2005/10/28 13:09:23 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleComp.cc,v 1.2 2005/10/28 13:09:23 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleComp.h b/src/glu/sgi/libnurbs/nurbtess/sampleComp.h index 8bdc4c41eb..e35e5e291d 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleComp.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampleComp.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleComp.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLECOMP_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc b/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc index b66647aa99..e12f88bab1 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.cc,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h b/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h index f48dceaea6..6debef9119 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompBot.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLECOMPBOT_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc b/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc index e25b53c1a9..d01e50018b 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2006/08/30 19:02:45 $ $Revision: 1.4 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.cc,v 1.4 2006/08/30 19:02:45 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h b/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h index 747e35e6ad..b4b0e0732e 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompRight.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLECOMPRIGHT_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc b/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc index 0d012d47ce..b7b929623a 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.cc,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h b/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h index 6875ad57e2..695092c586 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleCompTop.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLECOMPTOP_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc b/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc index c1b045437c..051f241083 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2005/10/28 13:09:23 $ $Revision: 1.5 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.cc,v 1.5 2005/10/28 13:09:23 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h b/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h index 3bfa0d4393..777a28fa2b 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampleMonoPoly.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLEMONOPOLY_H diff --git a/src/glu/sgi/libnurbs/nurbtess/sampledLine.cc b/src/glu/sgi/libnurbs/nurbtess/sampledLine.cc index 15332eb41c..6253a7c09d 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampledLine.cc +++ b/src/glu/sgi/libnurbs/nurbtess/sampledLine.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/11/29 16:16:55 $ $Revision: 1.2 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampledLine.cc,v 1.2 2001/11/29 16:16:55 kschultz Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/sampledLine.h b/src/glu/sgi/libnurbs/nurbtess/sampledLine.h index 8925197ab3..147b8a5e12 100644 --- a/src/glu/sgi/libnurbs/nurbtess/sampledLine.h +++ b/src/glu/sgi/libnurbs/nurbtess/sampledLine.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/sampledLine.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SAMPLEDLINE_H diff --git a/src/glu/sgi/libnurbs/nurbtess/searchTree.cc b/src/glu/sgi/libnurbs/nurbtess/searchTree.cc index 45c2412b48..1865755a48 100644 --- a/src/glu/sgi/libnurbs/nurbtess/searchTree.cc +++ b/src/glu/sgi/libnurbs/nurbtess/searchTree.cc @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/searchTree.cc,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libnurbs/nurbtess/searchTree.h b/src/glu/sgi/libnurbs/nurbtess/searchTree.h index 4272248528..246099fbac 100644 --- a/src/glu/sgi/libnurbs/nurbtess/searchTree.h +++ b/src/glu/sgi/libnurbs/nurbtess/searchTree.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/searchTree.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef _SEARCHTREE_H diff --git a/src/glu/sgi/libnurbs/nurbtess/zlassert.h b/src/glu/sgi/libnurbs/nurbtess/zlassert.h index 6a3720853b..6891385196 100644 --- a/src/glu/sgi/libnurbs/nurbtess/zlassert.h +++ b/src/glu/sgi/libnurbs/nurbtess/zlassert.h @@ -31,10 +31,8 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ */ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libnurbs/nurbtess/zlassert.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ /*XXXblythe this file should be deleted*/ diff --git a/src/glu/sgi/libtess/README b/src/glu/sgi/libtess/README index 7c314b74a0..66a6011e25 100644 --- a/src/glu/sgi/libtess/README +++ b/src/glu/sgi/libtess/README @@ -1,5 +1,4 @@ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/README,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ General Polygon Tesselation diff --git a/src/glu/sgi/libtess/alg-outline b/src/glu/sgi/libtess/alg-outline index f51d68ce3b..33fd69728a 100644 --- a/src/glu/sgi/libtess/alg-outline +++ b/src/glu/sgi/libtess/alg-outline @@ -1,5 +1,4 @@ /* -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/alg-outline,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ This is only a very brief overview. There is quite a bit of diff --git a/src/glu/sgi/libtess/dict-list.h b/src/glu/sgi/libtess/dict-list.h index f5b82116d8..8cc1069c52 100644 --- a/src/glu/sgi/libtess/dict-list.h +++ b/src/glu/sgi/libtess/dict-list.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/dict-list.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __dict_list_h_ diff --git a/src/glu/sgi/libtess/dict.c b/src/glu/sgi/libtess/dict.c index e3750eea22..f42565f2ff 100644 --- a/src/glu/sgi/libtess/dict.c +++ b/src/glu/sgi/libtess/dict.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2006/04/19 14:42:01 $ $Revision: 1.3 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/dict.c,v 1.3 2006/04/19 14:42:01 brianp Exp $ */ #include diff --git a/src/glu/sgi/libtess/dict.h b/src/glu/sgi/libtess/dict.h index ea3b4064ff..8cc1069c52 100644 --- a/src/glu/sgi/libtess/dict.h +++ b/src/glu/sgi/libtess/dict.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/dict.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __dict_list_h_ diff --git a/src/glu/sgi/libtess/geom.c b/src/glu/sgi/libtess/geom.c index d009e143ad..4551531751 100644 --- a/src/glu/sgi/libtess/geom.c +++ b/src/glu/sgi/libtess/geom.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/geom.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libtess/memalloc.c b/src/glu/sgi/libtess/memalloc.c index 61fd59aaed..11fd33b3d7 100644 --- a/src/glu/sgi/libtess/memalloc.c +++ b/src/glu/sgi/libtess/memalloc.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/memalloc.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "memalloc.h" diff --git a/src/glu/sgi/libtess/memalloc.h b/src/glu/sgi/libtess/memalloc.h index 97f223759d..5cbdb5342e 100644 --- a/src/glu/sgi/libtess/memalloc.h +++ b/src/glu/sgi/libtess/memalloc.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2003/07/24 22:41:17 $ $Revision: 1.4 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/memalloc.h,v 1.4 2003/07/24 22:41:17 brianp Exp $ */ #ifndef __memalloc_simple_h_ diff --git a/src/glu/sgi/libtess/mesh.c b/src/glu/sgi/libtess/mesh.c index 045954db91..4ffe1a6142 100644 --- a/src/glu/sgi/libtess/mesh.c +++ b/src/glu/sgi/libtess/mesh.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/mesh.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libtess/mesh.h b/src/glu/sgi/libtess/mesh.h index 6224df415b..299b1bacb0 100644 --- a/src/glu/sgi/libtess/mesh.h +++ b/src/glu/sgi/libtess/mesh.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/mesh.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __mesh_h_ diff --git a/src/glu/sgi/libtess/normal.h b/src/glu/sgi/libtess/normal.h index c8e334f45f..9a805d56f9 100644 --- a/src/glu/sgi/libtess/normal.h +++ b/src/glu/sgi/libtess/normal.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/normal.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __normal_h_ diff --git a/src/glu/sgi/libtess/priorityq-heap.c b/src/glu/sgi/libtess/priorityq-heap.c index 6b77155e1e..3f8a6f5f0d 100644 --- a/src/glu/sgi/libtess/priorityq-heap.c +++ b/src/glu/sgi/libtess/priorityq-heap.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/priorityq-heap.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include diff --git a/src/glu/sgi/libtess/priorityq-heap.h b/src/glu/sgi/libtess/priorityq-heap.h index 39c33c3921..095cc3456c 100644 --- a/src/glu/sgi/libtess/priorityq-heap.h +++ b/src/glu/sgi/libtess/priorityq-heap.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/priorityq-heap.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __priorityq_heap_h_ diff --git a/src/glu/sgi/libtess/priorityq-sort.h b/src/glu/sgi/libtess/priorityq-sort.h index 2439238793..9e62e983e9 100644 --- a/src/glu/sgi/libtess/priorityq-sort.h +++ b/src/glu/sgi/libtess/priorityq-sort.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/priorityq-sort.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __priorityq_sort_h_ diff --git a/src/glu/sgi/libtess/priorityq.c b/src/glu/sgi/libtess/priorityq.c index fffa1d5255..7eac424e96 100644 --- a/src/glu/sgi/libtess/priorityq.c +++ b/src/glu/sgi/libtess/priorityq.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/priorityq.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libtess/priorityq.h b/src/glu/sgi/libtess/priorityq.h index 97ed707578..9e62e983e9 100644 --- a/src/glu/sgi/libtess/priorityq.h +++ b/src/glu/sgi/libtess/priorityq.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/priorityq.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __priorityq_sort_h_ diff --git a/src/glu/sgi/libtess/render.c b/src/glu/sgi/libtess/render.c index 97751dc810..c2b12b35c3 100644 --- a/src/glu/sgi/libtess/render.c +++ b/src/glu/sgi/libtess/render.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/render.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libtess/render.h b/src/glu/sgi/libtess/render.h index 956569bb77..271e616c19 100644 --- a/src/glu/sgi/libtess/render.h +++ b/src/glu/sgi/libtess/render.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/render.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __render_h_ diff --git a/src/glu/sgi/libtess/sweep.h b/src/glu/sgi/libtess/sweep.h index 2223f52f59..74c375c9b3 100644 --- a/src/glu/sgi/libtess/sweep.h +++ b/src/glu/sgi/libtess/sweep.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/sweep.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __sweep_h_ diff --git a/src/glu/sgi/libtess/tess.h b/src/glu/sgi/libtess/tess.h index 2ba00b6ddb..d705d04c6e 100644 --- a/src/glu/sgi/libtess/tess.h +++ b/src/glu/sgi/libtess/tess.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/tess.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __tess_h_ diff --git a/src/glu/sgi/libtess/tessmono.c b/src/glu/sgi/libtess/tessmono.c index 77fe0ac619..a2b6eccbac 100644 --- a/src/glu/sgi/libtess/tessmono.c +++ b/src/glu/sgi/libtess/tessmono.c @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/tessmono.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libtess/tessmono.h b/src/glu/sgi/libtess/tessmono.h index 01f244f6ec..cbe8950d20 100644 --- a/src/glu/sgi/libtess/tessmono.h +++ b/src/glu/sgi/libtess/tessmono.h @@ -35,8 +35,6 @@ /* ** Author: Eric Veach, July 1994. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libtess/tessmono.h,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #ifndef __tessmono_h_ diff --git a/src/glu/sgi/libutil/error.c b/src/glu/sgi/libutil/error.c index 3d1ce9b210..24d8b70f88 100644 --- a/src/glu/sgi/libutil/error.c +++ b/src/glu/sgi/libutil/error.c @@ -31,8 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2006/06/20 15:30:26 $ $Revision: 1.3 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libutil/error.c,v 1.3 2006/06/20 15:30:26 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libutil/glue.c b/src/glu/sgi/libutil/glue.c index a0471bbe2e..6a4e6c7c6f 100644 --- a/src/glu/sgi/libutil/glue.c +++ b/src/glu/sgi/libutil/glue.c @@ -31,8 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/09/24 09:40:40 $ $Revision: 1.3 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libutil/glue.c,v 1.3 2001/09/24 09:40:40 joukj Exp $ */ #include diff --git a/src/glu/sgi/libutil/gluint.h b/src/glu/sgi/libutil/gluint.h index f08401df7a..cd2a56fed9 100644 --- a/src/glu/sgi/libutil/gluint.h +++ b/src/glu/sgi/libutil/gluint.h @@ -31,8 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/09/20 21:50:53 $ $Revision: 1.2 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libutil/gluint.h,v 1.2 2001/09/20 21:50:53 kschultz Exp $ */ #ifndef __gluint_h__ diff --git a/src/glu/sgi/libutil/project.c b/src/glu/sgi/libutil/project.c index 2b20ad4fb3..5ba396ca1c 100644 --- a/src/glu/sgi/libutil/project.c +++ b/src/glu/sgi/libutil/project.c @@ -31,8 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2006/05/01 16:01:17 $ $Revision: 1.6 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libutil/project.c,v 1.6 2006/05/01 16:01:17 brianp Exp $ */ #include "gluos.h" diff --git a/src/glu/sgi/libutil/registry.c b/src/glu/sgi/libutil/registry.c index e486ffa8ca..d83d2fef11 100644 --- a/src/glu/sgi/libutil/registry.c +++ b/src/glu/sgi/libutil/registry.c @@ -31,8 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. ** -** $Date: 2001/03/17 00:25:41 $ $Revision: 1.1 $ -** $Header: /home/krh/git/sync/mesa-cvs-repo/Mesa/src/glu/sgi/libutil/registry.c,v 1.1 2001/03/17 00:25:41 brianp Exp $ */ #include "gluos.h" diff --git a/src/glut/beos/beos_x11.cpp b/src/glut/beos/beos_x11.cpp index 2d1bc655cb..4f7ec48ac8 100644 --- a/src/glut/beos/beos_x11.cpp +++ b/src/glut/beos/beos_x11.cpp @@ -23,7 +23,6 @@ int DisplayHeight() { /* the following function was stolen from the X sources as indicated. */ /* Copyright Massachusetts Institute of Technology 1985, 1986, 1987 */ -/* $XConsortium: XParseGeom.c,v 11.18 91/02/21 17:23:05 rws Exp $ */ /* Permission to use, copy, modify, distribute, and sell this software and its diff --git a/src/glut/ggi/debug.h b/src/glut/ggi/debug.h index da329a1d9b..09fa960670 100644 --- a/src/glut/ggi/debug.h +++ b/src/glut/ggi/debug.h @@ -1,4 +1,4 @@ -/* $Id: debug.h,v 1.1 2000/11/19 07:41:26 jtaylor Exp $ +/* ****************************************************************************** GGIMesa debugging macros diff --git a/src/glut/glx/stroke.h b/src/glut/glx/stroke.h index fc29680bea..602b2fae9f 100644 --- a/src/glut/glx/stroke.h +++ b/src/glut/glx/stroke.h @@ -1,4 +1,3 @@ -/* $XConsortium: wfont.h,v 5.1 91/02/16 09:46:37 rws Exp $ */ /***************************************************************** Copyright (c) 1989,1990, 1991 by Sun Microsystems, Inc. and the X Consortium. diff --git a/src/glut/glx/win32_x11.c b/src/glut/glx/win32_x11.c index 1d138cfa2a..d00ccdb121 100644 --- a/src/glut/glx/win32_x11.c +++ b/src/glut/glx/win32_x11.c @@ -263,7 +263,6 @@ XPending(Display* display) /* the following function was stolen from the X sources as indicated. */ /* Copyright Massachusetts Institute of Technology 1985, 1986, 1987 */ -/* $XConsortium: XParseGeom.c,v 11.18 91/02/21 17:23:05 rws Exp $ */ /* Permission to use, copy, modify, distribute, and sell this software and its diff --git a/src/glx/mini/miniglx_events.c b/src/glx/mini/miniglx_events.c index 969398bc16..a20d5847b3 100644 --- a/src/glx/mini/miniglx_events.c +++ b/src/glx/mini/miniglx_events.c @@ -38,7 +38,6 @@ * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. */ -/* $Id: miniglx_events.c,v 1.6 2006/04/03 07:31:27 airlied Exp $ */ #include diff --git a/src/glx/x11/XF86dri.c b/src/glx/x11/XF86dri.c index 8909a04772..9919a40977 100644 --- a/src/glx/x11/XF86dri.c +++ b/src/glx/x11/XF86dri.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/dri/XF86dri.c,v 1.13 2002/10/30 12:51:25 alanh Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/glx/x11/clientattrib.c b/src/glx/x11/clientattrib.c index bfb263ced1..888f8e3187 100644 --- a/src/glx/x11/clientattrib.c +++ b/src/glx/x11/clientattrib.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/clientattrib.c,v 1.5 2001/03/21 16:04:39 dawes Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/compsize.c b/src/glx/x11/compsize.c index b8c162e8ac..2d124573ef 100644 --- a/src/glx/x11/compsize.c +++ b/src/glx/x11/compsize.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/compsize.c,v 1.6 2004/01/28 18:11:38 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/dri_glx.c b/src/glx/x11/dri_glx.c index 5cf9923979..21e07c1935 100644 --- a/src/glx/x11/dri_glx.c +++ b/src/glx/x11/dri_glx.c @@ -24,7 +24,6 @@ TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/dri/dri_glx.c,v 1.14 2003/07/16 00:54:00 dawes Exp $ */ /* * Authors: diff --git a/src/glx/x11/eval.c b/src/glx/x11/eval.c index 0f94e6da6f..2544c50fce 100644 --- a/src/glx/x11/eval.c +++ b/src/glx/x11/eval.c @@ -1,4 +1,3 @@ -/* $XFree86$ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/glxclient.h b/src/glx/x11/glxclient.h index 477566cc46..03e44e5d04 100644 --- a/src/glx/x11/glxclient.h +++ b/src/glx/x11/glxclient.h @@ -31,7 +31,6 @@ ** published by SGI, but has not been independently verified as being ** compliant with the OpenGL(R) version 1.2.1 Specification. */ -/* $XFree86: xc/lib/GL/glx/glxclient.h,v 1.21 2004/02/09 23:46:31 alanh Exp $ */ /** * \file glxclient.h diff --git a/src/glx/x11/glxcmds.c b/src/glx/x11/glxcmds.c index f52b71ffcd..80281896f6 100644 --- a/src/glx/x11/glxcmds.c +++ b/src/glx/x11/glxcmds.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/glxcmds.c,v 1.30 2004/01/30 20:33:06 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/glxext.c b/src/glx/x11/glxext.c index af3a5166dc..2852217ba3 100644 --- a/src/glx/x11/glxext.c +++ b/src/glx/x11/glxext.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/glxext.c,v 1.22 2003/12/08 17:35:28 dawes Exp $ */ /* ** License Applicability. Except to the extent portions of this file are diff --git a/src/glx/x11/indirect_init.h b/src/glx/x11/indirect_init.h index 62d04ba6dc..72255f1301 100644 --- a/src/glx/x11/indirect_init.h +++ b/src/glx/x11/indirect_init.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/indirect_init.h,v 1.2 2000/02/08 17:18:33 dawes Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/glx/x11/packrender.h b/src/glx/x11/packrender.h index ce2a1616de..8e3119d1b2 100644 --- a/src/glx/x11/packrender.h +++ b/src/glx/x11/packrender.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/packrender.h,v 1.7tsi Exp $ */ #ifndef __GLX_packrender_h__ #define __GLX_packrender_h__ diff --git a/src/glx/x11/packsingle.h b/src/glx/x11/packsingle.h index 16b054f1e0..c69c543921 100644 --- a/src/glx/x11/packsingle.h +++ b/src/glx/x11/packsingle.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/packsingle.h,v 1.5tsi Exp $ */ #ifndef __GLX_packsingle_h__ #define __GLX_packsingle_h__ diff --git a/src/glx/x11/pixel.c b/src/glx/x11/pixel.c index 3b3a1811ab..279555bdfd 100644 --- a/src/glx/x11/pixel.c +++ b/src/glx/x11/pixel.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/pixel.c,v 1.8 2003/09/28 20:15:04 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/pixelstore.c b/src/glx/x11/pixelstore.c index 3bf1b35ba3..6f25ed786e 100644 --- a/src/glx/x11/pixelstore.c +++ b/src/glx/x11/pixelstore.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/pixelstore.c,v 1.4 2004/01/28 18:11:43 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/render2.c b/src/glx/x11/render2.c index 21ba270998..b17ad974c8 100644 --- a/src/glx/x11/render2.c +++ b/src/glx/x11/render2.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/render2.c,v 1.6 2004/01/31 09:29:33 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/renderpix.c b/src/glx/x11/renderpix.c index b7d01dc679..41a7a2d762 100644 --- a/src/glx/x11/renderpix.c +++ b/src/glx/x11/renderpix.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/renderpix.c,v 1.5 2003/09/28 20:15:04 alanh Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/single2.c b/src/glx/x11/single2.c index d535757a9e..35fe417b62 100644 --- a/src/glx/x11/single2.c +++ b/src/glx/x11/single2.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/single2.c,v 1.10 2004/02/11 19:48:16 dawes Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/singlepix.c b/src/glx/x11/singlepix.c index a7b5b79870..cd88684f70 100644 --- a/src/glx/x11/singlepix.c +++ b/src/glx/x11/singlepix.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/singlepix.c,v 1.3 2001/03/21 16:04:39 dawes Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/vertarr.c b/src/glx/x11/vertarr.c index 483a166ea2..d50560ba1a 100644 --- a/src/glx/x11/vertarr.c +++ b/src/glx/x11/vertarr.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/vertarr.c,v 1.4 2001/03/25 05:32:00 tsi Exp $ */ /* ** License Applicability. Except to the extent portions of this file are ** made subject to an alternative license as permitted in the SGI Free diff --git a/src/glx/x11/xf86dri.h b/src/glx/x11/xf86dri.h index 0a2bb24971..c8c878f127 100644 --- a/src/glx/x11/xf86dri.h +++ b/src/glx/x11/xf86dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/dri/xf86dri.h,v 1.8 2002/10/30 12:51:25 alanh Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/glx/x11/xf86dristr.h b/src/glx/x11/xf86dristr.h index ac05b183b3..b834bd1a1a 100644 --- a/src/glx/x11/xf86dristr.h +++ b/src/glx/x11/xf86dristr.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/dri/xf86dristr.h,v 1.10 2002/10/30 12:51:25 alanh Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/glx/x11/xfont.c b/src/glx/x11/xfont.c index 5f23a79622..f3e3da3e79 100644 --- a/src/glx/x11/xfont.c +++ b/src/glx/x11/xfont.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/glx/xfont.c,v 1.6 2001/05/02 15:06:02 dawes Exp $ */ /* * Mesa 3-D graphics library * Version: 3.1 diff --git a/src/mesa/drivers/dri/common/stenciltmp.h b/src/mesa/drivers/dri/common/stenciltmp.h index 324fc873d3..2b10b9ecfe 100644 --- a/src/mesa/drivers/dri/common/stenciltmp.h +++ b/src/mesa/drivers/dri/common/stenciltmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/common/stenciltmp.h,v 1.3 2001/03/21 16:14:20 dawes Exp $ */ #include "spantmp_common.h" diff --git a/src/mesa/drivers/dri/common/texmem.c b/src/mesa/drivers/dri/common/texmem.c index b0e8c4c1c2..a81cc2413d 100644 --- a/src/mesa/drivers/dri/common/texmem.c +++ b/src/mesa/drivers/dri/common/texmem.c @@ -28,7 +28,6 @@ * Kevin E. Martin * Gareth Hughes */ -/* $XFree86:$ */ /** \file texmem.c * Implements all of the device-independent texture memory management. diff --git a/src/mesa/drivers/dri/common/texmem.h b/src/mesa/drivers/dri/common/texmem.h index 6692efcc30..ffed7dd66e 100644 --- a/src/mesa/drivers/dri/common/texmem.h +++ b/src/mesa/drivers/dri/common/texmem.h @@ -28,7 +28,6 @@ * Kevin E. Martin * Gareth Hughes */ -/* $XFree86:$ */ /** \file texmem.h * Public interface to the DRI texture memory management routines. diff --git a/src/mesa/drivers/dri/common/utils.h b/src/mesa/drivers/dri/common/utils.h index b2bab86e66..b28b895627 100644 --- a/src/mesa/drivers/dri/common/utils.h +++ b/src/mesa/drivers/dri/common/utils.h @@ -24,7 +24,6 @@ * Authors: * Ian Romanick */ -/* $XFree86:$ */ #ifndef DRI_DEBUG_H #define DRI_DEBUG_H diff --git a/src/mesa/drivers/dri/common/vblank.c b/src/mesa/drivers/dri/common/vblank.c index e7ed545f13..094950d362 100644 --- a/src/mesa/drivers/dri/common/vblank.c +++ b/src/mesa/drivers/dri/common/vblank.c @@ -25,7 +25,6 @@ * Authors: * Ian Romanick */ -/* $XFree86:$ */ #include "glheader.h" #include "xf86drm.h" diff --git a/src/mesa/drivers/dri/common/vblank.h b/src/mesa/drivers/dri/common/vblank.h index ec83adc78d..52c1933ca5 100644 --- a/src/mesa/drivers/dri/common/vblank.h +++ b/src/mesa/drivers/dri/common/vblank.h @@ -25,7 +25,6 @@ * Authors: * Ian Romanick */ -/* $XFree86:$ */ #ifndef DRI_VBLANK_H #define DRI_VBLANK_H diff --git a/src/mesa/drivers/dri/ffb/ffb_bitmap.c b/src/mesa/drivers/dri/ffb/ffb_bitmap.c index 7263e83813..1aa66859a6 100644 --- a/src/mesa/drivers/dri/ffb/ffb_bitmap.c +++ b/src/mesa/drivers/dri/ffb/ffb_bitmap.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_bitmap.c,v 1.1 2002/02/22 21:32:58 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_bitmap.h b/src/mesa/drivers/dri/ffb/ffb_bitmap.h index 4f8d2ea2a6..0ccbc57bd0 100644 --- a/src/mesa/drivers/dri/ffb/ffb_bitmap.h +++ b/src/mesa/drivers/dri/ffb/ffb_bitmap.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_bitmap.h,v 1.1 2002/02/22 21:32:58 dawes Exp $ */ #ifndef _FFB_BITMAP_H #define _FFB_BITMAP_H diff --git a/src/mesa/drivers/dri/ffb/ffb_clear.c b/src/mesa/drivers/dri/ffb/ffb_clear.c index e8dfcbe254..7de05b5cf0 100644 --- a/src/mesa/drivers/dri/ffb/ffb_clear.c +++ b/src/mesa/drivers/dri/ffb/ffb_clear.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_clear.c,v 1.2 2002/02/22 21:32:58 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_context.h b/src/mesa/drivers/dri/ffb/ffb_context.h index df1b65d748..0ab75fce47 100644 --- a/src/mesa/drivers/dri/ffb/ffb_context.h +++ b/src/mesa/drivers/dri/ffb/ffb_context.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_context.h,v 1.2 2002/02/22 21:32:58 dawes Exp $ */ #ifndef _FFB_CONTEXT_H #define _FFB_CONTEXT_H diff --git a/src/mesa/drivers/dri/ffb/ffb_dd.c b/src/mesa/drivers/dri/ffb/ffb_dd.c index 53423bbae4..f64a577d1f 100644 --- a/src/mesa/drivers/dri/ffb/ffb_dd.c +++ b/src/mesa/drivers/dri/ffb/ffb_dd.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_dd.c,v 1.4 2002/09/11 19:49:07 tsi Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_dd.h b/src/mesa/drivers/dri/ffb/ffb_dd.h index 4ffcbe6666..e065ebbecd 100644 --- a/src/mesa/drivers/dri/ffb/ffb_dd.h +++ b/src/mesa/drivers/dri/ffb/ffb_dd.h @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_dd.h,v 1.1 2000/06/20 05:08:38 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D. * Copyright (C) 2000 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_depth.c b/src/mesa/drivers/dri/ffb/ffb_depth.c index 68a2450eb7..cca6212f50 100644 --- a/src/mesa/drivers/dri/ffb/ffb_depth.c +++ b/src/mesa/drivers/dri/ffb/ffb_depth.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_depth.c,v 1.2 2002/02/22 21:32:58 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_depth.h b/src/mesa/drivers/dri/ffb/ffb_depth.h index db908e7a63..8a1829ed49 100644 --- a/src/mesa/drivers/dri/ffb/ffb_depth.h +++ b/src/mesa/drivers/dri/ffb/ffb_depth.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_depth.h,v 1.1 2000/06/20 05:08:38 dawes Exp $ */ #ifndef _FFB_DEPTH_H #define _FFB_DEPTH_H diff --git a/src/mesa/drivers/dri/ffb/ffb_fifo.h b/src/mesa/drivers/dri/ffb/ffb_fifo.h index 886d71b76e..a175f38643 100644 --- a/src/mesa/drivers/dri/ffb/ffb_fifo.h +++ b/src/mesa/drivers/dri/ffb/ffb_fifo.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_fifo.h,v 1.2 2002/02/22 21:32:58 dawes Exp $ */ #ifndef _FFB_FIFO_H #define _FFB_FIFO_H diff --git a/src/mesa/drivers/dri/ffb/ffb_lines.c b/src/mesa/drivers/dri/ffb/ffb_lines.c index da1de18f36..8294701464 100644 --- a/src/mesa/drivers/dri/ffb/ffb_lines.c +++ b/src/mesa/drivers/dri/ffb/ffb_lines.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_lines.c,v 1.2 2002/02/22 21:32:58 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_lines.h b/src/mesa/drivers/dri/ffb/ffb_lines.h index d508c243ea..ddb9365653 100644 --- a/src/mesa/drivers/dri/ffb/ffb_lines.h +++ b/src/mesa/drivers/dri/ffb/ffb_lines.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_lines.h,v 1.2 2002/02/22 21:32:58 dawes Exp $ */ #ifndef _FFB_LINES_H #define _FFB_LINES_H diff --git a/src/mesa/drivers/dri/ffb/ffb_linetmp.h b/src/mesa/drivers/dri/ffb/ffb_linetmp.h index 0951513ca1..e9d8260e1a 100644 --- a/src/mesa/drivers/dri/ffb/ffb_linetmp.h +++ b/src/mesa/drivers/dri/ffb/ffb_linetmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_linetmp.h,v 1.2 2002/02/22 21:32:58 dawes Exp $ */ static __inline void TAG(ffb_line)(GLcontext *ctx, ffb_vertex *v0, ffb_vertex *v1 ) diff --git a/src/mesa/drivers/dri/ffb/ffb_lock.h b/src/mesa/drivers/dri/ffb/ffb_lock.h index 7c49f740f8..1fd3eb5512 100644 --- a/src/mesa/drivers/dri/ffb/ffb_lock.h +++ b/src/mesa/drivers/dri/ffb/ffb_lock.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_lock.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_LOCK_H #define _FFB_LOCK_H diff --git a/src/mesa/drivers/dri/ffb/ffb_points.c b/src/mesa/drivers/dri/ffb/ffb_points.c index a7496dd1d6..d00255ccee 100644 --- a/src/mesa/drivers/dri/ffb/ffb_points.c +++ b/src/mesa/drivers/dri/ffb/ffb_points.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_points.c,v 1.2 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_points.h b/src/mesa/drivers/dri/ffb/ffb_points.h index 7d5c1f8a03..a7229de7f1 100644 --- a/src/mesa/drivers/dri/ffb/ffb_points.h +++ b/src/mesa/drivers/dri/ffb/ffb_points.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_points.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_POINTS_H #define _FFB_POINTS_H diff --git a/src/mesa/drivers/dri/ffb/ffb_pointtmp.h b/src/mesa/drivers/dri/ffb/ffb_pointtmp.h index 310c95d89b..2c91426b3a 100644 --- a/src/mesa/drivers/dri/ffb/ffb_pointtmp.h +++ b/src/mesa/drivers/dri/ffb/ffb_pointtmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_pointtmp.h,v 1.3 2002/02/22 21:32:59 dawes Exp $ */ static __inline void TAG(ffb_draw_point)(GLcontext *ctx, ffb_vertex *tmp ) { diff --git a/src/mesa/drivers/dri/ffb/ffb_rendertmp.h b/src/mesa/drivers/dri/ffb/ffb_rendertmp.h index 26d991b081..64141c2c5f 100644 --- a/src/mesa/drivers/dri/ffb/ffb_rendertmp.h +++ b/src/mesa/drivers/dri/ffb/ffb_rendertmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_rendertmp.h,v 1.2 2003/01/29 23:00:40 dawes Exp $ */ #define IMPL_LOCAL_VARS \ ffbContextPtr fmesa = FFB_CONTEXT(ctx); \ diff --git a/src/mesa/drivers/dri/ffb/ffb_span.c b/src/mesa/drivers/dri/ffb/ffb_span.c index fff7fa1d3f..59ac414678 100644 --- a/src/mesa/drivers/dri/ffb/ffb_span.c +++ b/src/mesa/drivers/dri/ffb/ffb_span.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_span.c,v 1.2 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_span.h b/src/mesa/drivers/dri/ffb/ffb_span.h index 5ae227910d..37506cf30e 100644 --- a/src/mesa/drivers/dri/ffb/ffb_span.h +++ b/src/mesa/drivers/dri/ffb/ffb_span.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_span.h,v 1.1 2000/06/20 05:08:39 dawes Exp $ */ #ifndef _FFB_SPAN_H #define _FFB_SPAN_H diff --git a/src/mesa/drivers/dri/ffb/ffb_state.c b/src/mesa/drivers/dri/ffb/ffb_state.c index eb13478166..880ad8be0a 100644 --- a/src/mesa/drivers/dri/ffb/ffb_state.c +++ b/src/mesa/drivers/dri/ffb/ffb_state.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_state.c,v 1.5 2002/10/30 12:51:27 alanh Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_state.h b/src/mesa/drivers/dri/ffb/ffb_state.h index 17b6fa20ab..19e72085fd 100644 --- a/src/mesa/drivers/dri/ffb/ffb_state.h +++ b/src/mesa/drivers/dri/ffb/ffb_state.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_state.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_STATE_H #define _FFB_STATE_H diff --git a/src/mesa/drivers/dri/ffb/ffb_stencil.c b/src/mesa/drivers/dri/ffb/ffb_stencil.c index 2f13ee9210..d535b1b778 100644 --- a/src/mesa/drivers/dri/ffb/ffb_stencil.c +++ b/src/mesa/drivers/dri/ffb/ffb_stencil.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_stencil.c,v 1.2 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_stencil.h b/src/mesa/drivers/dri/ffb/ffb_stencil.h index c7da1ca681..2d529980d1 100644 --- a/src/mesa/drivers/dri/ffb/ffb_stencil.h +++ b/src/mesa/drivers/dri/ffb/ffb_stencil.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_stencil.h,v 1.1 2000/06/20 05:08:39 dawes Exp $ */ #ifndef _FFB_STENCIL_H #define _FFB_STENCIL_H diff --git a/src/mesa/drivers/dri/ffb/ffb_tex.c b/src/mesa/drivers/dri/ffb/ffb_tex.c index d6763b7cd3..6503b0f4e7 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tex.c +++ b/src/mesa/drivers/dri/ffb/ffb_tex.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_tex.c,v 1.1 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_tex.h b/src/mesa/drivers/dri/ffb/ffb_tex.h index dba0e08af6..4032e73209 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tex.h +++ b/src/mesa/drivers/dri/ffb/ffb_tex.h @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_tex.h,v 1.1 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D. * Copyright (C) 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_tris.c b/src/mesa/drivers/dri/ffb/ffb_tris.c index 9fae8c8283..c2857f61bd 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tris.c +++ b/src/mesa/drivers/dri/ffb/ffb_tris.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_tris.c,v 1.3 2002/10/30 12:51:28 alanh Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_tris.h b/src/mesa/drivers/dri/ffb/ffb_tris.h index a803174b3e..116b8e07f1 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tris.h +++ b/src/mesa/drivers/dri/ffb/ffb_tris.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_tris.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_TRIS_H #define _FFB_TRIS_H diff --git a/src/mesa/drivers/dri/ffb/ffb_tritmp.h b/src/mesa/drivers/dri/ffb/ffb_tritmp.h index 612ef2433f..324a871ec4 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tritmp.h +++ b/src/mesa/drivers/dri/ffb/ffb_tritmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_tritmp.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ static void TAG(ffb_triangle)( GLcontext *ctx, ffb_vertex *v0, diff --git a/src/mesa/drivers/dri/ffb/ffb_vb.c b/src/mesa/drivers/dri/ffb/ffb_vb.c index 6ba1eabbf2..edc9d79124 100644 --- a/src/mesa/drivers/dri/ffb/ffb_vb.c +++ b/src/mesa/drivers/dri/ffb/ffb_vb.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_vb.c,v 1.4 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_vb.h b/src/mesa/drivers/dri/ffb/ffb_vb.h index 9eb6759f61..af669bce30 100644 --- a/src/mesa/drivers/dri/ffb/ffb_vb.h +++ b/src/mesa/drivers/dri/ffb/ffb_vb.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_vb.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_VB_H #define _FFB_VB_H diff --git a/src/mesa/drivers/dri/ffb/ffb_vbtmp.h b/src/mesa/drivers/dri/ffb/ffb_vbtmp.h index a1d1254d97..0495d0e276 100644 --- a/src/mesa/drivers/dri/ffb/ffb_vbtmp.h +++ b/src/mesa/drivers/dri/ffb/ffb_vbtmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_vbtmp.h,v 1.1 2002/02/22 21:32:59 dawes Exp $ */ static void TAG(emit)(GLcontext *ctx, GLuint start, GLuint end) { diff --git a/src/mesa/drivers/dri/ffb/ffb_vtxfmt.c b/src/mesa/drivers/dri/ffb/ffb_vtxfmt.c index 9c1b770fbd..8b60f095c9 100644 --- a/src/mesa/drivers/dri/ffb/ffb_vtxfmt.c +++ b/src/mesa/drivers/dri/ffb/ffb_vtxfmt.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_vtxfmt.c,v 1.1 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_vtxfmt.h b/src/mesa/drivers/dri/ffb/ffb_vtxfmt.h index 063bb4923e..4d9125cd15 100644 --- a/src/mesa/drivers/dri/ffb/ffb_vtxfmt.h +++ b/src/mesa/drivers/dri/ffb/ffb_vtxfmt.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_vtxfmt.h,v 1.1 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_VTXFMT_H #define _FFB_VTXFMT_H diff --git a/src/mesa/drivers/dri/ffb/ffb_xmesa.c b/src/mesa/drivers/dri/ffb/ffb_xmesa.c index 4c5323d230..f521de63c0 100644 --- a/src/mesa/drivers/dri/ffb/ffb_xmesa.c +++ b/src/mesa/drivers/dri/ffb/ffb_xmesa.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_xmesa.c,v 1.4 2002/02/22 21:32:59 dawes Exp $ +/* * * GLX Hardware Device Driver for Sun Creator/Creator3D * Copyright (C) 2000, 2001 David S. Miller diff --git a/src/mesa/drivers/dri/ffb/ffb_xmesa.h b/src/mesa/drivers/dri/ffb/ffb_xmesa.h index b7580780a6..bc8cfe9f21 100644 --- a/src/mesa/drivers/dri/ffb/ffb_xmesa.h +++ b/src/mesa/drivers/dri/ffb/ffb_xmesa.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/ffb/ffb_xmesa.h,v 1.2 2002/02/22 21:32:59 dawes Exp $ */ #ifndef _FFB_XMESA_H_ #define _FFB_XMESA_H_ diff --git a/src/mesa/drivers/dri/ffb/server/ffb_dac.h b/src/mesa/drivers/dri/ffb/server/ffb_dac.h index 08114282e5..ac4a75b459 100644 --- a/src/mesa/drivers/dri/ffb/server/ffb_dac.h +++ b/src/mesa/drivers/dri/ffb/server/ffb_dac.h @@ -21,7 +21,6 @@ * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. * */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/sunffb/ffb_dac.h,v 1.2 2001/04/05 17:42:33 dawes Exp $ */ #ifndef _FFB_DAC_H #define _FFB_DAC_H diff --git a/src/mesa/drivers/dri/ffb/server/ffb_drishare.h b/src/mesa/drivers/dri/ffb/server/ffb_drishare.h index baf2f0d0a6..69fefa3f0a 100644 --- a/src/mesa/drivers/dri/ffb/server/ffb_drishare.h +++ b/src/mesa/drivers/dri/ffb/server/ffb_drishare.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/sunffb/ffb_drishare.h,v 1.2 2000/06/21 00:47:37 dawes Exp $ */ #ifndef _FFB_DRISHARE_H #define _FFB_DRISHARE_H diff --git a/src/mesa/drivers/dri/ffb/server/ffb_regs.h b/src/mesa/drivers/dri/ffb/server/ffb_regs.h index 7f383d38d6..bda5840d60 100644 --- a/src/mesa/drivers/dri/ffb/server/ffb_regs.h +++ b/src/mesa/drivers/dri/ffb/server/ffb_regs.h @@ -24,7 +24,6 @@ * USE OR OTHER DEALINGS IN THE SOFTWARE. * */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/sunffb/ffb_regs.h,v 1.1 2000/05/18 23:21:37 dawes Exp $ */ #ifndef FFBREGS_H #define FFBREGS_H diff --git a/src/mesa/drivers/dri/gamma/gamma_client.h b/src/mesa/drivers/dri/gamma/gamma_client.h index 1c1a22ebc4..6dcf2e9438 100644 --- a/src/mesa/drivers/dri/gamma/gamma_client.h +++ b/src/mesa/drivers/dri/gamma/gamma_client.h @@ -31,7 +31,6 @@ * ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER * DEALINGS IN THE SOFTWARE. * - * $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_client.h,v 1.3 2002/02/22 21:33:00 dawes Exp $ * */ diff --git a/src/mesa/drivers/dri/gamma/gamma_context.h b/src/mesa/drivers/dri/gamma/gamma_context.h index f0ab1c4f05..fb70df6c37 100644 --- a/src/mesa/drivers/dri/gamma/gamma_context.h +++ b/src/mesa/drivers/dri/gamma/gamma_context.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_context.h,v 1.6 2002/12/16 16:18:50 dawes Exp $ */ /* * Copyright 2001 by Alan Hourihane. * diff --git a/src/mesa/drivers/dri/gamma/gamma_inithw.c b/src/mesa/drivers/dri/gamma/gamma_inithw.c index 47eb802b4e..79b54aacb5 100644 --- a/src/mesa/drivers/dri/gamma/gamma_inithw.c +++ b/src/mesa/drivers/dri/gamma/gamma_inithw.c @@ -23,7 +23,6 @@ * Kevin E. Martin * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_inithw.c,v 1.9 2002/10/30 12:51:29 alanh Exp $ */ #include "gamma_context.h" #include "glint_dri.h" diff --git a/src/mesa/drivers/dri/gamma/gamma_lock.c b/src/mesa/drivers/dri/gamma/gamma_lock.c index 2ab387fa27..97eea75541 100644 --- a/src/mesa/drivers/dri/gamma/gamma_lock.c +++ b/src/mesa/drivers/dri/gamma/gamma_lock.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_lock.c,v 1.4 2002/11/05 17:46:07 tsi Exp $ */ #include "gamma_context.h" #include "gamma_lock.h" diff --git a/src/mesa/drivers/dri/gamma/gamma_macros.h b/src/mesa/drivers/dri/gamma/gamma_macros.h index 974fe569df..c15483b770 100644 --- a/src/mesa/drivers/dri/gamma/gamma_macros.h +++ b/src/mesa/drivers/dri/gamma/gamma_macros.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_macros.h,v 1.5 2002/02/22 21:33:02 dawes Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/mesa/drivers/dri/gamma/gamma_regs.h b/src/mesa/drivers/dri/gamma/gamma_regs.h index 2edda07227..9e1c735019 100644 --- a/src/mesa/drivers/dri/gamma/gamma_regs.h +++ b/src/mesa/drivers/dri/gamma/gamma_regs.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_regs.h,v 1.5 2002/02/22 21:33:02 dawes Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/mesa/drivers/dri/gamma/gamma_span.c b/src/mesa/drivers/dri/gamma/gamma_span.c index f62bea9b66..012d77782b 100644 --- a/src/mesa/drivers/dri/gamma/gamma_span.c +++ b/src/mesa/drivers/dri/gamma/gamma_span.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_span.c,v 1.4 2002/11/05 17:46:07 tsi Exp $ */ #include "gamma_context.h" #include "gamma_lock.h" diff --git a/src/mesa/drivers/dri/gamma/gamma_state.c b/src/mesa/drivers/dri/gamma/gamma_state.c index 8dbe0a97ca..a0690f64d0 100644 --- a/src/mesa/drivers/dri/gamma/gamma_state.c +++ b/src/mesa/drivers/dri/gamma/gamma_state.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_state.c,v 1.5 2002/11/05 17:46:07 tsi Exp $ */ /* * Copyright 2001 by Alan Hourihane. * diff --git a/src/mesa/drivers/dri/gamma/gamma_tex.c b/src/mesa/drivers/dri/gamma/gamma_tex.c index d4fc93f86b..0770cbf694 100644 --- a/src/mesa/drivers/dri/gamma/gamma_tex.c +++ b/src/mesa/drivers/dri/gamma/gamma_tex.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_tex.c,v 1.4 2002/11/05 17:46:07 tsi Exp $ */ #include #include diff --git a/src/mesa/drivers/dri/gamma/gamma_texmem.c b/src/mesa/drivers/dri/gamma/gamma_texmem.c index 506b5c4c8f..94ecb5c2f6 100644 --- a/src/mesa/drivers/dri/gamma/gamma_texmem.c +++ b/src/mesa/drivers/dri/gamma/gamma_texmem.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_texmem.c,v 1.5 2002/11/05 17:46:07 tsi Exp $ */ #include #include diff --git a/src/mesa/drivers/dri/gamma/gamma_texstate.c b/src/mesa/drivers/dri/gamma/gamma_texstate.c index a8d1b253c7..b9bd6d4cee 100644 --- a/src/mesa/drivers/dri/gamma/gamma_texstate.c +++ b/src/mesa/drivers/dri/gamma/gamma_texstate.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_texstate.c,v 1.5 2002/11/05 17:46:07 tsi Exp $ */ #include #include diff --git a/src/mesa/drivers/dri/gamma/gamma_tritmp.h b/src/mesa/drivers/dri/gamma/gamma_tritmp.h index 23459ff156..56e0a850c8 100644 --- a/src/mesa/drivers/dri/gamma/gamma_tritmp.h +++ b/src/mesa/drivers/dri/gamma/gamma_tritmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/extras/Mesa/src/mesa/drivers/dri/gamma/gamma_tritmp.h,v 1.2 2004/12/13 22:40:49 tsi Exp $ */ static void TAG(gamma_point)( gammaContextPtr gmesa, const gammaVertex *v0 ) diff --git a/src/mesa/drivers/dri/gamma/gamma_vb.c b/src/mesa/drivers/dri/gamma/gamma_vb.c index 80d35cba9e..f23f585fc0 100644 --- a/src/mesa/drivers/dri/gamma/gamma_vb.c +++ b/src/mesa/drivers/dri/gamma/gamma_vb.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_vb.c,v 1.4 2003/03/26 20:43:48 tsi Exp $ */ /* * Copyright 2001 by Alan Hourihane. * diff --git a/src/mesa/drivers/dri/gamma/gamma_xmesa.c b/src/mesa/drivers/dri/gamma/gamma_xmesa.c index f41682cea7..4c0ebe1899 100644 --- a/src/mesa/drivers/dri/gamma/gamma_xmesa.c +++ b/src/mesa/drivers/dri/gamma/gamma_xmesa.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/gamma/gamma_xmesa.c,v 1.14 2002/10/30 12:51:30 alanh Exp $ */ /* * Copyright 2001 by Alan Hourihane. * diff --git a/src/mesa/drivers/dri/gamma/server/glint_common.h b/src/mesa/drivers/dri/gamma/server/glint_common.h index ec601f942d..36554e4ac2 100644 --- a/src/mesa/drivers/dri/gamma/server/glint_common.h +++ b/src/mesa/drivers/dri/gamma/server/glint_common.h @@ -25,7 +25,6 @@ * Converted to common header format: * Jens Owen * - * $XFree86: xc/programs/Xserver/hw/xfree86/drivers/glint/glint_common.h,v 1.2 2003/04/03 16:52:18 dawes Exp $ * */ diff --git a/src/mesa/drivers/dri/gamma/server/glint_dri.h b/src/mesa/drivers/dri/gamma/server/glint_dri.h index 3952759f83..df1992a5d1 100644 --- a/src/mesa/drivers/dri/gamma/server/glint_dri.h +++ b/src/mesa/drivers/dri/gamma/server/glint_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/glint/glint_dri.h,v 1.7 2002/10/30 12:52:16 alanh Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/mesa/drivers/dri/i810/i810_3d_reg.h b/src/mesa/drivers/dri/i810/i810_3d_reg.h index 7cc59d5c86..2fbeb64978 100644 --- a/src/mesa/drivers/dri/i810/i810_3d_reg.h +++ b/src/mesa/drivers/dri/i810/i810_3d_reg.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810_3d_reg.h,v 1.7 2002/02/22 21:33:03 dawes Exp $ */ #ifndef I810_3D_REG_H #define I810_3D_REG_H diff --git a/src/mesa/drivers/dri/i810/i810context.c b/src/mesa/drivers/dri/i810/i810context.c index 3f7f2cc8a4..f90b3682f8 100644 --- a/src/mesa/drivers/dri/i810/i810context.c +++ b/src/mesa/drivers/dri/i810/i810context.c @@ -24,7 +24,6 @@ TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810context.c,v 1.3 2002/10/30 12:51:33 alanh Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/i810/i810context.h b/src/mesa/drivers/dri/i810/i810context.h index b83500bbd0..4708042059 100644 --- a/src/mesa/drivers/dri/i810/i810context.h +++ b/src/mesa/drivers/dri/i810/i810context.h @@ -21,7 +21,6 @@ * OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810context.h,v 1.9 2002/12/16 16:18:51 dawes Exp $ */ #ifndef I810CONTEXT_INC #define I810CONTEXT_INC diff --git a/src/mesa/drivers/dri/i810/i810ioctl.c b/src/mesa/drivers/dri/i810/i810ioctl.c index 57c84193fa..95726fb252 100644 --- a/src/mesa/drivers/dri/i810/i810ioctl.c +++ b/src/mesa/drivers/dri/i810/i810ioctl.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810ioctl.c,v 1.7 2002/10/30 12:51:33 alanh Exp $ */ #include /* for usleep() */ diff --git a/src/mesa/drivers/dri/i810/i810ioctl.h b/src/mesa/drivers/dri/i810/i810ioctl.h index 61399ee7b7..748d29ae36 100644 --- a/src/mesa/drivers/dri/i810/i810ioctl.h +++ b/src/mesa/drivers/dri/i810/i810ioctl.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810ioctl.h,v 1.7 2002/10/30 12:51:33 alanh Exp $ */ #ifndef I810_IOCTL_H #define I810_IOCTL_H diff --git a/src/mesa/drivers/dri/i810/i810screen.c b/src/mesa/drivers/dri/i810/i810screen.c index f64c10a9ae..695b996319 100644 --- a/src/mesa/drivers/dri/i810/i810screen.c +++ b/src/mesa/drivers/dri/i810/i810screen.c @@ -24,7 +24,6 @@ TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810screen.c,v 1.2 2002/10/30 12:51:33 alanh Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/i810/i810state.c b/src/mesa/drivers/dri/i810/i810state.c index e0d5b2b487..e203c74f52 100644 --- a/src/mesa/drivers/dri/i810/i810state.c +++ b/src/mesa/drivers/dri/i810/i810state.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810state.c,v 1.9 2002/10/30 12:51:33 alanh Exp $ */ #include diff --git a/src/mesa/drivers/dri/i810/i810tex.c b/src/mesa/drivers/dri/i810/i810tex.c index f657abe671..730bc90eaf 100644 --- a/src/mesa/drivers/dri/i810/i810tex.c +++ b/src/mesa/drivers/dri/i810/i810tex.c @@ -21,7 +21,6 @@ * OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810tex.c,v 1.9 2002/10/30 12:51:33 alanh Exp $ */ #include "glheader.h" #include "mtypes.h" diff --git a/src/mesa/drivers/dri/i810/i810tris.c b/src/mesa/drivers/dri/i810/i810tris.c index 2c4ee06633..40ab436b95 100644 --- a/src/mesa/drivers/dri/i810/i810tris.c +++ b/src/mesa/drivers/dri/i810/i810tris.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810tris.c,v 1.7 2002/10/30 12:51:33 alanh Exp $ */ /************************************************************************** Copyright 2001 VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/i810/i810tris.h b/src/mesa/drivers/dri/i810/i810tris.h index 06c8b3fcd5..3d0dd916ca 100644 --- a/src/mesa/drivers/dri/i810/i810tris.h +++ b/src/mesa/drivers/dri/i810/i810tris.h @@ -22,7 +22,6 @@ * * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810tris.h,v 1.10 2002/02/22 21:33:04 dawes Exp $ */ #ifndef I810TRIS_INC #define I810TRIS_INC diff --git a/src/mesa/drivers/dri/i810/i810vb.c b/src/mesa/drivers/dri/i810/i810vb.c index 5ce98a991d..3439192b0d 100644 --- a/src/mesa/drivers/dri/i810/i810vb.c +++ b/src/mesa/drivers/dri/i810/i810vb.c @@ -22,7 +22,6 @@ * * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810vb.c,v 1.13 2003/03/26 20:43:48 tsi Exp $ */ #include "glheader.h" diff --git a/src/mesa/drivers/dri/i810/i810vb.h b/src/mesa/drivers/dri/i810/i810vb.h index 1cced86ab2..55d0d2409e 100644 --- a/src/mesa/drivers/dri/i810/i810vb.h +++ b/src/mesa/drivers/dri/i810/i810vb.h @@ -22,7 +22,6 @@ * * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/i810/i810vb.h,v 1.4 2002/02/22 21:33:04 dawes Exp $ */ #ifndef I810VB_INC #define I810VB_INC diff --git a/src/mesa/drivers/dri/i810/server/i810_common.h b/src/mesa/drivers/dri/i810/server/i810_common.h index 02e548be0e..29be444b45 100644 --- a/src/mesa/drivers/dri/i810/server/i810_common.h +++ b/src/mesa/drivers/dri/i810/server/i810_common.h @@ -25,7 +25,6 @@ * Converted to common header format: * Jens Owen * - * $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i810_common.h,v 1.1 2002/09/11 00:29:31 dawes Exp $ * */ diff --git a/src/mesa/drivers/dri/i810/server/i810_dri.h b/src/mesa/drivers/dri/i810/server/i810_dri.h index 408a4ebb4d..4a714f0306 100644 --- a/src/mesa/drivers/dri/i810/server/i810_dri.h +++ b/src/mesa/drivers/dri/i810/server/i810_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i810_dri.h,v 1.10 2002/12/10 01:27:04 dawes Exp $ */ #ifndef _I810_DRI_ #define _I810_DRI_ diff --git a/src/mesa/drivers/dri/i810/server/i810_reg.h b/src/mesa/drivers/dri/i810/server/i810_reg.h index c935982a78..e7e5081038 100644 --- a/src/mesa/drivers/dri/i810/server/i810_reg.h +++ b/src/mesa/drivers/dri/i810/server/i810_reg.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i810_reg.h,v 1.13 2003/02/06 04:18:04 dawes Exp $ */ /************************************************************************** Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas. diff --git a/src/mesa/drivers/dri/i915/server/i830_common.h b/src/mesa/drivers/dri/i915/server/i830_common.h index fb6ceaa52d..2b0fee82a8 100644 --- a/src/mesa/drivers/dri/i915/server/i830_common.h +++ b/src/mesa/drivers/dri/i915/server/i830_common.h @@ -26,7 +26,6 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_common.h,v 1.1 2002/09/11 00:29:32 dawes Exp $ */ #ifndef _I830_COMMON_H_ #define _I830_COMMON_H_ diff --git a/src/mesa/drivers/dri/i915/server/i830_dri.h b/src/mesa/drivers/dri/i915/server/i830_dri.h index 6c9a709021..313eb759b0 100644 --- a/src/mesa/drivers/dri/i915/server/i830_dri.h +++ b/src/mesa/drivers/dri/i915/server/i830_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_dri.h,v 1.4 2002/10/30 12:52:18 alanh Exp $ */ #ifndef _I830_DRI_H #define _I830_DRI_H diff --git a/src/mesa/drivers/dri/i965/server/i830_common.h b/src/mesa/drivers/dri/i965/server/i830_common.h index f320378c2a..49eb145f8b 100644 --- a/src/mesa/drivers/dri/i965/server/i830_common.h +++ b/src/mesa/drivers/dri/i965/server/i830_common.h @@ -26,7 +26,6 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_common.h,v 1.1 2002/09/11 00:29:32 dawes Exp $ */ #ifndef _I830_COMMON_H_ #define _I830_COMMON_H_ diff --git a/src/mesa/drivers/dri/i965/server/i830_dri.h b/src/mesa/drivers/dri/i965/server/i830_dri.h index 22951812ad..68213f69f5 100644 --- a/src/mesa/drivers/dri/i965/server/i830_dri.h +++ b/src/mesa/drivers/dri/i965/server/i830_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/i810/i830_dri.h,v 1.4 2002/10/30 12:52:18 alanh Exp $ */ #ifndef _I830_DRI_H #define _I830_DRI_H diff --git a/src/mesa/drivers/dri/mach64/mach64_context.c b/src/mesa/drivers/dri/mach64/mach64_context.c index ad661e198c..7f558e92bc 100644 --- a/src/mesa/drivers/dri/mach64/mach64_context.c +++ b/src/mesa/drivers/dri/mach64/mach64_context.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_context.h b/src/mesa/drivers/dri/mach64/mach64_context.h index 8d89452412..e925f18c11 100644 --- a/src/mesa/drivers/dri/mach64/mach64_context.h +++ b/src/mesa/drivers/dri/mach64/mach64_context.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_dd.c b/src/mesa/drivers/dri/mach64/mach64_dd.c index 17e8d74d9f..7d225ebc88 100644 --- a/src/mesa/drivers/dri/mach64/mach64_dd.c +++ b/src/mesa/drivers/dri/mach64/mach64_dd.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_dd.h b/src/mesa/drivers/dri/mach64/mach64_dd.h index 74cf1d304f..0a2ce06412 100644 --- a/src/mesa/drivers/dri/mach64/mach64_dd.h +++ b/src/mesa/drivers/dri/mach64/mach64_dd.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_ioctl.c b/src/mesa/drivers/dri/mach64/mach64_ioctl.c index 36e7d3c5d3..6bc2b58ce9 100644 --- a/src/mesa/drivers/dri/mach64/mach64_ioctl.c +++ b/src/mesa/drivers/dri/mach64/mach64_ioctl.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_ioctl.h b/src/mesa/drivers/dri/mach64/mach64_ioctl.h index 52fe863484..2153ab80d7 100644 --- a/src/mesa/drivers/dri/mach64/mach64_ioctl.h +++ b/src/mesa/drivers/dri/mach64/mach64_ioctl.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_lock.c b/src/mesa/drivers/dri/mach64/mach64_lock.c index b73e350111..ea605fb061 100644 --- a/src/mesa/drivers/dri/mach64/mach64_lock.c +++ b/src/mesa/drivers/dri/mach64/mach64_lock.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_lock.h b/src/mesa/drivers/dri/mach64/mach64_lock.h index 973880ee25..3130b183e3 100644 --- a/src/mesa/drivers/dri/mach64/mach64_lock.h +++ b/src/mesa/drivers/dri/mach64/mach64_lock.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_native_vb.c b/src/mesa/drivers/dri/mach64/mach64_native_vb.c index 248fa2a9a2..99f1a14e17 100644 --- a/src/mesa/drivers/dri/mach64/mach64_native_vb.c +++ b/src/mesa/drivers/dri/mach64/mach64_native_vb.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Mesa 3-D graphics library * Version: 3.5 diff --git a/src/mesa/drivers/dri/mach64/mach64_native_vbtmp.h b/src/mesa/drivers/dri/mach64/mach64_native_vbtmp.h index f64b808ee7..684f2acc89 100644 --- a/src/mesa/drivers/dri/mach64/mach64_native_vbtmp.h +++ b/src/mesa/drivers/dri/mach64/mach64_native_vbtmp.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Mesa 3-D graphics library * Version: 3.5 diff --git a/src/mesa/drivers/dri/mach64/mach64_reg.h b/src/mesa/drivers/dri/mach64/mach64_reg.h index abbba295a5..cb944e1023 100644 --- a/src/mesa/drivers/dri/mach64/mach64_reg.h +++ b/src/mesa/drivers/dri/mach64/mach64_reg.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_screen.c b/src/mesa/drivers/dri/mach64/mach64_screen.c index 4e9e216e7d..b780ba65ea 100644 --- a/src/mesa/drivers/dri/mach64/mach64_screen.c +++ b/src/mesa/drivers/dri/mach64/mach64_screen.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_screen.h b/src/mesa/drivers/dri/mach64/mach64_screen.h index 5305058e2f..7bf7dc474d 100644 --- a/src/mesa/drivers/dri/mach64/mach64_screen.h +++ b/src/mesa/drivers/dri/mach64/mach64_screen.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_span.c b/src/mesa/drivers/dri/mach64/mach64_span.c index 3830a28165..5c2403f587 100644 --- a/src/mesa/drivers/dri/mach64/mach64_span.c +++ b/src/mesa/drivers/dri/mach64/mach64_span.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_span.h b/src/mesa/drivers/dri/mach64/mach64_span.h index 0f4c766477..65141d05c3 100644 --- a/src/mesa/drivers/dri/mach64/mach64_span.h +++ b/src/mesa/drivers/dri/mach64/mach64_span.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_state.c b/src/mesa/drivers/dri/mach64/mach64_state.c index 667a394520..9ac51ee5b1 100644 --- a/src/mesa/drivers/dri/mach64/mach64_state.c +++ b/src/mesa/drivers/dri/mach64/mach64_state.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_state.h b/src/mesa/drivers/dri/mach64/mach64_state.h index 95bcab3653..23081cb2fe 100644 --- a/src/mesa/drivers/dri/mach64/mach64_state.h +++ b/src/mesa/drivers/dri/mach64/mach64_state.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_tex.c b/src/mesa/drivers/dri/mach64/mach64_tex.c index 5288d321ce..c42588e064 100644 --- a/src/mesa/drivers/dri/mach64/mach64_tex.c +++ b/src/mesa/drivers/dri/mach64/mach64_tex.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_tex.h b/src/mesa/drivers/dri/mach64/mach64_tex.h index f6cf1cf802..e67661b970 100644 --- a/src/mesa/drivers/dri/mach64/mach64_tex.h +++ b/src/mesa/drivers/dri/mach64/mach64_tex.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_texmem.c b/src/mesa/drivers/dri/mach64/mach64_texmem.c index 3b7b93b984..d65b2cda6a 100644 --- a/src/mesa/drivers/dri/mach64/mach64_texmem.c +++ b/src/mesa/drivers/dri/mach64/mach64_texmem.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., * Cedar Park, Texas. diff --git a/src/mesa/drivers/dri/mach64/mach64_texstate.c b/src/mesa/drivers/dri/mach64/mach64_texstate.c index 3ace370d70..80c84d6774 100644 --- a/src/mesa/drivers/dri/mach64/mach64_texstate.c +++ b/src/mesa/drivers/dri/mach64/mach64_texstate.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_tris.c b/src/mesa/drivers/dri/mach64/mach64_tris.c index 369f610442..e4df01106d 100644 --- a/src/mesa/drivers/dri/mach64/mach64_tris.c +++ b/src/mesa/drivers/dri/mach64/mach64_tris.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_tris.h b/src/mesa/drivers/dri/mach64/mach64_tris.h index 208703289d..4780765a18 100644 --- a/src/mesa/drivers/dri/mach64/mach64_tris.h +++ b/src/mesa/drivers/dri/mach64/mach64_tris.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_vb.c b/src/mesa/drivers/dri/mach64/mach64_vb.c index 83a5f73e6b..8aab72a3f3 100644 --- a/src/mesa/drivers/dri/mach64/mach64_vb.c +++ b/src/mesa/drivers/dri/mach64/mach64_vb.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_vb.h b/src/mesa/drivers/dri/mach64/mach64_vb.h index bcc4759af3..0d923abce0 100644 --- a/src/mesa/drivers/dri/mach64/mach64_vb.h +++ b/src/mesa/drivers/dri/mach64/mach64_vb.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mach64/mach64_vbtmp.h b/src/mesa/drivers/dri/mach64/mach64_vbtmp.h index c1207cacd1..938804af9e 100644 --- a/src/mesa/drivers/dri/mach64/mach64_vbtmp.h +++ b/src/mesa/drivers/dri/mach64/mach64_vbtmp.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Mesa 3-D graphics library * Version: 3.5 diff --git a/src/mesa/drivers/dri/mach64/server/mach64_dri.h b/src/mesa/drivers/dri/mach64/server/mach64_dri.h index 139668e3f3..1477443f79 100644 --- a/src/mesa/drivers/dri/mach64/server/mach64_dri.h +++ b/src/mesa/drivers/dri/mach64/server/mach64_dri.h @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- mode: c; c-basic-offset: 3 -*- */ +/* -*- mode: c; c-basic-offset: 3 -*- */ /* * Copyright 2000 Gareth Hughes * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mga_texstate.c b/src/mesa/drivers/dri/mga/mga_texstate.c index 71d264b0f1..c14ddc95c9 100644 --- a/src/mesa/drivers/dri/mga/mga_texstate.c +++ b/src/mesa/drivers/dri/mga/mga_texstate.c @@ -26,7 +26,6 @@ * Ian Romanick * Keith Whitwell */ -/* $XFree86:$ */ #include #include "mm.h" diff --git a/src/mesa/drivers/dri/mga/mga_xmesa.c b/src/mesa/drivers/dri/mga/mga_xmesa.c index f4e651afa0..6148f6b488 100644 --- a/src/mesa/drivers/dri/mga/mga_xmesa.c +++ b/src/mesa/drivers/dri/mga/mga_xmesa.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mga_xmesa.c,v 1.19 2003/03/26 20:43:49 tsi Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mga_xmesa.h b/src/mesa/drivers/dri/mga/mga_xmesa.h index 0ab0c63f78..0f81c9cbec 100644 --- a/src/mesa/drivers/dri/mga/mga_xmesa.h +++ b/src/mesa/drivers/dri/mga/mga_xmesa.h @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mga_xmesa.h,v 1.12 2002/12/16 16:18:52 dawes Exp $ */ #ifndef _MGA_INIT_H_ #define _MGA_INIT_H_ diff --git a/src/mesa/drivers/dri/mga/mgacontext.h b/src/mesa/drivers/dri/mga/mgacontext.h index 2124006ade..6aa92355b8 100644 --- a/src/mesa/drivers/dri/mga/mgacontext.h +++ b/src/mesa/drivers/dri/mga/mgacontext.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgacontext.h,v 1.7 2002/12/16 16:18:52 dawes Exp $*/ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mgadd.c b/src/mesa/drivers/dri/mga/mgadd.c index b1d5e0c48f..04336b5ac7 100644 --- a/src/mesa/drivers/dri/mga/mgadd.c +++ b/src/mesa/drivers/dri/mga/mgadd.c @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgadd.c,v 1.14 2002/10/30 12:51:35 alanh Exp $ */ #include "mtypes.h" diff --git a/src/mesa/drivers/dri/mga/mgadd.h b/src/mesa/drivers/dri/mga/mgadd.h index f98bfdc878..6830ca67ad 100644 --- a/src/mesa/drivers/dri/mga/mgadd.h +++ b/src/mesa/drivers/dri/mga/mgadd.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgadd.h,v 1.3 2002/10/30 12:51:35 alanh Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mgaioctl.h b/src/mesa/drivers/dri/mga/mgaioctl.h index f3ae749ca9..9aa08c5158 100644 --- a/src/mesa/drivers/dri/mga/mgaioctl.h +++ b/src/mesa/drivers/dri/mga/mgaioctl.h @@ -25,7 +25,6 @@ * Keith Whitwell * Gareth Hughes */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgaioctl.h,v 1.11 2002/10/30 12:51:36 alanh Exp $ */ #ifndef MGA_IOCTL_H #define MGA_IOCTL_H diff --git a/src/mesa/drivers/dri/mga/mgapixel.c b/src/mesa/drivers/dri/mga/mgapixel.c index 2b9da8c181..f309aabbc8 100644 --- a/src/mesa/drivers/dri/mga/mgapixel.c +++ b/src/mesa/drivers/dri/mga/mgapixel.c @@ -34,7 +34,6 @@ * \author Keith Whitwell * \author Gareth Hughes */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgapixel.c,v 1.9 2002/11/05 17:46:08 tsi Exp $ */ #include "mtypes.h" #include "macros.h" diff --git a/src/mesa/drivers/dri/mga/mgapixel.h b/src/mesa/drivers/dri/mga/mgapixel.h index c44fd769a8..b52c8670f3 100644 --- a/src/mesa/drivers/dri/mga/mgapixel.h +++ b/src/mesa/drivers/dri/mga/mgapixel.h @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgapixel.h,v 1.5 2002/10/30 12:51:36 alanh Exp $ */ #ifndef MGA_PIXELS_H #define MGA_PIXELS_H diff --git a/src/mesa/drivers/dri/mga/mgaregs.h b/src/mesa/drivers/dri/mga/mgaregs.h index e1291ca01b..1ef1e6d24c 100644 --- a/src/mesa/drivers/dri/mga/mgaregs.h +++ b/src/mesa/drivers/dri/mga/mgaregs.h @@ -19,7 +19,6 @@ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE * OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgaregs.h,v 1.6 2003/01/12 03:55:46 tsi Exp $ */ #ifndef _MGAREGS_H_ #define _MGAREGS_H_ diff --git a/src/mesa/drivers/dri/mga/mgarender.c b/src/mesa/drivers/dri/mga/mgarender.c index 3080cea79f..c9e42a8040 100644 --- a/src/mesa/drivers/dri/mga/mgarender.c +++ b/src/mesa/drivers/dri/mga/mgarender.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgarender.c,v 1.4 2002/10/30 12:51:36 alanh Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/mga/mgaspan.h b/src/mesa/drivers/dri/mga/mgaspan.h index f133a51c08..f5e2e49b8a 100644 --- a/src/mesa/drivers/dri/mga/mgaspan.h +++ b/src/mesa/drivers/dri/mga/mgaspan.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgaspan.h,v 1.3 2002/10/30 12:51:36 alanh Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mgastate.h b/src/mesa/drivers/dri/mga/mgastate.h index afbe0aaf90..ec65d4e6cd 100644 --- a/src/mesa/drivers/dri/mga/mgastate.h +++ b/src/mesa/drivers/dri/mga/mgastate.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgastate.h,v 1.5 2002/10/30 12:51:36 alanh Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mgatex.c b/src/mesa/drivers/dri/mga/mgatex.c index a7d74317a5..31ea5046df 100644 --- a/src/mesa/drivers/dri/mga/mgatex.c +++ b/src/mesa/drivers/dri/mga/mgatex.c @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgatex.c,v 1.14 2002/10/30 12:51:36 alanh Exp $ */ #include "glheader.h" #include "mm.h" diff --git a/src/mesa/drivers/dri/mga/mgatex.h b/src/mesa/drivers/dri/mga/mgatex.h index fb7ffcff16..789034964a 100644 --- a/src/mesa/drivers/dri/mga/mgatex.h +++ b/src/mesa/drivers/dri/mga/mgatex.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgatex.h,v 1.7 2002/10/30 12:51:36 alanh Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/mgatexmem.c b/src/mesa/drivers/dri/mga/mgatexmem.c index 18743331c6..559813f5de 100644 --- a/src/mesa/drivers/dri/mga/mgatexmem.c +++ b/src/mesa/drivers/dri/mga/mgatexmem.c @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgatexmem.c,v 1.7 2002/10/30 12:51:36 alanh Exp $ */ #include "glheader.h" diff --git a/src/mesa/drivers/dri/mga/mgatris.c b/src/mesa/drivers/dri/mga/mgatris.c index 91b413ae76..0c8081cfb9 100644 --- a/src/mesa/drivers/dri/mga/mgatris.c +++ b/src/mesa/drivers/dri/mga/mgatris.c @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgatris.c,v 1.10 2002/10/30 12:51:36 alanh Exp $ */ #include "mtypes.h" #include "macros.h" diff --git a/src/mesa/drivers/dri/mga/mgatris.h b/src/mesa/drivers/dri/mga/mgatris.h index f3ece3a053..a40fef8307 100644 --- a/src/mesa/drivers/dri/mga/mgatris.h +++ b/src/mesa/drivers/dri/mga/mgatris.h @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgatris.h,v 1.10 2002/10/30 12:51:36 alanh Exp $ */ #ifndef MGATRIS_INC #define MGATRIS_INC diff --git a/src/mesa/drivers/dri/mga/mgavb.c b/src/mesa/drivers/dri/mga/mgavb.c index 902d8bd1c1..954fd53ae3 100644 --- a/src/mesa/drivers/dri/mga/mgavb.c +++ b/src/mesa/drivers/dri/mga/mgavb.c @@ -24,7 +24,6 @@ * Authors: * Keith Whitwell */ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgavb.c,v 1.15 2003/03/26 20:43:49 tsi Exp $ */ #include #include "mgacontext.h" diff --git a/src/mesa/drivers/dri/mga/mgavb.h b/src/mesa/drivers/dri/mga/mgavb.h index 5f6454aca9..f6580e0db9 100644 --- a/src/mesa/drivers/dri/mga/mgavb.h +++ b/src/mesa/drivers/dri/mga/mgavb.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/mga/mgavb.h,v 1.8 2002/10/30 12:51:36 alanh Exp $ */ /* * Copyright 2000-2001 VA Linux Systems, Inc. * All Rights Reserved. diff --git a/src/mesa/drivers/dri/mga/server/mga.h b/src/mesa/drivers/dri/mga/server/mga.h index 830d48d859..d7790e4779 100644 --- a/src/mesa/drivers/dri/mga/server/mga.h +++ b/src/mesa/drivers/dri/mga/server/mga.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga.h,v 1.85 2002/12/16 16:19:17 dawes Exp $ */ /* * MGA Millennium (MGA2064W) functions * diff --git a/src/mesa/drivers/dri/mga/server/mga_bios.h b/src/mesa/drivers/dri/mga/server/mga_bios.h index 8fbf619e34..5dcfc1614d 100644 --- a/src/mesa/drivers/dri/mga/server/mga_bios.h +++ b/src/mesa/drivers/dri/mga/server/mga_bios.h @@ -1,8 +1,6 @@ -/* $XConsortium: mga_bios.h /main/2 1996/10/28 04:48:23 kaleb $ */ #ifndef MGA_BIOS_H #define MGA_BIOS_H -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga_bios.h,v 1.3 1998/07/25 16:55:51 dawes Exp $ */ /* * MGABiosInfo - This struct describes the video BIOS info block. diff --git a/src/mesa/drivers/dri/mga/server/mga_dri.c b/src/mesa/drivers/dri/mga/server/mga_dri.c index 258ace83a0..bc575e62ee 100644 --- a/src/mesa/drivers/dri/mga/server/mga_dri.c +++ b/src/mesa/drivers/dri/mga/server/mga_dri.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga_dri.c,v 1.28 2003/02/08 21:26:58 dawes Exp $ */ /* * Copyright 2000 VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/mga/server/mga_dri.h b/src/mesa/drivers/dri/mga/server/mga_dri.h index 03b8414603..1ce07028f1 100644 --- a/src/mesa/drivers/dri/mga/server/mga_dri.h +++ b/src/mesa/drivers/dri/mga/server/mga_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga_dri.h,v 1.8 2002/11/29 11:06:42 eich Exp $ */ /* * Copyright 2000 VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/mga/server/mga_macros.h b/src/mesa/drivers/dri/mga/server/mga_macros.h index d985081ab6..189e1415d0 100644 --- a/src/mesa/drivers/dri/mga/server/mga_macros.h +++ b/src/mesa/drivers/dri/mga/server/mga_macros.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga_macros.h,v 1.22 2002/02/20 17:17:50 dawes Exp $ */ #ifndef _MGA_MACROS_H_ #define _MGA_MACROS_H_ diff --git a/src/mesa/drivers/dri/mga/server/mga_reg.h b/src/mesa/drivers/dri/mga/server/mga_reg.h index b8e3499235..d51366d44e 100644 --- a/src/mesa/drivers/dri/mga/server/mga_reg.h +++ b/src/mesa/drivers/dri/mga/server/mga_reg.h @@ -1,8 +1,6 @@ -/* $XConsortium: mgareg.h /main/2 1996/10/25 10:33:21 kaleb $ */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/mga/mga_reg.h,v 1.18 2001/09/26 12:59:18 alanh Exp $ */ diff --git a/src/mesa/drivers/dri/r128/r128_context.c b/src/mesa/drivers/dri/r128/r128_context.c index 95e54a6af5..dfc89a2da7 100644 --- a/src/mesa/drivers/dri/r128/r128_context.c +++ b/src/mesa/drivers/dri/r128/r128_context.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_context.c,v 1.8 2002/10/30 12:51:38 alanh Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_context.h b/src/mesa/drivers/dri/r128/r128_context.h index c51dd7fa58..3f96836df1 100644 --- a/src/mesa/drivers/dri/r128/r128_context.h +++ b/src/mesa/drivers/dri/r128/r128_context.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_context.h,v 1.12 2002/12/16 16:18:52 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_dd.c b/src/mesa/drivers/dri/r128/r128_dd.c index 54f2b21b5d..d8e1c70ab7 100644 --- a/src/mesa/drivers/dri/r128/r128_dd.c +++ b/src/mesa/drivers/dri/r128/r128_dd.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_dd.c,v 1.15 2002/10/30 12:51:38 alanh Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_dd.h b/src/mesa/drivers/dri/r128/r128_dd.h index 7a0abb73f8..ce038853c4 100644 --- a/src/mesa/drivers/dri/r128/r128_dd.h +++ b/src/mesa/drivers/dri/r128/r128_dd.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_dd.h,v 1.3 2001/01/08 01:07:20 martin Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_ioctl.c b/src/mesa/drivers/dri/r128/r128_ioctl.c index b0dba7d04e..25188061a0 100644 --- a/src/mesa/drivers/dri/r128/r128_ioctl.c +++ b/src/mesa/drivers/dri/r128/r128_ioctl.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_ioctl.c,v 1.10 2002/12/16 16:18:53 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_ioctl.h b/src/mesa/drivers/dri/r128/r128_ioctl.h index 95779f09be..57063c41f5 100644 --- a/src/mesa/drivers/dri/r128/r128_ioctl.h +++ b/src/mesa/drivers/dri/r128/r128_ioctl.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_ioctl.h,v 1.6 2002/12/16 16:18:53 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_lock.c b/src/mesa/drivers/dri/r128/r128_lock.c index ea23b007f3..3478e12ad0 100644 --- a/src/mesa/drivers/dri/r128/r128_lock.c +++ b/src/mesa/drivers/dri/r128/r128_lock.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_lock.c,v 1.5 2002/10/30 12:51:38 alanh Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_lock.h b/src/mesa/drivers/dri/r128/r128_lock.h index 39bdde9820..1fc8cbe29f 100644 --- a/src/mesa/drivers/dri/r128/r128_lock.h +++ b/src/mesa/drivers/dri/r128/r128_lock.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_lock.h,v 1.4 2001/01/08 01:07:21 martin Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_screen.c b/src/mesa/drivers/dri/r128/r128_screen.c index 880dee85c2..0722b80ee5 100644 --- a/src/mesa/drivers/dri/r128/r128_screen.c +++ b/src/mesa/drivers/dri/r128/r128_screen.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_screen.c,v 1.9 2003/03/26 20:43:49 tsi Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_screen.h b/src/mesa/drivers/dri/r128/r128_screen.h index 8db8eea358..b31e87661b 100644 --- a/src/mesa/drivers/dri/r128/r128_screen.h +++ b/src/mesa/drivers/dri/r128/r128_screen.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_screen.h,v 1.7 2002/12/16 16:18:53 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_span.c b/src/mesa/drivers/dri/r128/r128_span.c index 85798c1601..c5b6480db9 100644 --- a/src/mesa/drivers/dri/r128/r128_span.c +++ b/src/mesa/drivers/dri/r128/r128_span.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_span.c,v 1.8 2002/10/30 12:51:39 alanh Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_span.h b/src/mesa/drivers/dri/r128/r128_span.h index fd7c2d1394..9af4058129 100644 --- a/src/mesa/drivers/dri/r128/r128_span.h +++ b/src/mesa/drivers/dri/r128/r128_span.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_span.h,v 1.3 2001/01/08 01:07:21 martin Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_state.c b/src/mesa/drivers/dri/r128/r128_state.c index e476afa5d8..58c3a27ee8 100644 --- a/src/mesa/drivers/dri/r128/r128_state.c +++ b/src/mesa/drivers/dri/r128/r128_state.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_state.c,v 1.11 2002/10/30 12:51:39 alanh Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_state.h b/src/mesa/drivers/dri/r128/r128_state.h index 6f0a6a6557..a44327dfb3 100644 --- a/src/mesa/drivers/dri/r128/r128_state.h +++ b/src/mesa/drivers/dri/r128/r128_state.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_state.h,v 1.3 2001/01/08 01:07:21 martin Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_tex.c b/src/mesa/drivers/dri/r128/r128_tex.c index 3b2d017c1f..554a92287f 100644 --- a/src/mesa/drivers/dri/r128/r128_tex.c +++ b/src/mesa/drivers/dri/r128/r128_tex.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tex.c,v 1.14 2002/11/05 17:46:08 tsi Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_tex.h b/src/mesa/drivers/dri/r128/r128_tex.h index 54053b8b31..994dffb5a9 100644 --- a/src/mesa/drivers/dri/r128/r128_tex.h +++ b/src/mesa/drivers/dri/r128/r128_tex.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tex.h,v 1.7 2002/02/22 21:44:58 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_texmem.c b/src/mesa/drivers/dri/r128/r128_texmem.c index d011a75671..a7d0280636 100644 --- a/src/mesa/drivers/dri/r128/r128_texmem.c +++ b/src/mesa/drivers/dri/r128/r128_texmem.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_texmem.c,v 1.1 2002/02/22 21:44:58 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_texobj.h b/src/mesa/drivers/dri/r128/r128_texobj.h index 282e887149..08eac87758 100644 --- a/src/mesa/drivers/dri/r128/r128_texobj.h +++ b/src/mesa/drivers/dri/r128/r128_texobj.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_texobj.h,v 1.5 2002/02/22 21:44:58 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_texstate.c b/src/mesa/drivers/dri/r128/r128_texstate.c index 6b43f21cd4..211b9ea2a9 100644 --- a/src/mesa/drivers/dri/r128/r128_texstate.c +++ b/src/mesa/drivers/dri/r128/r128_texstate.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_texstate.c,v 1.1 2002/02/22 21:44:58 dawes Exp $ */ /************************************************************************** Copyright 1999, 2000 ATI Technologies Inc. and Precision Insight, Inc., diff --git a/src/mesa/drivers/dri/r128/r128_tris.c b/src/mesa/drivers/dri/r128/r128_tris.c index f406e928c5..f2f124360c 100644 --- a/src/mesa/drivers/dri/r128/r128_tris.c +++ b/src/mesa/drivers/dri/r128/r128_tris.c @@ -1,4 +1,4 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tris.c,v 1.8 2002/10/30 12:51:43 alanh Exp $ */ /* -*- c-basic-offset: 3 -*- */ +/* -*- c-basic-offset: 3 -*- */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/r128/r128_tris.h b/src/mesa/drivers/dri/r128/r128_tris.h index 755d3320b0..c8f0a4809b 100644 --- a/src/mesa/drivers/dri/r128/r128_tris.h +++ b/src/mesa/drivers/dri/r128/r128_tris.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tris.h,v 1.8 2002/10/30 12:51:43 alanh Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/r128/server/r128.h b/src/mesa/drivers/dri/r128/server/r128.h index ce98b1b915..ca08d7c86a 100644 --- a/src/mesa/drivers/dri/r128/server/r128.h +++ b/src/mesa/drivers/dri/r128/server/r128.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/r128.h,v 1.24 2002/12/16 16:19:10 dawes Exp $ */ /* * Copyright 1999, 2000 ATI Technologies Inc., Markham, Ontario, * Precision Insight, Inc., Cedar Park, Texas, and diff --git a/src/mesa/drivers/dri/r128/server/r128_dri.c b/src/mesa/drivers/dri/r128/server/r128_dri.c index 5edf1e1003..efe9232dc2 100644 --- a/src/mesa/drivers/dri/r128/server/r128_dri.c +++ b/src/mesa/drivers/dri/r128/server/r128_dri.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/r128_dri.c,v 1.28 2003/02/07 20:41:14 martin Exp $ */ /* * Copyright 1999, 2000 ATI Technologies Inc., Markham, Ontario, * Precision Insight, Inc., Cedar Park, Texas, and diff --git a/src/mesa/drivers/dri/r128/server/r128_dri.h b/src/mesa/drivers/dri/r128/server/r128_dri.h index 67ade70de4..430e5f580b 100644 --- a/src/mesa/drivers/dri/r128/server/r128_dri.h +++ b/src/mesa/drivers/dri/r128/server/r128_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/r128_dri.h,v 1.7 2002/10/30 12:52:12 alanh Exp $ */ /* * Copyright 1999, 2000 ATI Technologies Inc., Markham, Ontario, * Precision Insight, Inc., Cedar Park, Texas, and diff --git a/src/mesa/drivers/dri/r128/server/r128_macros.h b/src/mesa/drivers/dri/r128/server/r128_macros.h index 93b7feb02c..f7b945da93 100644 --- a/src/mesa/drivers/dri/r128/server/r128_macros.h +++ b/src/mesa/drivers/dri/r128/server/r128_macros.h @@ -35,7 +35,6 @@ * DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/R128_reg.h,v 1.20 2002/10/12 01:38:07 martin Exp $ */ #ifndef _R128_MACROS_H_ #define _R128_MACROS_H_ diff --git a/src/mesa/drivers/dri/r128/server/r128_reg.h b/src/mesa/drivers/dri/r128/server/r128_reg.h index 5669452d74..50033540b9 100644 --- a/src/mesa/drivers/dri/r128/server/r128_reg.h +++ b/src/mesa/drivers/dri/r128/server/r128_reg.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/r128_reg.h,v 1.15 2002/12/16 16:19:11 dawes Exp $ */ /* * Copyright 1999, 2000 ATI Technologies Inc., Markham, Ontario, * Precision Insight, Inc., Cedar Park, Texas, and diff --git a/src/mesa/drivers/dri/r128/server/r128_version.h b/src/mesa/drivers/dri/r128/server/r128_version.h index 589d8d40bc..783711ef97 100644 --- a/src/mesa/drivers/dri/r128/server/r128_version.h +++ b/src/mesa/drivers/dri/r128/server/r128_version.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/r128_version.h,v 1.6 2003/01/01 19:16:35 tsi Exp $ */ /* * Copyright 2000 through 2003 by Marc Aurele La France (TSI @ UQV), tsi@xfree86.org * diff --git a/src/mesa/drivers/dri/radeon/radeon_compat.c b/src/mesa/drivers/dri/radeon/radeon_compat.c index 1cbe3407ba..bd467fb15b 100644 --- a/src/mesa/drivers/dri/radeon/radeon_compat.c +++ b/src/mesa/drivers/dri/radeon/radeon_compat.c @@ -1,4 +1,3 @@ -/* $XFree86$ */ /************************************************************************** Copyright 2002 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_context.c b/src/mesa/drivers/dri/radeon/radeon_context.c index 9451ec4aa5..ba93a054ae 100644 --- a/src/mesa/drivers/dri/radeon/radeon_context.c +++ b/src/mesa/drivers/dri/radeon/radeon_context.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_context.c,v 1.9 2003/09/24 02:43:12 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_ioctl.c b/src/mesa/drivers/dri/radeon/radeon_ioctl.c index 4c64bc201a..f7e461239e 100644 --- a/src/mesa/drivers/dri/radeon/radeon_ioctl.c +++ b/src/mesa/drivers/dri/radeon/radeon_ioctl.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_ioctl.c,v 1.11 2003/01/29 22:04:59 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_ioctl.h b/src/mesa/drivers/dri/radeon/radeon_ioctl.h index 11a7d02b1b..020a5c21e2 100644 --- a/src/mesa/drivers/dri/radeon/radeon_ioctl.h +++ b/src/mesa/drivers/dri/radeon/radeon_ioctl.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_ioctl.h,v 1.6 2002/12/16 16:18:58 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_lighting.c b/src/mesa/drivers/dri/radeon/radeon_lighting.c index 44e00af0ef..5e9b9c3051 100644 --- a/src/mesa/drivers/dri/radeon/radeon_lighting.c +++ b/src/mesa/drivers/dri/radeon/radeon_lighting.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_state.c,v 1.5 2002/09/16 18:05:20 eich Exp $ */ /* * Copyright 2000, 2001 VA Linux Systems Inc., Fremont, California. * diff --git a/src/mesa/drivers/dri/radeon/radeon_maos.h b/src/mesa/drivers/dri/radeon/radeon_maos.h index 09039d6840..b8935e84a0 100644 --- a/src/mesa/drivers/dri/radeon/radeon_maos.h +++ b/src/mesa/drivers/dri/radeon/radeon_maos.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_maos.h,v 1.1 2002/10/30 12:51:55 alanh Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_maos_arrays.c b/src/mesa/drivers/dri/radeon/radeon_maos_arrays.c index 49118b5e37..b61f5e0f3e 100644 --- a/src/mesa/drivers/dri/radeon/radeon_maos_arrays.c +++ b/src/mesa/drivers/dri/radeon/radeon_maos_arrays.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_maos_arrays.c,v 1.1 2002/10/30 12:51:55 alanh Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_maos_verts.c b/src/mesa/drivers/dri/radeon/radeon_maos_verts.c index 65dbecf7a6..d5ceedfa24 100644 --- a/src/mesa/drivers/dri/radeon/radeon_maos_verts.c +++ b/src/mesa/drivers/dri/radeon/radeon_maos_verts.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_maos_verts.c,v 1.1 2002/10/30 12:51:55 alanh Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_sanity.c b/src/mesa/drivers/dri/radeon/radeon_sanity.c index 557057784c..bdfb7240d7 100644 --- a/src/mesa/drivers/dri/radeon/radeon_sanity.c +++ b/src/mesa/drivers/dri/radeon/radeon_sanity.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_sanity.c,v 1.1 2002/10/30 12:51:55 alanh Exp $ */ /************************************************************************** Copyright 2002 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_screen.c b/src/mesa/drivers/dri/radeon/radeon_screen.c index aa7fb633dd..4a45948608 100644 --- a/src/mesa/drivers/dri/radeon/radeon_screen.c +++ b/src/mesa/drivers/dri/radeon/radeon_screen.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_screen.c,v 1.7 2003/03/26 20:43:51 tsi Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_screen.h b/src/mesa/drivers/dri/radeon/radeon_screen.h index 25e6fcf399..f8c0cc96df 100644 --- a/src/mesa/drivers/dri/radeon/radeon_screen.h +++ b/src/mesa/drivers/dri/radeon/radeon_screen.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_screen.h,v 1.5 2002/12/16 16:18:58 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_state.c b/src/mesa/drivers/dri/radeon/radeon_state.c index 4de05c7697..856d27df75 100644 --- a/src/mesa/drivers/dri/radeon/radeon_state.c +++ b/src/mesa/drivers/dri/radeon/radeon_state.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_state.c,v 1.8 2002/12/16 16:18:58 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/radeon/radeon_state.h b/src/mesa/drivers/dri/radeon/radeon_state.h index ad7db3b677..2171879f75 100644 --- a/src/mesa/drivers/dri/radeon/radeon_state.h +++ b/src/mesa/drivers/dri/radeon/radeon_state.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_state.h,v 1.5 2002/11/05 17:46:09 tsi Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_state_init.c b/src/mesa/drivers/dri/radeon/radeon_state_init.c index 5fc34f0933..c876a596e6 100644 --- a/src/mesa/drivers/dri/radeon/radeon_state_init.c +++ b/src/mesa/drivers/dri/radeon/radeon_state_init.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_state_init.c,v 1.3 2003/02/22 06:21:11 dawes Exp $ */ /* * Copyright 2000, 2001 VA Linux Systems Inc., Fremont, California. * diff --git a/src/mesa/drivers/dri/radeon/radeon_swtcl.c b/src/mesa/drivers/dri/radeon/radeon_swtcl.c index 7ce1fa67cf..2b3ae14ff7 100644 --- a/src/mesa/drivers/dri/radeon/radeon_swtcl.c +++ b/src/mesa/drivers/dri/radeon/radeon_swtcl.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_swtcl.c,v 1.6 2003/05/06 23:52:08 daenzer Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_swtcl.h b/src/mesa/drivers/dri/radeon/radeon_swtcl.h index 64f9019513..1feedf185d 100644 --- a/src/mesa/drivers/dri/radeon/radeon_swtcl.h +++ b/src/mesa/drivers/dri/radeon/radeon_swtcl.h @@ -1,4 +1,3 @@ -/* $XFree86$ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_tcl.c b/src/mesa/drivers/dri/radeon/radeon_tcl.c index 5ad044c262..d35be1ca88 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tcl.c +++ b/src/mesa/drivers/dri/radeon/radeon_tcl.c @@ -1,4 +1,3 @@ -/* $XFree86$ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_tcl.h b/src/mesa/drivers/dri/radeon/radeon_tcl.h index 168ab958a2..dccbea5fdb 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tcl.h +++ b/src/mesa/drivers/dri/radeon/radeon_tcl.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_tcl.h,v 1.2 2003/02/08 21:26:45 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_tex.c b/src/mesa/drivers/dri/radeon/radeon_tex.c index edaea6c209..f3eb9d8eef 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tex.c +++ b/src/mesa/drivers/dri/radeon/radeon_tex.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_tex.c,v 1.6 2002/09/16 18:05:20 eich Exp $ */ /* Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/radeon/radeon_tex.h b/src/mesa/drivers/dri/radeon/radeon_tex.h index a806981ae6..bdf086dfee 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tex.h +++ b/src/mesa/drivers/dri/radeon/radeon_tex.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_tex.h,v 1.3 2002/02/22 21:45:01 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_texmem.c b/src/mesa/drivers/dri/radeon/radeon_texmem.c index 20f25dd34b..f7520f1dea 100644 --- a/src/mesa/drivers/dri/radeon/radeon_texmem.c +++ b/src/mesa/drivers/dri/radeon/radeon_texmem.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_texmem.c,v 1.7 2002/12/16 16:18:59 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/radeon_texstate.c b/src/mesa/drivers/dri/radeon/radeon_texstate.c index 37bb749223..ae8d527cf4 100644 --- a/src/mesa/drivers/dri/radeon/radeon_texstate.c +++ b/src/mesa/drivers/dri/radeon/radeon_texstate.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/radeon/radeon_texstate.c,v 1.6 2002/12/16 16:18:59 dawes Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/radeon/server/radeon.h b/src/mesa/drivers/dri/radeon/server/radeon.h index 6f6c2e6d25..3fb1e37c53 100644 --- a/src/mesa/drivers/dri/radeon/server/radeon.h +++ b/src/mesa/drivers/dri/radeon/server/radeon.h @@ -31,7 +31,6 @@ * DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/radeon.h,v 1.29 2002/10/12 01:38:07 martin Exp $ */ #ifndef _RADEON_H_ #define _RADEON_H_ diff --git a/src/mesa/drivers/dri/radeon/server/radeon_dri.h b/src/mesa/drivers/dri/radeon/server/radeon_dri.h index ecd5323339..dc51372107 100644 --- a/src/mesa/drivers/dri/radeon/server/radeon_dri.h +++ b/src/mesa/drivers/dri/radeon/server/radeon_dri.h @@ -34,7 +34,6 @@ * DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/radeon_dri.h,v 1.3 2002/04/24 16:20:40 martin Exp $ */ #ifndef _RADEON_DRI_ #define _RADEON_DRI_ diff --git a/src/mesa/drivers/dri/radeon/server/radeon_macros.h b/src/mesa/drivers/dri/radeon/server/radeon_macros.h index 60f0fa2d35..355262c9ba 100644 --- a/src/mesa/drivers/dri/radeon/server/radeon_macros.h +++ b/src/mesa/drivers/dri/radeon/server/radeon_macros.h @@ -35,7 +35,6 @@ * DEALINGS IN THE SOFTWARE. */ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/radeon_reg.h,v 1.20 2002/10/12 01:38:07 martin Exp $ */ #ifndef _RADEON_MACROS_H_ #define _RADEON_MACROS_H_ diff --git a/src/mesa/drivers/dri/radeon/server/radeon_reg.h b/src/mesa/drivers/dri/radeon/server/radeon_reg.h index 4dcce63846..596a8aa715 100644 --- a/src/mesa/drivers/dri/radeon/server/radeon_reg.h +++ b/src/mesa/drivers/dri/radeon/server/radeon_reg.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/ati/radeon_reg.h,v 1.30 2003/10/07 22:47:12 martin Exp $ */ /* * Copyright 2000 ATI Technologies Inc., Markham, Ontario, and * VA Linux Systems Inc., Fremont, California. diff --git a/src/mesa/drivers/dri/savage/savagetris.c b/src/mesa/drivers/dri/savage/savagetris.c index 4ce2f60b4f..52c7f5fa76 100644 --- a/src/mesa/drivers/dri/savage/savagetris.c +++ b/src/mesa/drivers/dri/savage/savagetris.c @@ -1,4 +1,4 @@ -/* $XFree86$ */ /* -*- c-basic-offset: 3 -*- */ +/* -*- c-basic-offset: 3 -*- */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/savage/savagetris.h b/src/mesa/drivers/dri/savage/savagetris.h index 00803e7ff3..b2b3d951c6 100644 --- a/src/mesa/drivers/dri/savage/savagetris.h +++ b/src/mesa/drivers/dri/savage/savagetris.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tris.h,v 1.4 2001/01/08 01:07:24 martin Exp $ */ /************************************************************************** Copyright 2000, 2001 ATI Technologies Inc., Ontario, Canada, and diff --git a/src/mesa/drivers/dri/sis/server/sis_common.h b/src/mesa/drivers/dri/sis/server/sis_common.h index cbddf0c737..bd9bab846f 100644 --- a/src/mesa/drivers/dri/sis/server/sis_common.h +++ b/src/mesa/drivers/dri/sis/server/sis_common.h @@ -1,4 +1,3 @@ -/* * $XFree86: xc/programs/Xserver/hw/xfree86/drivers/sis/sis_common.h,v 1.1 2003/08/29 08:52:12 twini Exp $ */ /* * Common header definitions for SiS 2D/3D/DRM suite * diff --git a/src/mesa/drivers/dri/sis/server/sis_dri.h b/src/mesa/drivers/dri/sis/server/sis_dri.h index a05662430e..f0171f3c0f 100644 --- a/src/mesa/drivers/dri/sis/server/sis_dri.h +++ b/src/mesa/drivers/dri/sis/server/sis_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/sis/sis_dri.h,v 1.9 2003/08/29 08:50:54 twini Exp $ */ /* modified from tdfx_dri.h */ diff --git a/src/mesa/drivers/dri/sis/sis_alloc.c b/src/mesa/drivers/dri/sis/sis_alloc.c index b696eeb51a..4ca4052803 100644 --- a/src/mesa/drivers/dri/sis/sis_alloc.c +++ b/src/mesa/drivers/dri/sis/sis_alloc.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_alloc.c,v 1.7 2001/01/08 01:07:29 martin Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_alloc.h b/src/mesa/drivers/dri/sis/sis_alloc.h index e76fc53fe2..eb784afad9 100644 --- a/src/mesa/drivers/dri/sis/sis_alloc.h +++ b/src/mesa/drivers/dri/sis/sis_alloc.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_clear.c b/src/mesa/drivers/dri/sis/sis_clear.c index fb92d06c73..174f3c0768 100644 --- a/src/mesa/drivers/dri/sis/sis_clear.c +++ b/src/mesa/drivers/dri/sis/sis_clear.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_clear.c,v 1.5 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_context.c b/src/mesa/drivers/dri/sis/sis_context.c index b21df0a61e..04c7464c5e 100644 --- a/src/mesa/drivers/dri/sis/sis_context.c +++ b/src/mesa/drivers/dri/sis/sis_context.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_ctx.c,v 1.3 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_context.h b/src/mesa/drivers/dri/sis/sis_context.h index c349bf96ed..b81812d6ce 100644 --- a/src/mesa/drivers/dri/sis/sis_context.h +++ b/src/mesa/drivers/dri/sis/sis_context.h @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_dd.c b/src/mesa/drivers/dri/sis/sis_dd.c index 8fc7896b87..989c159a80 100644 --- a/src/mesa/drivers/dri/sis/sis_dd.c +++ b/src/mesa/drivers/dri/sis/sis_dd.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_ctx.c,v 1.3 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_dd.h b/src/mesa/drivers/dri/sis/sis_dd.h index da76596e92..b141243a59 100644 --- a/src/mesa/drivers/dri/sis/sis_dd.h +++ b/src/mesa/drivers/dri/sis/sis_dd.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_fog.c b/src/mesa/drivers/dri/sis/sis_fog.c index fe9a3c95d6..ba5ac90851 100644 --- a/src/mesa/drivers/dri/sis/sis_fog.c +++ b/src/mesa/drivers/dri/sis/sis_fog.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_fog.c,v 1.3 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_lock.c b/src/mesa/drivers/dri/sis/sis_lock.c index 70ca8e6cbc..0ea64e3498 100644 --- a/src/mesa/drivers/dri/sis/sis_lock.c +++ b/src/mesa/drivers/dri/sis/sis_lock.c @@ -1,4 +1,3 @@ -/* $XFree86$ */ /************************************************************************** Copyright 2003 Eric Anholt diff --git a/src/mesa/drivers/dri/sis/sis_lock.h b/src/mesa/drivers/dri/sis/sis_lock.h index fef9931963..54844e9b09 100644 --- a/src/mesa/drivers/dri/sis/sis_lock.h +++ b/src/mesa/drivers/dri/sis/sis_lock.h @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_reg.h b/src/mesa/drivers/dri/sis/sis_reg.h index 78c6660181..e40c4371bf 100644 --- a/src/mesa/drivers/dri/sis/sis_reg.h +++ b/src/mesa/drivers/dri/sis/sis_reg.h @@ -25,7 +25,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_reg.h,v 1.3 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_screen.c b/src/mesa/drivers/dri/sis/sis_screen.c index 89d734ba78..d90482f3d7 100644 --- a/src/mesa/drivers/dri/sis/sis_screen.c +++ b/src/mesa/drivers/dri/sis/sis_screen.c @@ -1,4 +1,3 @@ -/* $XFree86$ */ /************************************************************************** Copyright 2003 Eric Anholt diff --git a/src/mesa/drivers/dri/sis/sis_screen.h b/src/mesa/drivers/dri/sis/sis_screen.h index d5b2101e98..07c29cfa09 100644 --- a/src/mesa/drivers/dri/sis/sis_screen.h +++ b/src/mesa/drivers/dri/sis/sis_screen.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_span.c b/src/mesa/drivers/dri/sis/sis_span.c index ea6db6781d..dc50bda877 100644 --- a/src/mesa/drivers/dri/sis/sis_span.c +++ b/src/mesa/drivers/dri/sis/sis_span.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_span.c,v 1.5 2001/03/21 16:14:26 dawes Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_span.h b/src/mesa/drivers/dri/sis/sis_span.h index 4b0add2ac2..a1f817c44c 100644 --- a/src/mesa/drivers/dri/sis/sis_span.h +++ b/src/mesa/drivers/dri/sis/sis_span.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_state.c b/src/mesa/drivers/dri/sis/sis_state.c index 33a2f089b8..305c63f73f 100644 --- a/src/mesa/drivers/dri/sis/sis_state.c +++ b/src/mesa/drivers/dri/sis/sis_state.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_ctx.c,v 1.3 2000/09/26 15:56:48 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_state.h b/src/mesa/drivers/dri/sis/sis_state.h index 8f7e2acb92..2d0ea9c5fb 100644 --- a/src/mesa/drivers/dri/sis/sis_state.h +++ b/src/mesa/drivers/dri/sis/sis_state.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_stencil.c b/src/mesa/drivers/dri/sis/sis_stencil.c index a1ce2966e8..55c0440eba 100644 --- a/src/mesa/drivers/dri/sis/sis_stencil.c +++ b/src/mesa/drivers/dri/sis/sis_stencil.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86: xc/lib/GL/mesa/src/drv/sis/sis_stencil.c,v 1.3 2000/09/26 15:56:49 tsi Exp $ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_stencil.h b/src/mesa/drivers/dri/sis/sis_stencil.h index 4a36c98f3d..6b556c4378 100644 --- a/src/mesa/drivers/dri/sis/sis_stencil.h +++ b/src/mesa/drivers/dri/sis/sis_stencil.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_tex.c b/src/mesa/drivers/dri/sis/sis_tex.c index be87f16e29..5e10c610f8 100644 --- a/src/mesa/drivers/dri/sis/sis_tex.c +++ b/src/mesa/drivers/dri/sis/sis_tex.c @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_tex.h b/src/mesa/drivers/dri/sis/sis_tex.h index 8ddc7c469e..c499e80e86 100644 --- a/src/mesa/drivers/dri/sis/sis_tex.h +++ b/src/mesa/drivers/dri/sis/sis_tex.h @@ -22,7 +22,6 @@ AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_texstate.c b/src/mesa/drivers/dri/sis/sis_texstate.c index 7ef20f880c..4f813bb81c 100644 --- a/src/mesa/drivers/dri/sis/sis_texstate.c +++ b/src/mesa/drivers/dri/sis/sis_texstate.c @@ -24,7 +24,6 @@ OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. **************************************************************************/ -/* $XFree86$ */ /* * Authors: diff --git a/src/mesa/drivers/dri/sis/sis_tris.h b/src/mesa/drivers/dri/sis/sis_tris.h index 5e07acc211..499eb4d24d 100644 --- a/src/mesa/drivers/dri/sis/sis_tris.h +++ b/src/mesa/drivers/dri/sis/sis_tris.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/r128/r128_tris.h,v 1.8 2002/10/30 12:51:43 alanh Exp $ */ /************************************************************************** Copyright 2003 Eric Anholt diff --git a/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fastpath.S b/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fastpath.S index 0f4cc45089..500c97c536 100644 --- a/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fastpath.S +++ b/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fastpath.S @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/X86/fx_3dnow_fastpath.S,v 1.2 2000/09/26 15:56:51 tsi Exp $ */ #include "../../X86/assyntax.h" diff --git a/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fasttmp.h b/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fasttmp.h index 9ec4935d78..78c5fef746 100644 --- a/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fasttmp.h +++ b/src/mesa/drivers/dri/tdfx/X86/fx_3dnow_fasttmp.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/X86/fx_3dnow_fasttmp.h,v 1.2 2000/09/26 15:56:51 tsi Exp $ */ #if !defined(NASM_ASSEMBLER) && !defined(MASM_ASSEMBLER) #define TAGLLBL(a) TAG(.L##a) diff --git a/src/mesa/drivers/dri/tdfx/dri_glide.h b/src/mesa/drivers/dri/tdfx/dri_glide.h index 52a53f7dd3..3ad2bf68c6 100644 --- a/src/mesa/drivers/dri/tdfx/dri_glide.h +++ b/src/mesa/drivers/dri/tdfx/dri_glide.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/dri_glide.h,v 1.1 2001/03/21 16:14:26 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/server/tdfx_dri.h b/src/mesa/drivers/dri/tdfx/server/tdfx_dri.h index acd0b9ae5b..dc29984a27 100644 --- a/src/mesa/drivers/dri/tdfx/server/tdfx_dri.h +++ b/src/mesa/drivers/dri/tdfx/server/tdfx_dri.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/tdfx/tdfx_dri.h,v 1.5 2001/03/21 17:02:26 dawes Exp $ */ #ifndef _TDFX_DRI_ #define _TDFX_DRI_ diff --git a/src/mesa/drivers/dri/tdfx/tdfx_context.h b/src/mesa/drivers/dri/tdfx/tdfx_context.h index 89a7a9d6c4..05673cd186 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_context.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_context.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_context.h,v 1.5 2002/02/24 21:51:10 dawes Exp $ */ /* * New fixes: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_dd.h b/src/mesa/drivers/dri/tdfx/tdfx_dd.h index 5ceba9d5f0..bd61e10605 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_dd.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_dd.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_dd.h,v 1.1 2001/03/21 16:14:27 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_glide.h b/src/mesa/drivers/dri/tdfx/tdfx_glide.h index f077aa678b..69e5399e72 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_glide.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_glide.h @@ -2,7 +2,6 @@ * This file defines macros and types necessary for accessing glide3. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_glide.h,v 1.1 2002/02/22 21:45:03 dawes Exp $ */ #ifndef NEWGLIDE_H #define NEWGLIDE_H diff --git a/src/mesa/drivers/dri/tdfx/tdfx_lock.c b/src/mesa/drivers/dri/tdfx/tdfx_lock.c index a20c91d030..17cdc51ee1 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_lock.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_lock.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_lock.c,v 1.5 2002/12/16 16:19:00 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_lock.h b/src/mesa/drivers/dri/tdfx/tdfx_lock.h index 616e65b2a1..74e3f5c9cc 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_lock.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_lock.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_lock.h,v 1.3 2002/02/22 21:45:03 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_pixels.c b/src/mesa/drivers/dri/tdfx/tdfx_pixels.c index 732270b2bd..b5c01f6ef2 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_pixels.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_pixels.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_pixels.c,v 1.4 2002/02/22 21:45:03 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_pixels.h b/src/mesa/drivers/dri/tdfx/tdfx_pixels.h index c38ce070ca..55f7eedef8 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_pixels.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_pixels.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_pixels.h,v 1.2 2002/02/22 21:45:03 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_render.c b/src/mesa/drivers/dri/tdfx/tdfx_render.c index f36c97bfeb..e374f09df3 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_render.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_render.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_render.c,v 1.4 2002/02/22 21:45:03 dawes Exp $ */ /* * New fixes: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_render.h b/src/mesa/drivers/dri/tdfx/tdfx_render.h index 09d0d90197..18c6168333 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_render.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_render.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_render.h,v 1.1 2001/03/21 16:14:28 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_screen.c b/src/mesa/drivers/dri/tdfx/tdfx_screen.c index 1f9ff4e30c..7761664394 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_screen.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_screen.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_screen.c,v 1.3 2002/02/22 21:45:03 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_screen.h b/src/mesa/drivers/dri/tdfx/tdfx_screen.h index 90be89a352..5a68898b36 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_screen.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_screen.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_screen.h,v 1.2 2002/02/22 21:45:03 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_span.c b/src/mesa/drivers/dri/tdfx/tdfx_span.c index d9d52d2b6f..6b38fa5a01 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_span.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_span.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_span.c,v 1.7 2002/10/30 12:52:00 alanh Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_span.h b/src/mesa/drivers/dri/tdfx/tdfx_span.h index 62044144f0..5af9f9b301 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_span.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_span.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_span.h,v 1.1 2001/03/21 16:14:28 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_state.c b/src/mesa/drivers/dri/tdfx/tdfx_state.c index 42cb5dfaa3..3688c76a5c 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_state.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_state.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_state.c,v 1.7 2002/10/30 12:52:00 alanh Exp $ */ /* * New fixes: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_state.h b/src/mesa/drivers/dri/tdfx/tdfx_state.h index b10c38f591..591ea5b083 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_state.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_state.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_state.h,v 1.2 2002/02/22 21:45:04 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_tex.c b/src/mesa/drivers/dri/tdfx/tdfx_tex.c index 89865d9637..65e665ee39 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_tex.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_tex.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_tex.c,v 1.7 2002/11/05 17:46:10 tsi Exp $ */ /* * New fixes: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_tex.h b/src/mesa/drivers/dri/tdfx/tdfx_tex.h index f536c25a2f..a445935a01 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_tex.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_tex.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_tex.h,v 1.2 2002/02/22 21:45:04 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_texman.c b/src/mesa/drivers/dri/tdfx/tdfx_texman.c index 6f782f687f..f9b2726da2 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_texman.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_texman.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_texman.c,v 1.5 2002/02/22 21:45:04 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_texman.h b/src/mesa/drivers/dri/tdfx/tdfx_texman.h index 739d4e142f..a9af4cb7c5 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_texman.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_texman.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_texman.h,v 1.2 2002/02/22 21:45:04 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_texstate.c b/src/mesa/drivers/dri/tdfx/tdfx_texstate.c index fda9ce5684..bbd2c8cfee 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_texstate.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_texstate.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_texstate.c,v 1.2 2002/02/22 21:45:04 dawes Exp $ */ /* * New fixes: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_texstate.h b/src/mesa/drivers/dri/tdfx/tdfx_texstate.h index 234ed4439a..0c5c4101ca 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_texstate.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_texstate.h @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_texstate.h,v 1.1 2002/02/22 21:45:04 dawes Exp $ */ /* * Original rewrite: diff --git a/src/mesa/drivers/dri/tdfx/tdfx_tris.c b/src/mesa/drivers/dri/tdfx/tdfx_tris.c index 7252a7e7dc..59ff35a7fa 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_tris.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_tris.c @@ -23,7 +23,6 @@ * OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_tris.c,v 1.4 2002/10/30 12:52:01 alanh Exp $ */ /* New fixes: * Daniel Borca , 19 Jul 2004 diff --git a/src/mesa/drivers/dri/tdfx/tdfx_tris.h b/src/mesa/drivers/dri/tdfx/tdfx_tris.h index 57e5d9b0ae..a591decf1d 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_tris.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_tris.h @@ -29,7 +29,6 @@ * Keith Whitwell * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_tris.h,v 1.5 2002/10/30 12:52:01 alanh Exp $ */ #ifndef TDFX_TRIS_INC #define TDFX_TRIS_INC diff --git a/src/mesa/drivers/dri/tdfx/tdfx_vb.c b/src/mesa/drivers/dri/tdfx/tdfx_vb.c index 0580135d1b..62885daaa5 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_vb.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_vb.c @@ -22,7 +22,6 @@ * * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_vb.c,v 1.3 2002/10/30 12:52:01 alanh Exp $ */ #include "glheader.h" #include "mtypes.h" diff --git a/src/mesa/drivers/dri/tdfx/tdfx_vb.h b/src/mesa/drivers/dri/tdfx/tdfx_vb.h index 7b7cd9065a..6389ec95b1 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_vb.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_vb.h @@ -22,7 +22,6 @@ * * */ -/* $XFree86: xc/lib/GL/mesa/src/drv/tdfx/tdfx_vb.h,v 1.2 2002/02/22 21:45:04 dawes Exp $ */ #ifndef TDFXVB_INC #define TDFXVB_INC diff --git a/src/mesa/drivers/dri/unichrome/server/via_dri.c b/src/mesa/drivers/dri/unichrome/server/via_dri.c index 6944bd66f9..9833145940 100644 --- a/src/mesa/drivers/dri/unichrome/server/via_dri.c +++ b/src/mesa/drivers/dri/unichrome/server/via_dri.c @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/via/via_dri.c,v 1.4 2003/09/24 02:43:30 dawes Exp $ */ /* * Copyright 1998-2003 VIA Technologies, Inc. All Rights Reserved. * Copyright 2001-2003 S3 Graphics, Inc. All Rights Reserved. diff --git a/src/mesa/drivers/dri/unichrome/server/via_driver.h b/src/mesa/drivers/dri/unichrome/server/via_driver.h index 997b2e41a7..a643fd9fbb 100644 --- a/src/mesa/drivers/dri/unichrome/server/via_driver.h +++ b/src/mesa/drivers/dri/unichrome/server/via_driver.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/via/via_driver.h,v 1.7 2003/11/06 18:38:11 tsi Exp $ */ /* * Copyright 1998-2003 VIA Technologies, Inc. All Rights Reserved. * Copyright 2001-2003 S3 Graphics, Inc. All Rights Reserved. diff --git a/src/mesa/drivers/dri/unichrome/server/via_priv.h b/src/mesa/drivers/dri/unichrome/server/via_priv.h index 587531b37c..352eac0597 100644 --- a/src/mesa/drivers/dri/unichrome/server/via_priv.h +++ b/src/mesa/drivers/dri/unichrome/server/via_priv.h @@ -1,4 +1,3 @@ -/* $XFree86: xc/programs/Xserver/hw/xfree86/drivers/via/via_priv.h,v 1.3 2003/08/27 15:16:12 tsi Exp $ */ #ifndef _VIA_PRIV_H_ #define _VIA_PRIV_H_ 1 diff --git a/src/mesa/drivers/ggi/default/genkgi.h b/src/mesa/drivers/ggi/default/genkgi.h index 022189138f..6d0963416f 100644 --- a/src/mesa/drivers/ggi/default/genkgi.h +++ b/src/mesa/drivers/ggi/default/genkgi.h @@ -1,4 +1,4 @@ -/* $Id: genkgi.h,v 1.3 1999/08/22 08:56:50 jtaylor Exp $ +/* ****************************************************************************** GGIMesa - KGIcon specific overrides for fbcon-mesa diff --git a/src/mesa/drivers/ggi/default/genkgi_mode.c b/src/mesa/drivers/ggi/default/genkgi_mode.c index 938024789f..f81d6a45bd 100644 --- a/src/mesa/drivers/ggi/default/genkgi_mode.c +++ b/src/mesa/drivers/ggi/default/genkgi_mode.c @@ -1,4 +1,4 @@ -/* $Id: genkgi_mode.c,v 1.4 2000/01/07 08:34:44 jtaylor Exp $ +/* ****************************************************************************** display-fbdev-kgicon-generic-mesa diff --git a/src/mesa/drivers/ggi/default/genkgi_visual.c b/src/mesa/drivers/ggi/default/genkgi_visual.c index 17ef9679bb..d7838cae6e 100644 --- a/src/mesa/drivers/ggi/default/genkgi_visual.c +++ b/src/mesa/drivers/ggi/default/genkgi_visual.c @@ -1,4 +1,4 @@ -/* $Id: genkgi_visual.c,v 1.7 2000/06/11 20:11:55 jtaylor Exp $ +/* ****************************************************************************** genkgi_visual.c: visual handling for the generic KGI helper diff --git a/src/mesa/drivers/ggi/include/ggi/mesa/debug.h b/src/mesa/drivers/ggi/include/ggi/mesa/debug.h index 35d11624c6..f461fee72c 100644 --- a/src/mesa/drivers/ggi/include/ggi/mesa/debug.h +++ b/src/mesa/drivers/ggi/include/ggi/mesa/debug.h @@ -1,4 +1,4 @@ -/* $Id: debug.h,v 1.5 2003/09/22 15:18:51 brianp Exp $ +/* ****************************************************************************** GGIMesa debugging macros diff --git a/src/mesa/drivers/svga/svgamesa.c b/src/mesa/drivers/svga/svgamesa.c index d138587569..1e4e185d65 100644 --- a/src/mesa/drivers/svga/svgamesa.c +++ b/src/mesa/drivers/svga/svgamesa.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa.c,v 1.27 2006/10/15 18:51:22 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa15.c b/src/mesa/drivers/svga/svgamesa15.c index ae5104d0c0..934aaa33fb 100644 --- a/src/mesa/drivers/svga/svgamesa15.c +++ b/src/mesa/drivers/svga/svgamesa15.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa15.c,v 1.11.36.1 2006/11/02 12:02:17 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa15.h b/src/mesa/drivers/svga/svgamesa15.h index 3ed7db82ee..d453fb8d35 100644 --- a/src/mesa/drivers/svga/svgamesa15.h +++ b/src/mesa/drivers/svga/svgamesa15.h @@ -1,4 +1,3 @@ -/* $Id: svgamesa15.h,v 1.7 2002/11/11 18:42:39 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa16.c b/src/mesa/drivers/svga/svgamesa16.c index a59937bfb4..9fc8c786e8 100644 --- a/src/mesa/drivers/svga/svgamesa16.c +++ b/src/mesa/drivers/svga/svgamesa16.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa16.c,v 1.11.36.1 2006/11/02 12:02:17 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa16.h b/src/mesa/drivers/svga/svgamesa16.h index 247c1f4045..b80cd3dd7e 100644 --- a/src/mesa/drivers/svga/svgamesa16.h +++ b/src/mesa/drivers/svga/svgamesa16.h @@ -1,4 +1,3 @@ -/* $Id: svgamesa16.h,v 1.6 2002/11/11 18:42:41 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa24.c b/src/mesa/drivers/svga/svgamesa24.c index dd15bf38db..c7c095333f 100644 --- a/src/mesa/drivers/svga/svgamesa24.c +++ b/src/mesa/drivers/svga/svgamesa24.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa24.c,v 1.12.36.1 2006/11/02 12:02:17 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa24.h b/src/mesa/drivers/svga/svgamesa24.h index 54d1a8298b..df5fa68c44 100644 --- a/src/mesa/drivers/svga/svgamesa24.h +++ b/src/mesa/drivers/svga/svgamesa24.h @@ -1,4 +1,3 @@ -/* $Id: svgamesa24.h,v 1.6 2002/11/11 18:42:41 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa32.c b/src/mesa/drivers/svga/svgamesa32.c index 4da18795d8..d089c20c05 100644 --- a/src/mesa/drivers/svga/svgamesa32.c +++ b/src/mesa/drivers/svga/svgamesa32.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa32.c,v 1.12.36.1 2006/11/02 12:02:17 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa32.h b/src/mesa/drivers/svga/svgamesa32.h index f518e11ad5..6cf8315300 100644 --- a/src/mesa/drivers/svga/svgamesa32.h +++ b/src/mesa/drivers/svga/svgamesa32.h @@ -1,4 +1,3 @@ -/* $Id: svgamesa32.h,v 1.6 2002/11/11 18:42:42 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa8.c b/src/mesa/drivers/svga/svgamesa8.c index 4264fcd959..2f7048a930 100644 --- a/src/mesa/drivers/svga/svgamesa8.c +++ b/src/mesa/drivers/svga/svgamesa8.c @@ -1,4 +1,3 @@ -/* $Id: svgamesa8.c,v 1.9.10.1 2006/11/02 12:02:17 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgamesa8.h b/src/mesa/drivers/svga/svgamesa8.h index 1aa25f93fc..d2b0509480 100644 --- a/src/mesa/drivers/svga/svgamesa8.h +++ b/src/mesa/drivers/svga/svgamesa8.h @@ -1,4 +1,3 @@ -/* $Id: svgamesa8.h,v 1.4 2001/02/06 00:03:48 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/svga/svgapix.h b/src/mesa/drivers/svga/svgapix.h index 0b19551bf6..19cb74487d 100644 --- a/src/mesa/drivers/svga/svgapix.h +++ b/src/mesa/drivers/svga/svgapix.h @@ -1,4 +1,3 @@ -/* $Id: svgapix.h,v 1.5 2002/11/11 18:42:44 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gdi/wgl.c b/src/mesa/drivers/windows/gdi/wgl.c index dad3dc1160..6e00d08aba 100644 --- a/src/mesa/drivers/windows/gdi/wgl.c +++ b/src/mesa/drivers/windows/gdi/wgl.c @@ -1,4 +1,3 @@ -/* $Id: wgl.c,v 1.12 2006/03/30 07:58:24 kschultz Exp $ */ /* * This library is free software; you can redistribute it and/or diff --git a/src/mesa/drivers/windows/gldirect/dx7/gld_vb_mesa_render_dx7.c b/src/mesa/drivers/windows/gldirect/dx7/gld_vb_mesa_render_dx7.c index ecc40e8f8b..72e5e1308c 100644 --- a/src/mesa/drivers/windows/gldirect/dx7/gld_vb_mesa_render_dx7.c +++ b/src/mesa/drivers/windows/gldirect/dx7/gld_vb_mesa_render_dx7.c @@ -1,4 +1,3 @@ -/* $Id: gld_vb_mesa_render_dx7.c,v 1.6 2005/08/27 13:56:08 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/dx8/gld_vb_mesa_render_dx8.c b/src/mesa/drivers/windows/gldirect/dx8/gld_vb_mesa_render_dx8.c index 414a2f64bf..9ab562010c 100644 --- a/src/mesa/drivers/windows/gldirect/dx8/gld_vb_mesa_render_dx8.c +++ b/src/mesa/drivers/windows/gldirect/dx8/gld_vb_mesa_render_dx8.c @@ -1,4 +1,3 @@ -/* $Id: gld_vb_mesa_render_dx8.c,v 1.6 2005/08/27 13:56:08 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/dx9/gld_vb_mesa_render_dx9.c b/src/mesa/drivers/windows/gldirect/dx9/gld_vb_mesa_render_dx9.c index c71fdefbae..64acab2d2a 100644 --- a/src/mesa/drivers/windows/gldirect/dx9/gld_vb_mesa_render_dx9.c +++ b/src/mesa/drivers/windows/gldirect/dx9/gld_vb_mesa_render_dx9.c @@ -1,4 +1,3 @@ -/* $Id: gld_vb_mesa_render_dx9.c,v 1.6 2005/08/27 13:56:08 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/gld_debug_clip.c b/src/mesa/drivers/windows/gldirect/gld_debug_clip.c index 1eb19ca84b..044d2e66f4 100644 --- a/src/mesa/drivers/windows/gldirect/gld_debug_clip.c +++ b/src/mesa/drivers/windows/gldirect/gld_debug_clip.c @@ -1,4 +1,3 @@ -/* $Id: gld_debug_clip.c,v 1.1 2004/04/20 11:13:11 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/gld_debug_norm.c b/src/mesa/drivers/windows/gldirect/gld_debug_norm.c index 00c428bd26..c20362bb24 100644 --- a/src/mesa/drivers/windows/gldirect/gld_debug_norm.c +++ b/src/mesa/drivers/windows/gldirect/gld_debug_norm.c @@ -1,4 +1,3 @@ -/* $Id: gld_debug_norm.c,v 1.1 2004/04/20 11:13:11 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/gld_debug_xform.c b/src/mesa/drivers/windows/gldirect/gld_debug_xform.c index d6e64b8ffd..73439dc3b6 100644 --- a/src/mesa/drivers/windows/gldirect/gld_debug_xform.c +++ b/src/mesa/drivers/windows/gldirect/gld_debug_xform.c @@ -1,4 +1,3 @@ -/* $Id: gld_debug_xform.c,v 1.1 2004/04/20 11:13:11 alanh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/drivers/windows/gldirect/mesasw/colors.h b/src/mesa/drivers/windows/gldirect/mesasw/colors.h index 17371a96cc..9c1f2a0540 100644 --- a/src/mesa/drivers/windows/gldirect/mesasw/colors.h +++ b/src/mesa/drivers/windows/gldirect/mesasw/colors.h @@ -18,12 +18,11 @@ * (mark@rsinc.com). */ -/* $Log: ddcolors.h 1997/6/14 by Li Wei(liwei@aiar.xjtu.edu.cn) +/* * Macros for pixel format defined */ /* - * $Log: colors.h,v $ * Revision 1.1 2004/04/20 11:13:11 alanh * add SciTech's GLDirect driver for Windows. * @@ -46,7 +45,6 @@ */ /* - * $Log: colors.h,v $ * Revision 1.1 2004/04/20 11:13:11 alanh * add SciTech's GLDirect driver for Windows. * @@ -69,7 +67,6 @@ */ /* - * $Log: colors.h,v $ * Revision 1.1 2004/04/20 11:13:11 alanh * add SciTech's GLDirect driver for Windows. * @@ -520,4 +517,4 @@ char unsigned const aWinGHalftoneTranslation[216] = 225, 226, 255, -}; \ No newline at end of file +}; diff --git a/src/mesa/glapi/mesadef.py b/src/mesa/glapi/mesadef.py index 097348dae0..0f410fc482 100644 --- a/src/mesa/glapi/mesadef.py +++ b/src/mesa/glapi/mesadef.py @@ -1,6 +1,5 @@ #!/usr/bin/env python -# $Id: mesadef.py,v 1.4 2006/01/25 15:05:36 brianp Exp $ # Mesa 3-D graphics library # Version: 4.1 diff --git a/src/mesa/sparc/norm.S b/src/mesa/sparc/norm.S index 713cd5b375..44950a10a5 100644 --- a/src/mesa/sparc/norm.S +++ b/src/mesa/sparc/norm.S @@ -1,4 +1,3 @@ -/* $Id: norm.S,v 1.5 2005/07/28 00:11:11 idr Exp $ */ #include "sparc_matrix.h" diff --git a/src/mesa/sparc/sparc.h b/src/mesa/sparc/sparc.h index 55ab12122d..a98e4d0e40 100644 --- a/src/mesa/sparc/sparc.h +++ b/src/mesa/sparc/sparc.h @@ -1,4 +1,3 @@ -/* $Id: sparc.h,v 1.3 2001/06/06 22:55:28 davem69 Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/sparc/xform.S b/src/mesa/sparc/xform.S index f44ec794e9..f2b9674bf2 100644 --- a/src/mesa/sparc/xform.S +++ b/src/mesa/sparc/xform.S @@ -1,4 +1,3 @@ -/* $Id: xform.S,v 1.4 2005/07/28 00:11:11 idr Exp $ */ /* TODO * diff --git a/src/mesa/x86-64/x86-64.c b/src/mesa/x86-64/x86-64.c index 09508b66d5..dee09fd648 100644 --- a/src/mesa/x86-64/x86-64.c +++ b/src/mesa/x86-64/x86-64.c @@ -1,4 +1,3 @@ -/* $Id: x86-64.c,v 1.4 2006/10/17 17:03:21 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86-64/x86-64.h b/src/mesa/x86-64/x86-64.h index fdbd154d5d..1d931fa345 100644 --- a/src/mesa/x86-64/x86-64.h +++ b/src/mesa/x86-64/x86-64.h @@ -1,4 +1,3 @@ -/* $Id: x86-64.h,v 1.1 2005/05/07 16:59:59 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86-64/xform4.S b/src/mesa/x86-64/xform4.S index 65328f6666..667ecf6e58 100644 --- a/src/mesa/x86-64/xform4.S +++ b/src/mesa/x86-64/xform4.S @@ -1,4 +1,3 @@ -/* $Id: xform4.S,v 1.2 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow.c b/src/mesa/x86/3dnow.c index 032aa661f4..4122ee4b00 100644 --- a/src/mesa/x86/3dnow.c +++ b/src/mesa/x86/3dnow.c @@ -1,4 +1,3 @@ -/* $Id: 3dnow.c,v 1.24 2005/10/07 17:18:52 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow.h b/src/mesa/x86/3dnow.h index 1f2fd8e8b4..df9f2638d7 100644 --- a/src/mesa/x86/3dnow.h +++ b/src/mesa/x86/3dnow.h @@ -1,4 +1,3 @@ -/* $Id: 3dnow.h,v 1.6 2002/04/09 14:58:03 keithw Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow_normal.S b/src/mesa/x86/3dnow_normal.S index f3bbcb27b7..693a7864db 100644 --- a/src/mesa/x86/3dnow_normal.S +++ b/src/mesa/x86/3dnow_normal.S @@ -1,4 +1,3 @@ -/* $Id: 3dnow_normal.S,v 1.10 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow_xform1.S b/src/mesa/x86/3dnow_xform1.S index 22b12cca06..7665c0ff8b 100644 --- a/src/mesa/x86/3dnow_xform1.S +++ b/src/mesa/x86/3dnow_xform1.S @@ -1,4 +1,3 @@ -/* $Id: 3dnow_xform1.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow_xform2.S b/src/mesa/x86/3dnow_xform2.S index d9e96d04e2..b201d1e901 100644 --- a/src/mesa/x86/3dnow_xform2.S +++ b/src/mesa/x86/3dnow_xform2.S @@ -1,4 +1,3 @@ -/* $Id: 3dnow_xform2.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow_xform3.S b/src/mesa/x86/3dnow_xform3.S index babee1caa0..46f155697d 100644 --- a/src/mesa/x86/3dnow_xform3.S +++ b/src/mesa/x86/3dnow_xform3.S @@ -1,4 +1,3 @@ -/* $Id: 3dnow_xform3.S,v 1.5 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/3dnow_xform4.S b/src/mesa/x86/3dnow_xform4.S index b16d2b12dd..a0c6b193cd 100644 --- a/src/mesa/x86/3dnow_xform4.S +++ b/src/mesa/x86/3dnow_xform4.S @@ -1,4 +1,3 @@ -/* $Id: 3dnow_xform4.S,v 1.5 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/clip_args.h b/src/mesa/x86/clip_args.h index cccf801981..796611fbfd 100644 --- a/src/mesa/x86/clip_args.h +++ b/src/mesa/x86/clip_args.h @@ -1,4 +1,3 @@ -/* $Id: clip_args.h,v 1.5 2002/10/29 20:28:57 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/common_x86_asm.h b/src/mesa/x86/common_x86_asm.h index 9977298328..89312b2437 100644 --- a/src/mesa/x86/common_x86_asm.h +++ b/src/mesa/x86/common_x86_asm.h @@ -1,4 +1,3 @@ -/* $Id: common_x86_asm.h,v 1.12 2005/07/16 00:56:20 ajax Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/common_x86_features.h b/src/mesa/x86/common_x86_features.h index 90509775cf..676af8c1f8 100644 --- a/src/mesa/x86/common_x86_features.h +++ b/src/mesa/x86/common_x86_features.h @@ -1,4 +1,3 @@ -/* $Id: common_x86_features.h,v 1.6 2003/01/21 16:14:00 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/common_x86_macros.h b/src/mesa/x86/common_x86_macros.h index ba155caae1..462f32b3f2 100644 --- a/src/mesa/x86/common_x86_macros.h +++ b/src/mesa/x86/common_x86_macros.h @@ -1,4 +1,3 @@ -/* $Id: common_x86_macros.h,v 1.3 2002/10/29 20:28:58 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/norm_args.h b/src/mesa/x86/norm_args.h index 1b43d57a20..5d352838be 100644 --- a/src/mesa/x86/norm_args.h +++ b/src/mesa/x86/norm_args.h @@ -1,4 +1,3 @@ -/* $Id: norm_args.h,v 1.4 2003/11/26 08:32:36 dborca Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse.h b/src/mesa/x86/sse.h index 98146a9047..521f91e411 100644 --- a/src/mesa/x86/sse.h +++ b/src/mesa/x86/sse.h @@ -1,4 +1,3 @@ -/* $Id: sse.h,v 1.2 2002/04/09 14:58:03 keithw Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse_normal.S b/src/mesa/x86/sse_normal.S index 066d46e5ef..1c32e3b2fe 100644 --- a/src/mesa/x86/sse_normal.S +++ b/src/mesa/x86/sse_normal.S @@ -1,4 +1,3 @@ -/* $Id: sse_normal.S,v 1.6 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse_xform1.S b/src/mesa/x86/sse_xform1.S index 4051f606a7..22fd8dd27b 100644 --- a/src/mesa/x86/sse_xform1.S +++ b/src/mesa/x86/sse_xform1.S @@ -1,4 +1,3 @@ -/* $Id: sse_xform1.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse_xform2.S b/src/mesa/x86/sse_xform2.S index 06fe086bd4..52eeb27ef5 100644 --- a/src/mesa/x86/sse_xform2.S +++ b/src/mesa/x86/sse_xform2.S @@ -1,4 +1,3 @@ -/* $Id: sse_xform2.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse_xform3.S b/src/mesa/x86/sse_xform3.S index eafbe34288..5e0cd8b666 100644 --- a/src/mesa/x86/sse_xform3.S +++ b/src/mesa/x86/sse_xform3.S @@ -1,4 +1,3 @@ -/* $Id: sse_xform3.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/sse_xform4.S b/src/mesa/x86/sse_xform4.S index 24c323194f..13680528db 100644 --- a/src/mesa/x86/sse_xform4.S +++ b/src/mesa/x86/sse_xform4.S @@ -1,4 +1,3 @@ -/* $Id: sse_xform4.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86.c b/src/mesa/x86/x86.c index 6b74e9e375..82caa42dbd 100644 --- a/src/mesa/x86/x86.c +++ b/src/mesa/x86/x86.c @@ -1,4 +1,3 @@ -/* $Id: x86.c,v 1.26 2005/10/07 17:18:52 brianp Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86.h b/src/mesa/x86/x86.h index a646aff46b..97651ec6ee 100644 --- a/src/mesa/x86/x86.h +++ b/src/mesa/x86/x86.h @@ -1,4 +1,3 @@ -/* $Id: x86.h,v 1.5 2002/04/09 14:58:03 keithw Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86_cliptest.S b/src/mesa/x86/x86_cliptest.S index 5a45ee6ae6..c7a3a9b57e 100644 --- a/src/mesa/x86/x86_cliptest.S +++ b/src/mesa/x86/x86_cliptest.S @@ -1,4 +1,3 @@ -/* $Id: x86_cliptest.S,v 1.12 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86_xform2.S b/src/mesa/x86/x86_xform2.S index 94f6989d42..e41661d546 100644 --- a/src/mesa/x86/x86_xform2.S +++ b/src/mesa/x86/x86_xform2.S @@ -1,4 +1,3 @@ -/* $Id: x86_xform2.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86_xform3.S b/src/mesa/x86/x86_xform3.S index 747e2f4d28..067ddd7d7c 100644 --- a/src/mesa/x86/x86_xform3.S +++ b/src/mesa/x86/x86_xform3.S @@ -1,4 +1,3 @@ -/* $Id: x86_xform3.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/x86_xform4.S b/src/mesa/x86/x86_xform4.S index def3c1ceb9..77621ac4bd 100644 --- a/src/mesa/x86/x86_xform4.S +++ b/src/mesa/x86/x86_xform4.S @@ -1,4 +1,3 @@ -/* $Id: x86_xform4.S,v 1.4 2006/04/17 18:58:24 krh Exp $ */ /* * Mesa 3-D graphics library diff --git a/src/mesa/x86/xform_args.h b/src/mesa/x86/xform_args.h index 89a04205c1..b773f5198d 100644 --- a/src/mesa/x86/xform_args.h +++ b/src/mesa/x86/xform_args.h @@ -1,4 +1,3 @@ -/* $Id: xform_args.h,v 1.5 2002/10/29 20:28:58 brianp Exp $ */ /* * Mesa 3-D graphics library -- cgit v1.2.3 From 2d28c2e3566c80c5ad0b0fd543cb4cd4cf9f36bd Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 12 Sep 2008 07:57:28 -0600 Subject: cell: update branch info in docs --- docs/cell.html | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index f9915d67e5..e1160b2428 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -29,12 +29,12 @@ Second, to implement a full-featured OpenGL driver with support for GLSL, etc.

Source Code

-The Cell driver source code is on the gallium-0.1 branch of the -git repository. +The latest Cell driver source code is on the gallium-0.2 branch +of the Mesa git repository. After you've cloned the repository, check out the branch with: 

-   git-checkout -b gallium-0.1 origin/gallium-0.1
+   git-checkout -b gallium-0.2 origin/gallium-0.2

To build the driver you'll need the IBM Cell SDK (version 2.1 or 3.0). @@ -60,7 +60,7 @@ directory that contains libGL.so. Verify that the Cell driver is being used by running glxinfo and looking for: 

-  OpenGL renderer string: Gallium 0.1, Cell on Xlib
+  OpenGL renderer string: Gallium 0.2, Cell on Xlib
-- cgit v1.2.3 From 0c0e5b71c0fb18f7ead2884a8c1429d00c090e18 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 12 Sep 2008 08:26:47 -0600 Subject: cell: updated docs/status --- docs/cell.html | 20 ++++++++++++++------ 1 file changed, 14 insertions(+), 6 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index e1160b2428..d61b57da80 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -77,21 +77,29 @@ SPU local store as needed. Similarly, textures are tiled and brought into local store as needed.

-

-More recently, vertex transformation has been parallelized across the SPUs -as well. -

-

Status

-As of February 2008 the driver supports smooth/flat shaded triangle rendering +As of September 2008, the driver supports smooth/flat shaded triangle rendering with Z testing and simple texture mapping. Simple demos like gears run successfully. To test texture mapping, try progs/demos/texcyl (press right mouse button for rendering options).

+

+Runtime/dynamic code generation is being done for per-fragment +operations (Z test, blend, etc) and for fragment programs (though only a +few opcodes are implemented now). +

+

+In general, however, the driver is rather slow because all vertex +transformation is being done by an interpreter running on the PPU. +Programs with many vertices or complex vertex shaders will run especially +slow. +This will be addressed in the future. +

+

Contributing

-- cgit v1.2.3 From 9b9eba5a42103aa79702d06e8ffd541d15845932 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 12 Sep 2008 12:04:49 -0600 Subject: cell: more documentation updates --- docs/cell.html | 28 +++++++++++++++++++++++++--- 1 file changed, 25 insertions(+), 3 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index d61b57da80..34d9a92723 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -6,7 +6,7 @@ -

Mesa Cell Driver

+

Mesa/Gallium Cell Driver

The Mesa @@ -23,6 +23,7 @@ Two phases are planned. First, to implement the framework for parallel rasterization using the Cell SPEs, including texture mapping. Second, to implement a full-featured OpenGL driver with support for GLSL, etc. +The second phase is now underway.

@@ -43,12 +44,13 @@ or the Cell Simulator (untested, though).

-If using Cell SDK 3.0, first edit configs/linux-cell and add --DSPU_MAIN_PARAM_LONG_LONG to the SPU_CFLAGS. +If using Cell SDK 2.1, see the configs/linux-cell file for some +special changes.

To compile the code, run make linux-cell. +To build in debug mode, run make linux-cell-debug.

@@ -102,6 +104,26 @@ This will be addressed in the future. +

Debug Options

+ +

+The CELL_DEBUG env var can be set to a comma-separated list of one or +more of the following debug options: +

+
    +
  • checker - use a different background clear color for each SPU. + This lets you see which SPU is rendering which screen tiles. +
  • sync - wait/synchronize after each DMA transfer +
+ +

+If the GALLIUM_NOCELL env var is set, the softpipe driver will be used +intead of the Cell driver. +This is useful for comparison/validation. +

+ + +

Contributing

-- cgit v1.2.3 From 5ecb4f969403c80e9a5e1e94070ec52f99823909 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 15 Oct 2008 15:46:53 -0600 Subject: cell: updated status in docs/cell.html --- docs/cell.html | 24 ++++++++++++++---------- 1 file changed, 14 insertions(+), 10 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index 34d9a92723..4a9ab14395 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -83,17 +83,17 @@ Similarly, textures are tiled and brought into local store as needed.

Status

-As of September 2008, the driver supports smooth/flat shaded triangle rendering -with Z testing and simple texture mapping. -Simple demos like gears run successfully. -To test texture mapping, try progs/demos/texcyl (press right mouse button for -rendering options). -

-

-Runtime/dynamic code generation is being done for per-fragment -operations (Z test, blend, etc) and for fragment programs (though only a -few opcodes are implemented now). +As of October 2008, the driver runs quite a few OpenGL demos. +Features that work include:

+
    +
  • Point/line/triangle rendering, glDrawPixels +
  • 2D texture maps with nearest/linear/mipmap filtering +
  • NPOT textures +
  • Cube maps, to some extent +
  • Dynamic SPU code generation for fragment shaders, but not complete +
  • Dynamic SPU code generation for fragment ops (blend, Z-test, etc), but not complete +

In general, however, the driver is rather slow because all vertex transformation is being done by an interpreter running on the PPU. @@ -114,6 +114,10 @@ more of the following debug options:

  • checker - use a different background clear color for each SPU. This lets you see which SPU is rendering which screen tiles.
  • sync - wait/synchronize after each DMA transfer +
  • asm - print generated SPU assembly code to stdout +
  • fragops - emit fragment ops debug messages +
  • fragopfallback - don't use codegen for fragment ops +
  • cmd - print SPU commands as their received

    -- cgit v1.2.3 From 02c9009bb842cd8a47bc36ea274ef54ff47e1528 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 23 Oct 2008 10:47:17 -0600 Subject: mesa: updated status in cell.html --- docs/cell.html | 24 ++++++++++++++++-------- 1 file changed, 16 insertions(+), 8 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index 4a9ab14395..7fbbba7c7e 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -88,18 +88,18 @@ Features that work include:

    • Point/line/triangle rendering, glDrawPixels -
    • 2D texture maps with nearest/linear/mipmap filtering -
    • NPOT textures -
    • Cube maps, to some extent +
    • 2D, NPOT and cube texture maps with nearest/linear/mipmap filtering
    • Dynamic SPU code generation for fragment shaders, but not complete
    • Dynamic SPU code generation for fragment ops (blend, Z-test, etc), but not complete +
    • Dynamic PPU/PPC code generation for vertex shaders, but not complete

    -In general, however, the driver is rather slow because all vertex -transformation is being done by an interpreter running on the PPU. -Programs with many vertices or complex vertex shaders will run especially -slow. -This will be addressed in the future. +Performance has recently improved with the addition of PPC code generation +for vertex shaders, but the code quality isn't too great yet. +

    +

    +Another bottleneck is SwapBuffers. It may be the limiting factor for +many simple GL tests.

    @@ -118,8 +118,16 @@ more of the following debug options:
  • fragops - emit fragment ops debug messages
  • fragopfallback - don't use codegen for fragment ops
  • cmd - print SPU commands as their received +
  • cache - print texture cache statistics when program exits +

    +Note that some of these options may only work for linux-cell-debug builds. +

    +

    +If the GALLIUM_NOPPC env var is set, PPC code generation will not be used +and vertex shaders will be run with the TGSI interpreter. +

    If the GALLIUM_NOCELL env var is set, the softpipe driver will be used intead of the Cell driver. -- cgit v1.2.3 From b268c2899bb0a828fae5afaf1675002938f26404 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 24 Nov 2008 08:14:28 -0700 Subject: docs: update webmaster email addr --- docs/webmaster.html | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/webmaster.html b/docs/webmaster.html index e645b90ba1..16f4dc8030 100644 --- a/docs/webmaster.html +++ b/docs/webmaster.html @@ -11,7 +11,7 @@

    If you have problems, edits or additions for this website send them to Brian -(brian_e_paul@yahoo.com). +(brian.e.paul gmail.com).

    @@ -21,4 +21,4 @@ Brian's modified it a lot since then. - \ No newline at end of file + -- cgit v1.2.3 From 178f1ff486bcff2b318dc346235a9758875faa13 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 8 Jan 2009 16:12:23 -0700 Subject: docs: import 7.2 relnotes, start on 7.3 relnotes --- docs/relnotes-7.2.html | 104 +++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes-7.3.html | 74 +++++++++++++++++++++++++++++++++++ docs/relnotes.html | 2 + 3 files changed, 180 insertions(+) create mode 100644 docs/relnotes-7.2.html create mode 100644 docs/relnotes-7.3.html (limited to 'docs') diff --git a/docs/relnotes-7.2.html b/docs/relnotes-7.2.html new file mode 100644 index 0000000000..0ad3b5b607 --- /dev/null +++ b/docs/relnotes-7.2.html @@ -0,0 +1,104 @@ + + +Mesa Release Notes + + + + + + + +

    Mesa 7.2 Release Notes / 20 September 2008

    + +

    +Mesa 7.2 is a stable release fixing bugs found in 7.1, which was a +new development release. +

    +

    +Mesa 7.2 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

    +

    +Note that this version of Mesa does not use the GEM memory manager. +The master branch of git uses GEM. +The prototype DRI2 code that was in 7.1 has also been removed. +

    +

    +DRM version 2.3.1 should be used with Mesa 7.2 +

    + + +

    MD5 checksums

    +
    +81a2a4b7cbfce7553f7ad8d924edbe2f  MesaLib-7.2.tar.gz
+04d379292e023df0b0266825cb0dbde5  MesaLib-7.2.tar.bz2
+8bc497a37977a55e987a4d1fabc3d882  MesaLib-7.2.zip
+10c762e39486df395838af1d7b57e69c  MesaDemos-7.2.tar.gz
+22e03dc4038cd63f32c21eb60994892b  MesaDemos-7.2.tar.bz2
+1197bc4eb3bf44e291c14d4eb2e19381  MesaDemos-7.2.zip
+42e3c6c6d156cd9dc545dbef72407354  MesaGLUT-7.2.tar.gz
+f67daf93e12c4a459703bbf3e4004e31  MesaGLUT-7.2.tar.bz2
+0390567eb2c2d12fbf82e8523fd77e2b  MesaGLUT-7.2.zip
+
    + + +

    New features

    +
      +
    • i965 driver: added support for G41 chipset (Intel) +
    + + +

    Bug fixes

    +
      +
    • Fixed display list bug involving primitives split across lists (bug 17564) +
    • Fixed some issues with glBindAttribLocation() +
    • Fixed crash in _tnl_InvalidateState() found with Amira (bug 15834) +
    • Assorted bug fixes for Ming build +
    • Fixed some vertex/pixel buffer object reference counting bugs +
    • Fixed depth/stencil bug in i915/945 driver +
    • Fixed some shader flow control bugs in i965 driver +
    • Fixed a few tdfx driver bugs which prevented driver from working +
    • Fixed multisample enable/disable bug +
    + +

    Changes

    +
      +
    • Updated SGI header files with new license terms. +
    + + + +

    To Do (someday) items

    +
      +
    • Remove the MEMCPY() and _mesa_memcpy() wrappers and just use memcpy(). +Probably do the same for malloc, calloc, etc. +The wrappers were useful in the past for memory debugging but now we +have valgrind. Not worried about SunOS 4 support anymore either... +
    • Switch to freeglut +
    • Fix linux-glide target/driver. +
    • Improved lambda and derivative calculation for frag progs. +
    + + +

    Driver Status

    + +
    +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
    + + + diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html new file mode 100644 index 0000000000..2be762d91d --- /dev/null +++ b/docs/relnotes-7.3.html @@ -0,0 +1,74 @@ + + +Mesa Release Notes + + + + + + + +

    Mesa 7.3 Release Notes / TBD January 2009

    + +

    +Mesa 7.3 is a new development release. +Users especially concerned with stability should stick with latest +stable release: version 7.2. +

    +

    +Mesa 7.3 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

    +

    +

    +DRM version 2.4.2 or later should be used with Mesa 7.3 +

    + + +

    MD5 checksums

    +
    +tbd
+
    + + +

    New features

    +
      +
    • Support for GLSL 1.20 +
    • Intel DRI drivers now use GEM and DRI2 +
    + + +

    Bug fixes

    +
      +
    • Assorted GLSL bug fixes +
    • Assorted i965 driver fixes +
    + +

    Changes

    +
      +
    + + + +

    Driver Status

    + +
    +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
    + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index e305977163..020e48551e 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -20,6 +20,8 @@ The release notes summarize what's new or changed in each Mesa release.

      +
    • 7.3 release notes +
    • 7.2 release notes
    • 7.1 release notes
    • 7.0.4 release notes
    • 7.0.3 release notes -- cgit v1.2.3 From da37940973110b8e64cd10d2f5f1d0ea8c81163f Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 8 Jan 2009 16:14:19 -0700 Subject: docs: more 7.3 doc updates --- docs/download.html | 4 ++-- docs/news.html | 14 ++++++++++++++ 2 files changed, 16 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/download.html b/docs/download.html index 2d587f35f9..37b0b3da47 100644 --- a/docs/download.html +++ b/docs/download.html @@ -9,9 +9,9 @@

      Downloading

      -Current development release: 7.1 +Current development release: 7.3
      -Last stable release: 7.0.4 +Last stable release: 7.2

      diff --git a/docs/news.html b/docs/news.html index 6d0d83659b..784aea364a 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,20 @@

      News

      +

      January TBD, 2009

      +

      +Mesa 7.3 is released. +This is a new development release. +

      + + +

      September 20, 2008

      +

      +Mesa 7.2 is released. +This is a stable, bug-fix release. +

      + +

      August 26, 2008

      Mesa 7.1 is released. -- cgit v1.2.3 From bd03d9bdbbe39a4fcfb49c02bbd5304c054743f5 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 8 Jan 2009 17:19:51 -0700 Subject: docs: dri2proto, libdrm tweaks --- docs/install.html | 2 +- docs/relnotes-7.3.html | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/install.html b/docs/install.html index 2d72506f67..d740477c13 100644 --- a/docs/install.html +++ b/docs/install.html @@ -38,7 +38,7 @@ The following are required for DRI-based hardware acceleration with Mesa 7.3:

        -
      • driproto2 version 1.99.3 or later +
      • dri2proto version 1.99.3 or later
      • DRM version 2.4.3 or later
      • Xorg server version 1.4 or 1.5. diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html index 2be762d91d..5cb7dc20fd 100644 --- a/docs/relnotes-7.3.html +++ b/docs/relnotes-7.3.html @@ -22,7 +22,7 @@ Some drivers don't support all the features required in OpenGL 2.1.

        -DRM version 2.4.2 or later should be used with Mesa 7.3 +DRM version 2.4.3 or later should be used with Mesa 7.3

        -- cgit v1.2.3 From e5aa89386d12300aebaac6f4530bbb51bb87981d Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:14:39 -0700 Subject: docs: 7.3 md5 sums --- docs/relnotes-7.3.html | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html index c083fcb6d9..47ecaebec9 100644 --- a/docs/relnotes-7.3.html +++ b/docs/relnotes-7.3.html @@ -28,7 +28,15 @@ for DRI ardware acceleration.

        MD5 checksums

        -tbd
+8ed03191432b22d118d88d6db497f304  MesaLib-7.3.tar.gz
+781e7811a6ed5c97b2b8defefc8ffbc9  MesaLib-7.3.tar.bz2
+3ccba9a1734ed6d4b3389e1535d90fbf  MesaLib-7.3.zip
+d312e974b31043b13b61bac5fbf00b87  MesaDemos-7.3.tar.gz
+3f0741394069bdf2329565a387396cda  MesaDemos-7.3.tar.bz2
+4d0887fd4c66a824295cdd619f6d34cb  MesaDemos-7.3.zip
+2d7661b66022bcb8878728f3d5bd33ab  MesaGLUT-7.3.tar.gz
+abe8036a724c1a483bdad6b5a55ddc1a  MesaGLUT-7.3.tar.bz2
+5f247819b47e2a7c62d07a6afe5262fb  MesaGLUT-7.3.zip
        -- cgit v1.2.3 From 609cc9c1395a9417e56224c8754d799f8b7a5573 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:18:04 -0700 Subject: docs: skeleton 7.4 release notes file --- docs/relnotes-7.4.html | 68 ++++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 69 insertions(+) create mode 100644 docs/relnotes-7.4.html (limited to 'docs') diff --git a/docs/relnotes-7.4.html b/docs/relnotes-7.4.html new file mode 100644 index 0000000000..9a3ac01023 --- /dev/null +++ b/docs/relnotes-7.4.html @@ -0,0 +1,68 @@ + + +Mesa Release Notes + + + + + + + +

        Mesa 7.4 Release Notes / date TBD

        + +

        +Mesa 7.4 is a stable development release fixing bugs since the 7.3 release. +

        +

        +Mesa 7.4 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

        +

        +See the Compiling/Installing page for prerequisites +for DRI ardware acceleration. +

        + + +

        MD5 checksums

        +
        +tbd
+
        + + +

        New features

        +
          +
        + + +

        Bug fixes

        +
          +
        + +

        Changes

        +
          +
        + + + +

        Driver Status

        + +
        +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
        + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 020e48551e..61c6a20c29 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -20,6 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

          +
        • 7.4 release notes
        • 7.3 release notes
        • 7.2 release notes
        • 7.1 release notes -- cgit v1.2.3 From d2ab930046ae91987ee4e528e13ad06f8889f200 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:29:24 -0700 Subject: docs: placeholder 7.5 release notes --- docs/relnotes-7.5.html | 47 +++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 5 +++-- 2 files changed, 50 insertions(+), 2 deletions(-) create mode 100644 docs/relnotes-7.5.html (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html new file mode 100644 index 0000000000..0d54dff762 --- /dev/null +++ b/docs/relnotes-7.5.html @@ -0,0 +1,47 @@ + + +Mesa Release Notes + + + + + + + +

          Mesa 7.5 Release Notes / date TBD

          + +

          +Mesa 7.5 is a new development release. +

          +

          +Mesa 7.5 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

          +

          +See the Compiling/Installing page for prerequisites +for DRI ardware acceleration. +

          + + +

          MD5 checksums

          +
          +tbd
+
          + + +

          New features

          +
            +
          + + +

          Bug fixes

          +
            +
          + +

          Changes

          +
            +
          + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 61c6a20c29..c5ed109390 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -10,8 +10,8 @@

          Mesa uses an even/odd version number scheme like the Linux kernel. -Odd numbered versions (such as 6.5) designate new developmental releases. -Even numbered versions (such as 6.4) designate stable releases. +Odd numbered versions (such as 7.5) designate new developmental releases. +Even numbered versions (such as 7.4) designate stable releases.

          @@ -20,6 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

            +
          • 7.5 release notes
          • 7.4 release notes
          • 7.3 release notes
          • 7.2 release notes -- cgit v1.2.3 From fb88b6df82900c5c8f3f8044be06c757e376b916 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 15:51:12 -0700 Subject: docs: first 7.5 feature: GL_ARB_framebuffer_object --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 0d54dff762..235be4ba02 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -32,6 +32,7 @@ tbd

            New features

              +
            • GL_ARB_framebuffer_object extension (software drivers, i965 driver)
            -- cgit v1.2.3 From 6f8896c5999721e7ba95645af562c47be29cf138 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 23 Jan 2009 11:36:57 -0700 Subject: docs: document improved stencil support and GL_EXT_vertex_array_bgra --- docs/relnotes-7.5.html | 4 ++++ 1 file changed, 4 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 235be4ba02..782d55829c 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -33,6 +33,10 @@ tbd

            New features

            • GL_ARB_framebuffer_object extension (software drivers, i965 driver) +
            • Reworked two-sided stencil support. +This allows a driver to support all three variations of two-sided stencil +including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0 +
            • GL_EXT_vertex_array_bgra extension (software drivers, i965 driver)
            -- cgit v1.2.3 From ea8d0aa94b9561b3df9b51222c549395b56a3103 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 23 Jan 2009 17:40:24 -0700 Subject: docs: added GL_NV_texture_env_combine4 --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 782d55829c..5e9d91de4f 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -37,6 +37,7 @@ tbd This allows a driver to support all three variations of two-sided stencil including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
          • GL_EXT_vertex_array_bgra extension (software drivers, i965 driver) +
          • GL_NV_texture_env_combine4 extension (software drivers, i965 driver)
          -- cgit v1.2.3 From f584752afefb06a17b10fc879f04c3b45bbc764b Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 28 Jan 2009 15:06:54 -0700 Subject: docs: document GL_EXT_texture_swizzle --- docs/relnotes-7.5.html | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 5e9d91de4f..ef8759ba6a 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -37,7 +37,8 @@ tbd This allows a driver to support all three variations of two-sided stencil including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
        • GL_EXT_vertex_array_bgra extension (software drivers, i965 driver) -
        • GL_NV_texture_env_combine4 extension (software drivers, i965 driver) +
        • GL_NV_texture_env_combine4 extension (software drivers, i965/i915 drivers) +
        • GL_EXT_texture_swizzle extension (software drivers, i965 driver)
        -- cgit v1.2.3 From 26da28c995557c8b913e5ccfe31b31dc32e6c735 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 28 Jan 2009 16:49:28 -0700 Subject: mesa: remove GL_SGIX_shadow, GL_SGIX_shadow_ambient and GL_SGIX_depth_texture Everyone should be using the newer/better ARB versions of these extensions. --- docs/relnotes-7.5.html | 2 + src/mesa/main/attrib.c | 12 ++--- src/mesa/main/extensions.c | 7 +-- src/mesa/main/mtypes.h | 7 +-- src/mesa/main/texobj.c | 8 +--- src/mesa/main/texparam.c | 82 +++++---------------------------- src/mesa/main/texstate.c | 10 ---- src/mesa/shader/prog_statevars.c | 10 ++-- src/mesa/swrast/s_texfilter.c | 99 +--------------------------------------- 9 files changed, 29 insertions(+), 208 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index ef8759ba6a..621bd4afac 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -48,6 +48,8 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0

        Changes

          +
        • Remove support for GL_SGIX_shadow, GL_SGIX_shadow_ambient and +GL_SGIX_depth_texture extensions. Superseded by the ARB versions.
        diff --git a/src/mesa/main/attrib.c b/src/mesa/main/attrib.c index 825c841ee2..3be7fd5a2d 100644 --- a/src/mesa/main/attrib.c +++ b/src/mesa/main/attrib.c @@ -820,15 +820,9 @@ pop_texture_group(GLcontext *ctx, struct texture_state *texstate) _mesa_TexParameterf(target, GL_TEXTURE_MAX_ANISOTROPY_EXT, obj->MaxAnisotropy); } - if (ctx->Extensions.SGIX_shadow) { - _mesa_TexParameteri(target, GL_TEXTURE_COMPARE_SGIX, - obj->CompareFlag); - _mesa_TexParameteri(target, GL_TEXTURE_COMPARE_OPERATOR_SGIX, - obj->CompareOperator); - } - if (ctx->Extensions.SGIX_shadow_ambient) { - _mesa_TexParameterf(target, GL_SHADOW_AMBIENT_SGIX, - obj->ShadowAmbient); + if (ctx->Extensions.ARB_shadow_ambient) { + _mesa_TexParameterf(target, GL_TEXTURE_COMPARE_FAIL_VALUE_ARB, + obj->CompareFailValue); } } diff --git a/src/mesa/main/extensions.c b/src/mesa/main/extensions.c index 86144c42ad..4ebdb5d9ae 100644 --- a/src/mesa/main/extensions.c +++ b/src/mesa/main/extensions.c @@ -62,7 +62,7 @@ static const struct { { OFF, "GL_ARB_shading_language_100", F(ARB_shading_language_100) }, { OFF, "GL_ARB_shading_language_120", F(ARB_shading_language_120) }, { OFF, "GL_ARB_shadow", F(ARB_shadow) }, - { OFF, "GL_ARB_shadow_ambient", F(SGIX_shadow_ambient) }, + { OFF, "GL_ARB_shadow_ambient", F(ARB_shadow_ambient) }, { OFF, "GL_ARB_texture_border_clamp", F(ARB_texture_border_clamp) }, { OFF, "GL_ARB_texture_compression", F(ARB_texture_compression) }, { OFF, "GL_ARB_texture_cube_map", F(ARB_texture_cube_map) }, @@ -170,8 +170,6 @@ static const struct { { ON, "GL_SGIS_texture_edge_clamp", F(SGIS_texture_edge_clamp) }, { ON, "GL_SGIS_texture_lod", F(SGIS_texture_lod) }, { OFF, "GL_SGIX_depth_texture", F(ARB_depth_texture) }, - { OFF, "GL_SGIX_shadow", F(SGIX_shadow) }, - { OFF, "GL_SGIX_shadow_ambient", F(SGIX_shadow_ambient) }, { OFF, "GL_SUN_multi_draw_arrays", F(EXT_multi_draw_arrays) }, { OFF, "GL_S3_s3tc", F(S3_s3tc) }, }; @@ -214,6 +212,7 @@ _mesa_enable_sw_extensions(GLcontext *ctx) ctx->Extensions.ARB_shading_language_120 = GL_FALSE; /* not quite done */ #endif ctx->Extensions.ARB_shadow = GL_TRUE; + ctx->Extensions.ARB_shadow_ambient = GL_TRUE; ctx->Extensions.ARB_texture_border_clamp = GL_TRUE; ctx->Extensions.ARB_texture_cube_map = GL_TRUE; ctx->Extensions.ARB_texture_env_combine = GL_TRUE; @@ -302,8 +301,6 @@ _mesa_enable_sw_extensions(GLcontext *ctx) ctx->Extensions.SGI_texture_color_table = GL_TRUE; ctx->Extensions.SGIS_generate_mipmap = GL_TRUE; ctx->Extensions.SGIS_texture_edge_clamp = GL_TRUE; - ctx->Extensions.SGIX_shadow = GL_TRUE; - ctx->Extensions.SGIX_shadow_ambient = GL_TRUE; #if FEATURE_ARB_vertex_program || FEATURE_ARB_fragment_program ctx->Extensions.EXT_gpu_program_parameters = GL_TRUE; #endif diff --git a/src/mesa/main/mtypes.h b/src/mesa/main/mtypes.h index 8ab0d26f45..da243eceac 100644 --- a/src/mesa/main/mtypes.h +++ b/src/mesa/main/mtypes.h @@ -1433,11 +1433,9 @@ struct gl_texture_object GLint BaseLevel; /**< min mipmap level, OpenGL 1.2 */ GLint MaxLevel; /**< max mipmap level, OpenGL 1.2 */ GLfloat MaxAnisotropy; /**< GL_EXT_texture_filter_anisotropic */ - GLboolean CompareFlag; /**< GL_SGIX_shadow */ - GLenum CompareOperator; /**< GL_SGIX_shadow */ - GLfloat ShadowAmbient; /**< GL_ARB_shadow_ambient */ GLenum CompareMode; /**< GL_ARB_shadow */ GLenum CompareFunc; /**< GL_ARB_shadow */ + GLfloat CompareFailValue; /**< GL_ARB_shadow_ambient */ GLenum _Function; /**< Comparison function derived from * \c CompareOperator, \c CompareMode, and * \c CompareFunc. @@ -2563,6 +2561,7 @@ struct gl_extensions GLboolean ARB_shading_language_100; GLboolean ARB_shading_language_120; GLboolean ARB_shadow; + GLboolean ARB_shadow_ambient; /* or GL_ARB_shadow_ambient */ GLboolean ARB_texture_border_clamp; GLboolean ARB_texture_compression; GLboolean ARB_texture_cube_map; @@ -2660,8 +2659,6 @@ struct gl_extensions GLboolean SGIS_generate_mipmap; GLboolean SGIS_texture_edge_clamp; GLboolean SGIS_texture_lod; - GLboolean SGIX_shadow; - GLboolean SGIX_shadow_ambient; /* or GL_ARB_shadow_ambient */ GLboolean TDFX_texture_compression_FXT1; GLboolean S3_s3tc; /*@}*/ diff --git a/src/mesa/main/texobj.c b/src/mesa/main/texobj.c index fad39a0634..4e6cf439fc 100644 --- a/src/mesa/main/texobj.c +++ b/src/mesa/main/texobj.c @@ -134,12 +134,10 @@ _mesa_initialize_texture_object( struct gl_texture_object *obj, obj->BaseLevel = 0; obj->MaxLevel = 1000; obj->MaxAnisotropy = 1.0; - obj->CompareFlag = GL_FALSE; /* SGIX_shadow */ - obj->CompareOperator = GL_TEXTURE_LEQUAL_R_SGIX; /* SGIX_shadow */ obj->CompareMode = GL_NONE; /* ARB_shadow */ obj->CompareFunc = GL_LEQUAL; /* ARB_shadow */ + obj->CompareFailValue = 0.0F; /* ARB_shadow_ambient */ obj->DepthMode = GL_LUMINANCE; /* ARB_depth_texture */ - obj->ShadowAmbient = 0.0F; /* ARB/SGIX_shadow_ambient */ obj->Swizzle[0] = GL_RED; obj->Swizzle[1] = GL_GREEN; obj->Swizzle[2] = GL_BLUE; @@ -248,11 +246,9 @@ _mesa_copy_texture_object( struct gl_texture_object *dest, dest->BaseLevel = src->BaseLevel; dest->MaxLevel = src->MaxLevel; dest->MaxAnisotropy = src->MaxAnisotropy; - dest->CompareFlag = src->CompareFlag; - dest->CompareOperator = src->CompareOperator; - dest->ShadowAmbient = src->ShadowAmbient; dest->CompareMode = src->CompareMode; dest->CompareFunc = src->CompareFunc; + dest->CompareFailValue = src->CompareFailValue; dest->DepthMode = src->DepthMode; dest->_MaxLevel = src->_MaxLevel; dest->_MaxLambda = src->_MaxLambda; diff --git a/src/mesa/main/texparam.c b/src/mesa/main/texparam.c index 41c914e5b3..f610fa8dda 100644 --- a/src/mesa/main/texparam.c +++ b/src/mesa/main/texparam.c @@ -260,30 +260,6 @@ set_tex_parameteri(GLcontext *ctx, texObj->MaxLevel = params[0]; return; - case GL_TEXTURE_COMPARE_SGIX: - if (ctx->Extensions.SGIX_shadow) { - FLUSH_VERTICES(ctx, _NEW_TEXTURE); - texObj->CompareFlag = params[0] ? GL_TRUE : GL_FALSE; - } - else { - _mesa_error(ctx, GL_INVALID_ENUM, - "glTexParameter(pname=GL_TEXTURE_COMPARE_SGIX)"); - } - return; - - case GL_TEXTURE_COMPARE_OPERATOR_SGIX: - if (ctx->Extensions.SGIX_shadow && - (params[0] == GL_TEXTURE_LEQUAL_R_SGIX || - params[0] == GL_TEXTURE_GEQUAL_R_SGIX)) { - FLUSH_VERTICES(ctx, _NEW_TEXTURE); - texObj->CompareOperator = params[0]; - } - else { - _mesa_error(ctx, GL_INVALID_ENUM, - "glTexParameter(GL_TEXTURE_COMPARE_OPERATOR_SGIX)"); - } - return; - case GL_GENERATE_MIPMAP_SGIS: if (ctx->Extensions.SGIS_generate_mipmap) { FLUSH_VERTICES(ctx, _NEW_TEXTURE); @@ -454,14 +430,14 @@ set_tex_parameterf(GLcontext *ctx, } return; - case GL_SHADOW_AMBIENT_SGIX: /* aka GL_TEXTURE_COMPARE_FAIL_VALUE_ARB */ - if (ctx->Extensions.SGIX_shadow_ambient) { + case GL_TEXTURE_COMPARE_FAIL_VALUE_ARB: + if (ctx->Extensions.ARB_shadow_ambient) { FLUSH_VERTICES(ctx, _NEW_TEXTURE); - texObj->ShadowAmbient = CLAMP(params[0], 0.0F, 1.0F); + texObj->CompareFailValue = CLAMP(params[0], 0.0F, 1.0F); } else { _mesa_error(ctx, GL_INVALID_ENUM, - "glTexParameter(pname=GL_SHADOW_AMBIENT_SGIX)"); + "glTexParameter(pname=GL_TEXTURE_COMPARE_FAIL_VALUE_ARB)"); } return; @@ -512,8 +488,6 @@ _mesa_TexParameterf(GLenum target, GLenum pname, GLfloat param) case GL_TEXTURE_WRAP_R: case GL_TEXTURE_BASE_LEVEL: case GL_TEXTURE_MAX_LEVEL: - case GL_TEXTURE_COMPARE_SGIX: - case GL_TEXTURE_COMPARE_OPERATOR_SGIX: case GL_GENERATE_MIPMAP_SGIS: case GL_TEXTURE_COMPARE_MODE_ARB: case GL_TEXTURE_COMPARE_FUNC_ARB: @@ -556,8 +530,6 @@ _mesa_TexParameterfv(GLenum target, GLenum pname, const GLfloat *params) case GL_TEXTURE_WRAP_R: case GL_TEXTURE_BASE_LEVEL: case GL_TEXTURE_MAX_LEVEL: - case GL_TEXTURE_COMPARE_SGIX: - case GL_TEXTURE_COMPARE_OPERATOR_SGIX: case GL_GENERATE_MIPMAP_SGIS: case GL_TEXTURE_COMPARE_MODE_ARB: case GL_TEXTURE_COMPARE_FUNC_ARB: @@ -613,7 +585,7 @@ _mesa_TexParameteri(GLenum target, GLenum pname, GLint param) case GL_TEXTURE_PRIORITY: case GL_TEXTURE_MAX_ANISOTROPY_EXT: case GL_TEXTURE_LOD_BIAS: - case GL_SHADOW_AMBIENT_SGIX: /* aka GL_TEXTURE_COMPARE_FAIL_VALUE_ARB */ + case GL_TEXTURE_COMPARE_FAIL_VALUE_ARB: { GLfloat fparam = (GLfloat) param; /* convert int param to float */ @@ -662,7 +634,7 @@ _mesa_TexParameteriv(GLenum target, GLenum pname, const GLint *params) case GL_TEXTURE_PRIORITY: case GL_TEXTURE_MAX_ANISOTROPY_EXT: case GL_TEXTURE_LOD_BIAS: - case GL_SHADOW_AMBIENT_SGIX: /* aka GL_TEXTURE_COMPARE_FAIL_VALUE_ARB */ + case GL_TEXTURE_COMPARE_FAIL_VALUE_ARB: { /* convert int param to float */ GLfloat fparam = (GLfloat) params[0]; @@ -1060,23 +1032,9 @@ _mesa_GetTexParameterfv( GLenum target, GLenum pname, GLfloat *params ) else error = GL_TRUE; break; - case GL_TEXTURE_COMPARE_SGIX: - if (ctx->Extensions.SGIX_shadow) { - *params = (GLfloat) obj->CompareFlag; - } - else - error = GL_TRUE; - break; - case GL_TEXTURE_COMPARE_OPERATOR_SGIX: - if (ctx->Extensions.SGIX_shadow) { - *params = (GLfloat) obj->CompareOperator; - } - else - error = GL_TRUE; - break; - case GL_SHADOW_AMBIENT_SGIX: /* aka GL_TEXTURE_COMPARE_FAIL_VALUE_ARB */ - if (ctx->Extensions.SGIX_shadow_ambient) { - *params = obj->ShadowAmbient; + case GL_TEXTURE_COMPARE_FAIL_VALUE_ARB: + if (ctx->Extensions.ARB_shadow_ambient) { + *params = obj->CompareFailValue; } else error = GL_TRUE; @@ -1248,25 +1206,9 @@ _mesa_GetTexParameteriv( GLenum target, GLenum pname, GLint *params ) error = GL_TRUE; } break; - case GL_TEXTURE_COMPARE_SGIX: - if (ctx->Extensions.SGIX_shadow) { - *params = (GLint) obj->CompareFlag; - } - else { - error = GL_TRUE; - } - break; - case GL_TEXTURE_COMPARE_OPERATOR_SGIX: - if (ctx->Extensions.SGIX_shadow) { - *params = (GLint) obj->CompareOperator; - } - else { - error = GL_TRUE; - } - break; - case GL_SHADOW_AMBIENT_SGIX: /* aka GL_TEXTURE_COMPARE_FAIL_VALUE_ARB */ - if (ctx->Extensions.SGIX_shadow_ambient) { - *params = (GLint) FLOAT_TO_INT(obj->ShadowAmbient); + case GL_TEXTURE_COMPARE_FAIL_VALUE_ARB: + if (ctx->Extensions.ARB_shadow_ambient) { + *params = (GLint) FLOAT_TO_INT(obj->CompareFailValue); } else { error = GL_TRUE; diff --git a/src/mesa/main/texstate.c b/src/mesa/main/texstate.c index 7cddec0bce..f7a4d8b323 100644 --- a/src/mesa/main/texstate.c +++ b/src/mesa/main/texstate.c @@ -404,16 +404,6 @@ update_texture_compare_function(GLcontext *ctx, */ tObj->_Function = GL_NONE; } - else if (tObj->CompareFlag) { - /* GL_SGIX_shadow */ - if (tObj->CompareOperator == GL_TEXTURE_LEQUAL_R_SGIX) { - tObj->_Function = GL_LEQUAL; - } - else { - ASSERT(tObj->CompareOperator == GL_TEXTURE_GEQUAL_R_SGIX); - tObj->_Function = GL_GEQUAL; - } - } else if (tObj->CompareMode == GL_COMPARE_R_TO_TEXTURE_ARB) { /* GL_ARB_shadow */ tObj->_Function = tObj->CompareFunc; diff --git a/src/mesa/shader/prog_statevars.c b/src/mesa/shader/prog_statevars.c index 615826b210..3ce60427bf 100644 --- a/src/mesa/shader/prog_statevars.c +++ b/src/mesa/shader/prog_statevars.c @@ -493,10 +493,10 @@ _mesa_fetch_state(GLcontext *ctx, const gl_state_index state[], const struct gl_texture_object *texObj = ctx->Texture.Unit[unit]._Current; if (texObj) { - value[0] = texObj->ShadowAmbient; - value[1] = texObj->ShadowAmbient; - value[2] = texObj->ShadowAmbient; - value[3] = texObj->ShadowAmbient; + value[0] = + value[1] = + value[2] = + value[3] = texObj->CompareFailValue; } } return; @@ -777,7 +777,7 @@ append_token(char *dst, gl_state_index k) append(dst, "PCMbias"); break; case STATE_SHADOW_AMBIENT: - append(dst, "ShadowAmbient"); + append(dst, "CompareFailValue"); break; default: /* probably STATE_INTERNAL_DRIVER+i (driver private state) */ diff --git a/src/mesa/swrast/s_texfilter.c b/src/mesa/swrast/s_texfilter.c index a095b255ab..8d72018cf4 100644 --- a/src/mesa/swrast/s_texfilter.c +++ b/src/mesa/swrast/s_texfilter.c @@ -2826,7 +2826,7 @@ sample_depth_texture( GLcontext *ctx, tObj->Target == GL_TEXTURE_1D_ARRAY_EXT || tObj->Target == GL_TEXTURE_2D_ARRAY_EXT); - UNCLAMPED_FLOAT_TO_CHAN(ambient, tObj->ShadowAmbient); + UNCLAMPED_FLOAT_TO_CHAN(ambient, tObj->CompareFailValue); /* XXXX if tObj->MinFilter != tObj->MagFilter, we're ignoring lambda */ @@ -3156,103 +3156,6 @@ sample_depth_texture( GLcontext *ctx, } -#if 0 -/* - * Experimental depth texture sampling function. - */ -static void -sample_depth_texture2(const GLcontext *ctx, - const struct gl_texture_unit *texUnit, - GLuint n, const GLfloat texcoords[][4], - GLchan texel[][4]) -{ - const struct gl_texture_object *texObj = texUnit->_Current; - const GLint baseLevel = texObj->BaseLevel; - const struct gl_texture_image *texImage = texObj->Image[0][baseLevel]; - const GLuint width = texImage->Width; - const GLuint height = texImage->Height; - GLchan ambient; - GLboolean lequal, gequal; - - if (texObj->Target != GL_TEXTURE_2D) { - _mesa_problem(ctx, "only 2-D depth textures supported at this time"); - return; - } - - if (texObj->MinFilter != texObj->MagFilter) { - _mesa_problem(ctx, "mipmapped depth textures not supported at this time"); - return; - } - - /* XXX the GL_SGIX_shadow extension spec doesn't say what to do if - * GL_TEXTURE_COMPARE_SGIX == GL_TRUE but the current texture object - * isn't a depth texture. - */ - if (texImage->TexFormat->BaseFormat != GL_DEPTH_COMPONENT) { - _mesa_problem(ctx,"GL_TEXTURE_COMPARE_SGIX enabled with non-depth texture"); - return; - } - - UNCLAMPED_FLOAT_TO_CHAN(ambient, tObj->ShadowAmbient); - - if (texObj->CompareOperator == GL_TEXTURE_LEQUAL_R_SGIX) { - lequal = GL_TRUE; - gequal = GL_FALSE; - } - else { - lequal = GL_FALSE; - gequal = GL_TRUE; - } - - { - GLuint i; - for (i = 0; i < n; i++) { - const GLint K = 3; - GLint col, row, ii, jj, imin, imax, jmin, jmax, samples, count; - GLfloat w; - GLchan lum; - col = nearest_texel_location(texObj->WrapS, img, width, - texcoords[i][0]); - row = nearest_texel_location(texObj->WrapT, img, height, - texcoords[i][1]); - - imin = col - K; - imax = col + K; - jmin = row - K; - jmax = row + K; - - if (imin < 0) imin = 0; - if (imax >= width) imax = width - 1; - if (jmin < 0) jmin = 0; - if (jmax >= height) jmax = height - 1; - - samples = (imax - imin + 1) * (jmax - jmin + 1); - count = 0; - for (jj = jmin; jj <= jmax; jj++) { - for (ii = imin; ii <= imax; ii++) { - GLfloat depthSample; - texImage->FetchTexelf(texImage, ii, jj, 0, &depthSample); - if ((depthSample <= r[i] && lequal) || - (depthSample >= r[i] && gequal)) { - count++; - } - } - } - - w = (GLfloat) count / (GLfloat) samples; - w = CHAN_MAXF - w * (CHAN_MAXF - (GLfloat) ambient); - lum = (GLint) w; - - texel[i][RCOMP] = lum; - texel[i][GCOMP] = lum; - texel[i][BCOMP] = lum; - texel[i][ACOMP] = CHAN_MAX; - } - } -} -#endif - - /** * We use this function when a texture object is in an "incomplete" state. * When a fragment program attempts to sample an incomplete texture we -- cgit v1.2.3 From bbcbf4f6804a098e06420736c281f353760b335c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 09:58:52 -0700 Subject: docs: assorted updates, link fixes --- docs/contents.html | 2 +- docs/envvars.html | 2 +- docs/helpwanted.html | 31 +++++++++++++++++++++++++++---- docs/systems.html | 25 ++++++++++++++++++++----- 4 files changed, 49 insertions(+), 11 deletions(-) (limited to 'docs') diff --git a/docs/contents.html b/docs/contents.html index b348d3d17f..1dca3a228d 100644 --- a/docs/contents.html +++ b/docs/contents.html @@ -48,7 +48,7 @@ a:visited {
      • Mailing Lists
      • Bug Database
      • Webmaster -
      • Wiki +
      • Mesa/DRI Wiki
      User Topics diff --git a/docs/envvars.html b/docs/envvars.html index 7b64dc9fef..7fd9fe7c0a 100644 --- a/docs/envvars.html +++ b/docs/envvars.html @@ -29,7 +29,7 @@ Setting this variable automatically sets the MESA_TEX_PROG variable as well.

      The following are only applicable to the Xlib software driver. -See README.X11 for details. +See the Xlib software driver page for details.

      • MESA_RGB_VISUAL - specifies the X visual and depth for RGB mode diff --git a/docs/helpwanted.html b/docs/helpwanted.html index 4cd92b97a9..34afe49f75 100644 --- a/docs/helpwanted.html +++ b/docs/helpwanted.html @@ -15,17 +15,40 @@ Here are some specific ideas and areas where help would be appreciated:
        1. -Enable -Wstrict-aliasing=2 -fstrict-aliasing and track down aliasing +Driver patching and testing. +Patches are often posted to the mesa3d-dev mailing list, but aren't +immediately checked into git because not enough people are testing them. +Just applying patches, testing and reporting back is helpful. +
        2. +Driver debugging. +There are plenty of open bugs in the bug database. +
        3. +Remove aliasing warnings. +Enable gcc -Wstrict-aliasing=2 -fstrict-aliasing and track down aliasing issues in the code.
        4. -Windows 98/NT driver building, maintenance and testing +Windows driver building, testing and maintenance. +The Visual Studio project files aren't always updated in a timely manner +when new source files are added or old ones are removed. +Fixing these tends to delay new Mesa releases. +
        5. +Maintenance and testing of lesser-used drivers. +Drivers such as DOS/DJGPP, GGI, etc that aren't being maintained are being +deprecated starting in Mesa 7.3. +
        6. +Contribute more tests to +glean.
        7. -Maintenance and testing of lesser-used drivers, such as DOS/DJGPP, GGI, etc. +Automatic testing. + +It would be great if someone would set up an automated system for grabbing +the latest Mesa code and run tests (such as glean) then report issues to +the mailing list.

        -If you want to help with Mesa, first join the Mesa developer's +If you want to do something new in Mesa, first join the Mesa developer's mailing list. Then post a message to propose what you want to do, just to make sure there's no issues. diff --git a/docs/systems.html b/docs/systems.html index 340f528af1..5137b074e2 100644 --- a/docs/systems.html +++ b/docs/systems.html @@ -27,16 +27,27 @@ the Amiga, Apple Macintosh, BeOS, NeXT, OS/2, MS-DOS, VMS, Windows

        -Details about particular drivers follows. -Be warned that some drivers may be out of date and no longer function. +Details about particular drivers follows:

        + + +

        Deprecated Systems

        + +

        +These drivers have not been maintained and are being deprecated. +They can be saved if someone steps up to help. +

        + + + +And for historical reference: + -- cgit v1.2.3 From 4e8d99998ff6679a321773da85df4aee31cb8d4c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 09:59:04 -0700 Subject: docs: set 7.3 release date --- docs/news.html | 3 ++- docs/relnotes-7.3.html | 2 +- 2 files changed, 3 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index 784aea364a..b177f3bca2 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,10 +11,11 @@

        News

        -

        January TBD, 2009

        +

        January 22, 2009

        Mesa 7.3 is released. This is a new development release. +Mesa 7.4 will follow and will have bug fixes relative to 7.3.

        diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html index 78ae00d0d5..c083fcb6d9 100644 --- a/docs/relnotes-7.3.html +++ b/docs/relnotes-7.3.html @@ -8,7 +8,7 @@ -

        Mesa 7.3 Release Notes / TBD January 2009

        +

        Mesa 7.3 Release Notes / 22 January 2009

        Mesa 7.3 is a new development release. -- cgit v1.2.3 From 978a6c1cfa99b32234291773b91ebcc9a85c8baf Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:14:39 -0700 Subject: docs: 7.3 md5 sums --- docs/relnotes-7.3.html | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html index c083fcb6d9..47ecaebec9 100644 --- a/docs/relnotes-7.3.html +++ b/docs/relnotes-7.3.html @@ -28,7 +28,15 @@ for DRI ardware acceleration.

        MD5 checksums

        -tbd
+8ed03191432b22d118d88d6db497f304  MesaLib-7.3.tar.gz
+781e7811a6ed5c97b2b8defefc8ffbc9  MesaLib-7.3.tar.bz2
+3ccba9a1734ed6d4b3389e1535d90fbf  MesaLib-7.3.zip
+d312e974b31043b13b61bac5fbf00b87  MesaDemos-7.3.tar.gz
+3f0741394069bdf2329565a387396cda  MesaDemos-7.3.tar.bz2
+4d0887fd4c66a824295cdd619f6d34cb  MesaDemos-7.3.zip
+2d7661b66022bcb8878728f3d5bd33ab  MesaGLUT-7.3.tar.gz
+abe8036a724c1a483bdad6b5a55ddc1a  MesaGLUT-7.3.tar.bz2
+5f247819b47e2a7c62d07a6afe5262fb  MesaGLUT-7.3.zip
        -- cgit v1.2.3 From b987fde60aa963eb2d2b4161c32b5e949a6698c9 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:18:04 -0700 Subject: docs: skeleton 7.4 release notes file --- docs/relnotes-7.4.html | 68 ++++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 69 insertions(+) create mode 100644 docs/relnotes-7.4.html (limited to 'docs') diff --git a/docs/relnotes-7.4.html b/docs/relnotes-7.4.html new file mode 100644 index 0000000000..9a3ac01023 --- /dev/null +++ b/docs/relnotes-7.4.html @@ -0,0 +1,68 @@ + + +Mesa Release Notes + + + + + + + +

        Mesa 7.4 Release Notes / date TBD

        + +

        +Mesa 7.4 is a stable development release fixing bugs since the 7.3 release. +

        +

        +Mesa 7.4 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

        +

        +See the Compiling/Installing page for prerequisites +for DRI ardware acceleration. +

        + + +

        MD5 checksums

        +
        +tbd
+
        + + +

        New features

        +
          +
        + + +

        Bug fixes

        +
          +
        + +

        Changes

        +
          +
        + + + +

        Driver Status

        + +
        +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
        + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 020e48551e..61c6a20c29 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -20,6 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

          +
        • 7.4 release notes
        • 7.3 release notes
        • 7.2 release notes
        • 7.1 release notes -- cgit v1.2.3 From e6df67bf66fee8683a8aa08583f9c1510106537b Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 22 Jan 2009 10:39:05 -0700 Subject: docs: fix typo --- docs/relnotes-7.3.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.3.html b/docs/relnotes-7.3.html index 47ecaebec9..df8988443e 100644 --- a/docs/relnotes-7.3.html +++ b/docs/relnotes-7.3.html @@ -22,7 +22,7 @@ Some drivers don't support all the features required in OpenGL 2.1.

          See the Compiling/Installing page for prerequisites -for DRI ardware acceleration. +for DRI hardware acceleration.

          -- cgit v1.2.3 From e351343fdff2b217fdcf1f7d7b352f5f852d74c4 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 28 Jan 2009 17:02:39 -0700 Subject: docs: i965 fixes --- docs/relnotes-7.4.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.4.html b/docs/relnotes-7.4.html index 9a3ac01023..60ada854c1 100644 --- a/docs/relnotes-7.4.html +++ b/docs/relnotes-7.4.html @@ -37,6 +37,7 @@ tbd

          Bug fixes

            +
          • Assorted i965 driver bug fixes

          Changes

          -- cgit v1.2.3 From 2f51be75c55f69dc3e09036d6fd12f808f5a5028 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 3 Feb 2009 10:13:22 -0700 Subject: docs: document new MESA_GLX_FORCE_DIRECT env var for the Xlib driver --- docs/xlibdriver.html | 16 ++++++++++++++++ 1 file changed, 16 insertions(+) (limited to 'docs') diff --git a/docs/xlibdriver.html b/docs/xlibdriver.html index d95f4d579c..029e2b1514 100644 --- a/docs/xlibdriver.html +++ b/docs/xlibdriver.html @@ -169,6 +169,20 @@ the Gamma FAQ

          +

          Direct Rendering Flag

          +

          +Some applications won't run with indirect rendering contexts (which is +what the Xlib driver supports). +To force the glXIsDirect() query to return True, set the MESA_GLX_FORCE_DIRECT +environment variable. +For example: +

          +
          +	$ export MESA_GLX_FORCE_DIRECT=1
+
          + + +

          Overlay Planes

          Hardware overlay planes are supported by the Xlib driver. To @@ -268,6 +282,8 @@ This extension was added in Mesa 2.6 MESA_BACK_BUFFER - specifies how to implement the back color buffer (X only) MESA_PRIVATE_CMAP - force aux/tk libraries to use private colormaps (X only) MESA_GAMMA - gamma correction coefficients (X only) + MESA_GLX_FORCE_DIRECT - report that the driver is direct rendering, even + though it's not. -- cgit v1.2.3 From 79e3441f6679c31532cd737129ec472b29d4d9c8 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 4 Feb 2009 08:43:11 -0700 Subject: Revert "docs: document new MESA_GLX_FORCE_DIRECT env var for the Xlib driver" This reverts commit 2f51be75c55f69dc3e09036d6fd12f808f5a5028. --- docs/xlibdriver.html | 16 ---------------- 1 file changed, 16 deletions(-) (limited to 'docs') diff --git a/docs/xlibdriver.html b/docs/xlibdriver.html index 029e2b1514..d95f4d579c 100644 --- a/docs/xlibdriver.html +++ b/docs/xlibdriver.html @@ -169,20 +169,6 @@ the Gamma FAQ

          -

          Direct Rendering Flag

          -

          -Some applications won't run with indirect rendering contexts (which is -what the Xlib driver supports). -To force the glXIsDirect() query to return True, set the MESA_GLX_FORCE_DIRECT -environment variable. -For example: -

          -
          -	$ export MESA_GLX_FORCE_DIRECT=1
-
          - - -

          Overlay Planes

          Hardware overlay planes are supported by the Xlib driver. To @@ -282,8 +268,6 @@ This extension was added in Mesa 2.6 MESA_BACK_BUFFER - specifies how to implement the back color buffer (X only) MESA_PRIVATE_CMAP - force aux/tk libraries to use private colormaps (X only) MESA_GAMMA - gamma correction coefficients (X only) - MESA_GLX_FORCE_DIRECT - report that the driver is direct rendering, even - though it's not. -- cgit v1.2.3 From 6e5d3117193fcbaa19c605c4d73241243ed46bcc Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 5 Feb 2009 08:41:27 -0700 Subject: mesa: remove oddball linux-directfb-install makefile rule It's probably not needed since the 'make install' rules were overhauled last year. --- Makefile | 4 ---- docs/README.directfb | 3 ++- 2 files changed, 2 insertions(+), 5 deletions(-) (limited to 'docs') diff --git a/Makefile b/Makefile index bf69b2a587..419265df80 100644 --- a/Makefile +++ b/Makefile @@ -44,10 +44,6 @@ install: done -# DirectFBGL module installation -linux-directfb-install: - cd src/mesa/drivers/directfb && $(MAKE) install - .PHONY: default doxygen clean realclean install linux-directfb-install # If there's no current configuration file diff --git a/docs/README.directfb b/docs/README.directfb index e3bada4888..d66ca8d3ca 100644 --- a/docs/README.directfb +++ b/docs/README.directfb @@ -22,7 +22,8 @@ Installation to install OpenGL libraries and - make linux-directfb-install + cd src/mesa/drivers/directfb ; make install to install DirectFBGL module in the proper location. + Actually, that last command may not be needed. Please provide feedback. -- cgit v1.2.3 From 9c101c44c4455e0404be482610fbe015fa012be0 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 10 Feb 2009 16:56:58 -0700 Subject: cell: update Cell driver info (code is on master now) --- docs/cell.html | 8 ++------ 1 file changed, 2 insertions(+), 6 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index 7fbbba7c7e..d7feb468ad 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -30,13 +30,9 @@ The second phase is now underway.

          Source Code

          -The latest Cell driver source code is on the gallium-0.2 branch -of the Mesa git repository. -After you've cloned the repository, check out the branch with: +The latest Cell driver source code is on the master branch of the Mesa +git repository.

          -
          -   git-checkout -b gallium-0.2 origin/gallium-0.2
-

          To build the driver you'll need the IBM Cell SDK (version 2.1 or 3.0). To use the driver you'll need a Cell system, such as a PS3 running Linux, -- cgit v1.2.3 From 36c1e756daea0be04395de063003b434ba98cbdd Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 10 Feb 2009 19:36:52 -0700 Subject: docs: some Cell driver docs updates --- docs/cell.html | 14 ++++++++------ 1 file changed, 8 insertions(+), 6 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index d7feb468ad..49b62cac7b 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -46,17 +46,19 @@ special changes.

          To compile the code, run make linux-cell. -To build in debug mode, run make linux-cell-debug. +Or to build in debug mode, run make linux-cell-debug.

          -To use the library, make sure LD_LIBRARY_PATH points the Mesa/lib/ -directory that contains libGL.so. -

          +To use the library, make sure your current directory is the top of the +Mesa tree, then set LD_LIBRARY_PATH like this: +
          +  export LD_LIBRARY_PATH=$PWD/lib/gallium:$PWD/lib/
+

          -Verify that the Cell driver is being used by running glxinfo -and looking for: +Verify that the Cell driver is being used by running +progs/xdemos/glxinfo and looking for: 

             OpenGL renderer string: Gallium 0.2, Cell on Xlib
          -- cgit v1.2.3 From 7d399bf0626a55fa2a124dcf09135464cc87baa1 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 26 Feb 2009 18:37:26 -0700 Subject: docs: add SPARC assembly updates --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 621bd4afac..f29553b0fb 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -39,6 +39,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
        • GL_EXT_vertex_array_bgra extension (software drivers, i965 driver)
        • GL_NV_texture_env_combine4 extension (software drivers, i965/i915 drivers)
        • GL_EXT_texture_swizzle extension (software drivers, i965 driver) +
        • Updated SPARC assembly optimizations (David S. Miller)
        -- cgit v1.2.3 From 69e07bdeb42f2454f5052f86119adfb68f253098 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Sat, 7 Mar 2009 11:53:18 -0700 Subject: mesa: remove GL_MESA_program_debug extension This was never fully fleshed out and hasn't been used. --- docs/MESA_shader_debug.spec | 2 +- src/mesa/SConscript | 1 - src/mesa/drivers/common/driverfuncs.c | 3 - src/mesa/drivers/dri/tdfx/tdfx_context.c | 4 - src/mesa/drivers/glide/fxdd.c | 1 - src/mesa/main/dd.h | 3 - src/mesa/main/enable.c | 22 --- src/mesa/main/extensions.c | 4 - src/mesa/main/ffvertex_prog.c | 1 - src/mesa/main/get.c | 48 ------ src/mesa/main/get_gen.py | 10 -- src/mesa/main/getstring.c | 30 ---- src/mesa/main/mfeatures.h | 1 - src/mesa/main/mtypes.h | 15 -- src/mesa/shader/arbprogparse.c | 9 -- src/mesa/shader/nvfragparse.c | 4 - src/mesa/shader/nvvertparse.c | 7 - src/mesa/shader/prog_debug.c | 255 ------------------------------- src/mesa/shader/prog_debug.h | 44 ------ src/mesa/shader/prog_execute.c | 41 ----- src/mesa/shader/prog_instruction.h | 5 - src/mesa/sources.mak | 1 - src/mesa/swrast/swrast.h | 6 - 23 files changed, 1 insertion(+), 516 deletions(-) delete mode 100644 src/mesa/shader/prog_debug.c delete mode 100644 src/mesa/shader/prog_debug.h (limited to 'docs') diff --git a/docs/MESA_shader_debug.spec b/docs/MESA_shader_debug.spec index 1f7d42ac91..fab92abc76 100644 --- a/docs/MESA_shader_debug.spec +++ b/docs/MESA_shader_debug.spec @@ -13,7 +13,7 @@ Contact Status - XXX - Not complete yet!!! + Obsolete. Version diff --git a/src/mesa/SConscript b/src/mesa/SConscript index 273ce11280..2e0168e0bc 100644 --- a/src/mesa/SConscript +++ b/src/mesa/SConscript @@ -189,7 +189,6 @@ if env['platform'] != 'winddk': 'shader/nvvertparse.c', 'shader/program.c', 'shader/prog_cache.c', - 'shader/prog_debug.c', 'shader/prog_execute.c', 'shader/prog_instruction.c', 'shader/prog_noise.c', diff --git a/src/mesa/drivers/common/driverfuncs.c b/src/mesa/drivers/common/driverfuncs.c index 9bee212c6a..44adaf8682 100644 --- a/src/mesa/drivers/common/driverfuncs.c +++ b/src/mesa/drivers/common/driverfuncs.c @@ -134,9 +134,6 @@ _mesa_init_driver_functions(struct dd_function_table *driver) driver->BindProgram = NULL; driver->NewProgram = _mesa_new_program; driver->DeleteProgram = _mesa_delete_program; -#if FEATURE_MESA_program_debug - driver->GetProgramRegister = _mesa_get_program_register; -#endif /* FEATURE_MESA_program_debug */ /* simple state commands */ driver->AlphaFunc = NULL; diff --git a/src/mesa/drivers/dri/tdfx/tdfx_context.c b/src/mesa/drivers/dri/tdfx/tdfx_context.c index 20046fcb3a..68b5027561 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_context.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_context.c @@ -67,7 +67,6 @@ #define need_GL_EXT_fog_coord #define need_GL_EXT_paletted_texture /* #define need_GL_EXT_secondary_color */ -/* #define need_GL_MESA_program_debug */ /* #define need_GL_NV_vertex_program */ #include "extension_helper.h" @@ -101,9 +100,6 @@ const struct dri_extension card_extensions[] = #ifdef need_GL_NV_vertex_program { "GL_NV_vertex_program", GL_NV_vertex_program_functions } { "GL_NV_vertex_program1_1", NULL }, -#endif -#ifdef need_GL_MESA_program_debug - { "GL_MESA_program_debug", GL_MESA_program_debug_functions }, #endif { NULL, NULL } }; diff --git a/src/mesa/drivers/glide/fxdd.c b/src/mesa/drivers/glide/fxdd.c index 1bcf2512a6..2bc60399ea 100644 --- a/src/mesa/drivers/glide/fxdd.c +++ b/src/mesa/drivers/glide/fxdd.c @@ -1922,7 +1922,6 @@ fxDDInitExtensions(GLcontext * ctx) _mesa_enable_extension(ctx, "GL_ARB_vertex_program"); _mesa_enable_extension(ctx, "GL_NV_vertex_program"); _mesa_enable_extension(ctx, "GL_NV_vertex_program1_1"); - _mesa_enable_extension(ctx, "GL_MESA_program_debug"); } #if 0 /* this requires _tnl_vertex_cull_stage in the pipeline */ diff --git a/src/mesa/main/dd.h b/src/mesa/main/dd.h index a335f77479..d994401e55 100644 --- a/src/mesa/main/dd.h +++ b/src/mesa/main/dd.h @@ -602,9 +602,6 @@ struct dd_function_table { /** Notify driver that a program string has been specified. */ void (*ProgramStringNotify)(GLcontext *ctx, GLenum target, struct gl_program *prog); - /** Get value of a program register during program execution. */ - void (*GetProgramRegister)(GLcontext *ctx, enum register_file file, - GLuint index, GLfloat val[4]); /** Query if program can be loaded onto hardware */ GLboolean (*IsProgramNative)(GLcontext *ctx, GLenum target, diff --git a/src/mesa/main/enable.c b/src/mesa/main/enable.c index a824705bdc..f432be183c 100644 --- a/src/mesa/main/enable.c +++ b/src/mesa/main/enable.c @@ -944,18 +944,6 @@ _mesa_set_enable(GLcontext *ctx, GLenum cap, GLboolean state) ctx->Depth.BoundsTest = state; break; - /* GL_MESA_program_debug */ -#if FEATURE_MESA_program_debug - case GL_FRAGMENT_PROGRAM_CALLBACK_MESA: - CHECK_EXTENSION(MESA_program_debug, cap); - ctx->FragmentProgram.CallbackEnabled = state; - break; - case GL_VERTEX_PROGRAM_CALLBACK_MESA: - CHECK_EXTENSION(MESA_program_debug, cap); - ctx->VertexProgram.CallbackEnabled = state; - break; -#endif - #if FEATURE_ATI_fragment_shader case GL_FRAGMENT_SHADER_ATI: CHECK_EXTENSION(ATI_fragment_shader, cap); @@ -1398,16 +1386,6 @@ _mesa_IsEnabled( GLenum cap ) CHECK_EXTENSION(EXT_depth_bounds_test); return ctx->Depth.BoundsTest; - /* GL_MESA_program_debug */ -#if FEATURE_MESA_program_debug - case GL_FRAGMENT_PROGRAM_CALLBACK_MESA: - CHECK_EXTENSION(MESA_program_debug); - return ctx->FragmentProgram.CallbackEnabled; - case GL_VERTEX_PROGRAM_CALLBACK_MESA: - CHECK_EXTENSION(MESA_program_debug); - return ctx->VertexProgram.CallbackEnabled; -#endif - #if FEATURE_ATI_fragment_shader case GL_FRAGMENT_SHADER_ATI: CHECK_EXTENSION(ATI_fragment_shader); diff --git a/src/mesa/main/extensions.c b/src/mesa/main/extensions.c index 9c8bd13e69..fbca924ad3 100644 --- a/src/mesa/main/extensions.c +++ b/src/mesa/main/extensions.c @@ -147,7 +147,6 @@ static const struct { { OFF, "GL_INGR_blend_func_separate", F(EXT_blend_func_separate) }, { OFF, "GL_MESA_pack_invert", F(MESA_pack_invert) }, { OFF, "GL_MESA_packed_depth_stencil", F(MESA_packed_depth_stencil) }, - { OFF, "GL_MESA_program_debug", F(MESA_program_debug) }, { OFF, "GL_MESA_resize_buffers", F(MESA_resize_buffers) }, { OFF, "GL_MESA_texture_array", F(MESA_texture_array) }, { OFF, "GL_MESA_ycbcr_texture", F(MESA_ycbcr_texture) }, @@ -276,9 +275,6 @@ _mesa_enable_sw_extensions(GLcontext *ctx) ctx->Extensions.EXT_vertex_array_bgra = GL_TRUE; /*ctx->Extensions.IBM_multimode_draw_arrays = GL_TRUE;*/ ctx->Extensions.MESA_pack_invert = GL_TRUE; -#if FEATURE_MESA_program_debug - ctx->Extensions.MESA_program_debug = GL_TRUE; -#endif ctx->Extensions.MESA_resize_buffers = GL_TRUE; ctx->Extensions.MESA_texture_array = GL_TRUE; ctx->Extensions.MESA_ycbcr_texture = GL_TRUE; diff --git a/src/mesa/main/ffvertex_prog.c b/src/mesa/main/ffvertex_prog.c index 42c8cc97c0..72b880e28e 100644 --- a/src/mesa/main/ffvertex_prog.c +++ b/src/mesa/main/ffvertex_prog.c @@ -655,7 +655,6 @@ static void emit_op3fn(struct tnl_program *p, inst = &p->program->Base.Instructions[nr]; inst->Opcode = (enum prog_opcode) op; - inst->StringPos = 0; inst->Data = 0; emit_arg( &inst->SrcReg[0], src0 ); diff --git a/src/mesa/main/get.c b/src/mesa/main/get.c index 3a8d56140f..0937fd053c 100644 --- a/src/mesa/main/get.c +++ b/src/mesa/main/get.c @@ -1715,22 +1715,6 @@ _mesa_GetBooleanv( GLenum pname, GLboolean *params ) params[0] = FLOAT_TO_BOOLEAN(ctx->Depth.BoundsMin); params[1] = FLOAT_TO_BOOLEAN(ctx->Depth.BoundsMax); break; - case GL_FRAGMENT_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetBooleanv"); - params[0] = ctx->FragmentProgram.CallbackEnabled; - break; - case GL_VERTEX_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetBooleanv"); - params[0] = ctx->VertexProgram.CallbackEnabled; - break; - case GL_FRAGMENT_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetBooleanv"); - params[0] = INT_TO_BOOLEAN(ctx->FragmentProgram.CurrentPosition); - break; - case GL_VERTEX_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetBooleanv"); - params[0] = INT_TO_BOOLEAN(ctx->VertexProgram.CurrentPosition); - break; case GL_MAX_DRAW_BUFFERS_ARB: params[0] = INT_TO_BOOLEAN(ctx->Const.MaxDrawBuffers); break; @@ -3541,22 +3525,6 @@ _mesa_GetFloatv( GLenum pname, GLfloat *params ) params[0] = ctx->Depth.BoundsMin; params[1] = ctx->Depth.BoundsMax; break; - case GL_FRAGMENT_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetFloatv"); - params[0] = BOOLEAN_TO_FLOAT(ctx->FragmentProgram.CallbackEnabled); - break; - case GL_VERTEX_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetFloatv"); - params[0] = BOOLEAN_TO_FLOAT(ctx->VertexProgram.CallbackEnabled); - break; - case GL_FRAGMENT_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetFloatv"); - params[0] = (GLfloat)(ctx->FragmentProgram.CurrentPosition); - break; - case GL_VERTEX_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetFloatv"); - params[0] = (GLfloat)(ctx->VertexProgram.CurrentPosition); - break; case GL_MAX_DRAW_BUFFERS_ARB: params[0] = (GLfloat)(ctx->Const.MaxDrawBuffers); break; @@ -5367,22 +5335,6 @@ _mesa_GetIntegerv( GLenum pname, GLint *params ) params[0] = IROUND(ctx->Depth.BoundsMin); params[1] = IROUND(ctx->Depth.BoundsMax); break; - case GL_FRAGMENT_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetIntegerv"); - params[0] = BOOLEAN_TO_INT(ctx->FragmentProgram.CallbackEnabled); - break; - case GL_VERTEX_PROGRAM_CALLBACK_MESA: - CHECK_EXT1(MESA_program_debug, "GetIntegerv"); - params[0] = BOOLEAN_TO_INT(ctx->VertexProgram.CallbackEnabled); - break; - case GL_FRAGMENT_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetIntegerv"); - params[0] = ctx->FragmentProgram.CurrentPosition; - break; - case GL_VERTEX_PROGRAM_POSITION_MESA: - CHECK_EXT1(MESA_program_debug, "GetIntegerv"); - params[0] = ctx->VertexProgram.CurrentPosition; - break; case GL_MAX_DRAW_BUFFERS_ARB: params[0] = ctx->Const.MaxDrawBuffers; break; diff --git a/src/mesa/main/get_gen.py b/src/mesa/main/get_gen.py index 729f382b4b..fa695c48f1 100644 --- a/src/mesa/main/get_gen.py +++ b/src/mesa/main/get_gen.py @@ -902,16 +902,6 @@ StateVars = [ ["ctx->Depth.BoundsMin", "ctx->Depth.BoundsMax"], "", ["EXT_depth_bounds_test"] ), - # GL_MESA_program_debug - ( "GL_FRAGMENT_PROGRAM_CALLBACK_MESA", GLboolean, - ["ctx->FragmentProgram.CallbackEnabled"], "", ["MESA_program_debug"] ), - ( "GL_VERTEX_PROGRAM_CALLBACK_MESA", GLboolean, - ["ctx->VertexProgram.CallbackEnabled"], "", ["MESA_program_debug"] ), - ( "GL_FRAGMENT_PROGRAM_POSITION_MESA", GLint, - ["ctx->FragmentProgram.CurrentPosition"], "", ["MESA_program_debug"] ), - ( "GL_VERTEX_PROGRAM_POSITION_MESA", GLint, - ["ctx->VertexProgram.CurrentPosition"], "", ["MESA_program_debug"] ), - # GL_ARB_draw_buffers ( "GL_MAX_DRAW_BUFFERS_ARB", GLint, ["ctx->Const.MaxDrawBuffers"], "", None ), diff --git a/src/mesa/main/getstring.c b/src/mesa/main/getstring.c index a42c44686d..41fd786d7d 100644 --- a/src/mesa/main/getstring.c +++ b/src/mesa/main/getstring.c @@ -242,36 +242,6 @@ _mesa_GetPointerv( GLenum pname, GLvoid **params ) case GL_SELECTION_BUFFER_POINTER: *params = ctx->Select.Buffer; break; -#if FEATURE_MESA_program_debug - case GL_FRAGMENT_PROGRAM_CALLBACK_FUNC_MESA: - if (!ctx->Extensions.MESA_program_debug) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetPointerv"); - return; - } - *params = *(GLvoid **) &ctx->FragmentProgram.Callback; - break; - case GL_FRAGMENT_PROGRAM_CALLBACK_DATA_MESA: - if (!ctx->Extensions.MESA_program_debug) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetPointerv"); - return; - } - *params = ctx->FragmentProgram.CallbackData; - break; - case GL_VERTEX_PROGRAM_CALLBACK_FUNC_MESA: - if (!ctx->Extensions.MESA_program_debug) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetPointerv"); - return; - } - *params = *(GLvoid **) &ctx->VertexProgram.Callback; - break; - case GL_VERTEX_PROGRAM_CALLBACK_DATA_MESA: - if (!ctx->Extensions.MESA_program_debug) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetPointerv"); - return; - } - *params = ctx->VertexProgram.CallbackData; - break; -#endif default: _mesa_error( ctx, GL_INVALID_ENUM, "glGetPointerv" ); return; diff --git a/src/mesa/main/mfeatures.h b/src/mesa/main/mfeatures.h index 8fb32dd7e9..f570647942 100644 --- a/src/mesa/main/mfeatures.h +++ b/src/mesa/main/mfeatures.h @@ -75,7 +75,6 @@ #define FEATURE_EXT_texture_sRGB _HAVE_FULL_GL #define FEATURE_EXT_timer_query _HAVE_FULL_GL #define FEATURE_ATI_fragment_shader _HAVE_FULL_GL -#define FEATURE_MESA_program_debug _HAVE_FULL_GL #define FEATURE_NV_fence _HAVE_FULL_GL #define FEATURE_NV_fragment_program _HAVE_FULL_GL #define FEATURE_NV_vertex_program _HAVE_FULL_GL diff --git a/src/mesa/main/mtypes.h b/src/mesa/main/mtypes.h index baf5850b83..17f6241e04 100644 --- a/src/mesa/main/mtypes.h +++ b/src/mesa/main/mtypes.h @@ -1856,13 +1856,6 @@ struct gl_vertex_program_state /** Cache of fixed-function programs */ struct gl_program_cache *Cache; -#if FEATURE_MESA_program_debug - GLprogramcallbackMESA Callback; - GLvoid *CallbackData; - GLboolean CallbackEnabled; - GLuint CurrentPosition; -#endif - GLboolean _Overriden; }; @@ -1892,13 +1885,6 @@ struct gl_fragment_program_state /** Cache of fixed-function programs */ struct gl_program_cache *Cache; - -#if FEATURE_MESA_program_debug - GLprogramcallbackMESA Callback; - GLvoid *CallbackData; - GLboolean CallbackEnabled; - GLuint CurrentPosition; -#endif }; @@ -2502,7 +2488,6 @@ struct gl_extensions GLboolean IBM_multimode_draw_arrays; GLboolean MESA_pack_invert; GLboolean MESA_packed_depth_stencil; - GLboolean MESA_program_debug; GLboolean MESA_resize_buffers; GLboolean MESA_ycbcr_texture; GLboolean MESA_texture_array; diff --git a/src/mesa/shader/arbprogparse.c b/src/mesa/shader/arbprogparse.c index ccc0318a53..75398cda90 100644 --- a/src/mesa/shader/arbprogparse.c +++ b/src/mesa/shader/arbprogparse.c @@ -2752,9 +2752,6 @@ parse_fp_instruction (GLcontext * ctx, const GLubyte ** inst, _mesa_init_instructions(fp, 1); - /* Record the position in the program string for debugging */ - fp->StringPos = Program->Position; - /* OP_ALU_INST or OP_TEX_INST */ instClass = *(*inst)++; @@ -3194,8 +3191,6 @@ parse_vp_instruction (GLcontext * ctx, const GLubyte ** inst, code = *(*inst)++; _mesa_init_instructions(vp, 1); - /* Record the position in the program string for debugging */ - vp->StringPos = Program->Position; switch (type) { /* XXX: */ @@ -3557,10 +3552,6 @@ parse_instructions(GLcontext * ctx, const GLubyte * inst, const GLuint numInst = Program->Base.NumInstructions; _mesa_init_instructions(Program->Base.Instructions + numInst, 1); Program->Base.Instructions[numInst].Opcode = OPCODE_END; - /* YYY Wrong Position in program, whatever, at least not random -> crash - Program->Position = parse_position (&inst); - */ - Program->Base.Instructions[numInst].StringPos = Program->Position; } Program->Base.NumInstructions++; diff --git a/src/mesa/shader/nvfragparse.c b/src/mesa/shader/nvfragparse.c index 37418ffb6e..b935cb562a 100644 --- a/src/mesa/shader/nvfragparse.c +++ b/src/mesa/shader/nvfragparse.c @@ -1311,8 +1311,6 @@ Parse_InstructionSequence(struct parse_state *parseState, } else if (Parse_String(parseState, "END")) { inst->Opcode = OPCODE_END; - inst->StringPos = parseState->curLine - parseState->start; - assert(inst->StringPos >= 0); parseState->numInst++; if (Parse_Token(parseState, token)) { RETURN_ERROR1("Code after END opcode."); @@ -1339,8 +1337,6 @@ Parse_InstructionSequence(struct parse_state *parseState, inst->SaturateMode = (instMatch.suffixes & (_S)) ? SATURATE_ZERO_ONE : SATURATE_OFF; inst->CondUpdate = (instMatch.suffixes & (_C)) ? GL_TRUE : GL_FALSE; - inst->StringPos = parseState->curLine - parseState->start; - assert(inst->StringPos >= 0); /* * parse the input and output operands diff --git a/src/mesa/shader/nvvertparse.c b/src/mesa/shader/nvvertparse.c index 08538c0ee4..268b577aec 100644 --- a/src/mesa/shader/nvvertparse.c +++ b/src/mesa/shader/nvvertparse.c @@ -799,7 +799,6 @@ Parse_UnaryOpInstruction(struct parse_state *parseState, RETURN_ERROR1("ABS illegal for vertex program 1.0"); inst->Opcode = opcode; - inst->StringPos = parseState->curLine - parseState->start; /* dest reg */ if (!Parse_MaskedDstReg(parseState, &inst->DstReg)) @@ -832,7 +831,6 @@ Parse_BiOpInstruction(struct parse_state *parseState, RETURN_ERROR1("SUB illegal for vertex program 1.0"); inst->Opcode = opcode; - inst->StringPos = parseState->curLine - parseState->start; /* dest reg */ if (!Parse_MaskedDstReg(parseState, &inst->DstReg)) @@ -880,7 +878,6 @@ Parse_TriOpInstruction(struct parse_state *parseState, enum prog_opcode opcode) { inst->Opcode = opcode; - inst->StringPos = parseState->curLine - parseState->start; /* dest reg */ if (!Parse_MaskedDstReg(parseState, &inst->DstReg)) @@ -951,7 +948,6 @@ Parse_ScalarInstruction(struct parse_state *parseState, RETURN_ERROR1("RCC illegal for vertex program 1.0"); inst->Opcode = opcode; - inst->StringPos = parseState->curLine - parseState->start; /* dest reg */ if (!Parse_MaskedDstReg(parseState, &inst->DstReg)) @@ -977,7 +973,6 @@ static GLboolean Parse_AddressInstruction(struct parse_state *parseState, struct prog_instruction *inst) { inst->Opcode = OPCODE_ARL; - inst->StringPos = parseState->curLine - parseState->start; /* Make ARB_vp backends happy */ inst->DstReg.File = PROGRAM_ADDRESS; @@ -1010,7 +1005,6 @@ Parse_EndInstruction(struct parse_state *parseState, struct prog_instruction *in GLubyte token[100]; inst->Opcode = OPCODE_END; - inst->StringPos = parseState->curLine - parseState->start; /* this should fail! */ if (Parse_Token(parseState, token)) @@ -1044,7 +1038,6 @@ Parse_PrintInstruction(struct parse_state *parseState, struct prog_instruction * GLint idx; inst->Opcode = OPCODE_PRINT; - inst->StringPos = parseState->curLine - parseState->start; /* The first argument is a literal string 'just like this' */ if (!Parse_String(parseState, "'")) diff --git a/src/mesa/shader/prog_debug.c b/src/mesa/shader/prog_debug.c deleted file mode 100644 index 35ce37d5ce..0000000000 --- a/src/mesa/shader/prog_debug.c +++ /dev/null @@ -1,255 +0,0 @@ -/* - * Mesa 3-D graphics library - * Version: 6.5.3 - * - * Copyright (C) 1999-2007 Brian Paul All Rights Reserved. - * - * Permission is hereby granted, free of charge, to any person obtaining a - * copy of this software and associated documentation files (the "Software"), - * to deal in the Software without restriction, including without limitation - * the rights to use, copy, modify, merge, publish, distribute, sublicense, - * and/or sell copies of the Software, and to permit persons to whom the - * Software is furnished to do so, subject to the following conditions: - * - * The above copyright notice and this permission notice shall be included - * in all copies or substantial portions of the Software. - * - * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS - * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL - * BRIAN PAUL BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN - * AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN - * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - */ - - -#include "main/glheader.h" -#include "main/context.h" -#include "main/macros.h" -#include "nvfragparse.h" -#include "nvvertparse.h" -#include "program.h" -#include "prog_debug.h" -#include "prog_parameter.h" -#include "prog_instruction.h" - - - -/** - * Functions for the experimental GL_MESA_program_debug extension. - */ - - -/* XXX temporary */ -GLAPI void GLAPIENTRY -glProgramCallbackMESA(GLenum target, GLprogramcallbackMESA callback, - GLvoid *data) -{ - _mesa_ProgramCallbackMESA(target, callback, data); -} - - -void -_mesa_ProgramCallbackMESA(GLenum target, GLprogramcallbackMESA callback, - GLvoid *data) -{ - GET_CURRENT_CONTEXT(ctx); - - switch (target) { - case GL_FRAGMENT_PROGRAM_ARB: - if (!ctx->Extensions.ARB_fragment_program) { - _mesa_error(ctx, GL_INVALID_ENUM, "glProgramCallbackMESA(target)"); - return; - } - ctx->FragmentProgram.Callback = callback; - ctx->FragmentProgram.CallbackData = data; - break; - case GL_FRAGMENT_PROGRAM_NV: - if (!ctx->Extensions.NV_fragment_program) { - _mesa_error(ctx, GL_INVALID_ENUM, "glProgramCallbackMESA(target)"); - return; - } - ctx->FragmentProgram.Callback = callback; - ctx->FragmentProgram.CallbackData = data; - break; - case GL_VERTEX_PROGRAM_ARB: /* == GL_VERTEX_PROGRAM_NV */ - if (!ctx->Extensions.ARB_vertex_program && - !ctx->Extensions.NV_vertex_program) { - _mesa_error(ctx, GL_INVALID_ENUM, "glProgramCallbackMESA(target)"); - return; - } - ctx->VertexProgram.Callback = callback; - ctx->VertexProgram.CallbackData = data; - break; - default: - _mesa_error(ctx, GL_INVALID_ENUM, "glProgramCallbackMESA(target)"); - return; - } -} - - -/* XXX temporary */ -GLAPI void GLAPIENTRY -glGetProgramRegisterfvMESA(GLenum target, - GLsizei len, const GLubyte *registerName, - GLfloat *v) -{ - _mesa_GetProgramRegisterfvMESA(target, len, registerName, v); -} - - -void -_mesa_GetProgramRegisterfvMESA(GLenum target, - GLsizei len, const GLubyte *registerName, - GLfloat *v) -{ - char reg[1000]; - GET_CURRENT_CONTEXT(ctx); - - /* We _should_ be inside glBegin/glEnd */ -#if 0 - if (ctx->Driver.CurrentExecPrimitive == PRIM_OUTSIDE_BEGIN_END) { - _mesa_error(ctx, GL_INVALID_OPERATION, "glGetProgramRegisterfvMESA"); - return; - } -#endif - - /* make null-terminated copy of registerName */ - len = MIN2((unsigned int) len, sizeof(reg) - 1); - _mesa_memcpy(reg, registerName, len); - reg[len] = 0; - - switch (target) { - case GL_VERTEX_PROGRAM_ARB: /* == GL_VERTEX_PROGRAM_NV */ - if (!ctx->Extensions.ARB_vertex_program && - !ctx->Extensions.NV_vertex_program) { - _mesa_error(ctx, GL_INVALID_ENUM, - "glGetProgramRegisterfvMESA(target)"); - return; - } - if (!ctx->VertexProgram._Enabled) { - _mesa_error(ctx, GL_INVALID_OPERATION, - "glGetProgramRegisterfvMESA"); - return; - } - /* GL_NV_vertex_program */ - if (reg[0] == 'R') { - /* Temp register */ - GLint i = _mesa_atoi(reg + 1); - if (i >= (GLint)ctx->Const.VertexProgram.MaxTemps) { - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - ctx->Driver.GetProgramRegister(ctx, PROGRAM_TEMPORARY, i, v); - } - else if (reg[0] == 'v' && reg[1] == '[') { - /* Vertex Input attribute */ - GLuint i; - for (i = 0; i < ctx->Const.VertexProgram.MaxAttribs; i++) { - const char *name = _mesa_nv_vertex_input_register_name(i); - char number[10]; - _mesa_sprintf(number, "%d", i); - if (_mesa_strncmp(reg + 2, name, 4) == 0 || - _mesa_strncmp(reg + 2, number, _mesa_strlen(number)) == 0) { - ctx->Driver.GetProgramRegister(ctx, PROGRAM_INPUT, i, v); - return; - } - } - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - else if (reg[0] == 'o' && reg[1] == '[') { - /* Vertex output attribute */ - } - /* GL_ARB_vertex_program */ - else if (_mesa_strncmp(reg, "vertex.", 7) == 0) { - - } - else { - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - break; - case GL_FRAGMENT_PROGRAM_ARB: - if (!ctx->Extensions.ARB_fragment_program) { - _mesa_error(ctx, GL_INVALID_ENUM, - "glGetProgramRegisterfvMESA(target)"); - return; - } - if (!ctx->FragmentProgram._Enabled) { - _mesa_error(ctx, GL_INVALID_OPERATION, - "glGetProgramRegisterfvMESA"); - return; - } - /* XXX to do */ - break; - case GL_FRAGMENT_PROGRAM_NV: - if (!ctx->Extensions.NV_fragment_program) { - _mesa_error(ctx, GL_INVALID_ENUM, - "glGetProgramRegisterfvMESA(target)"); - return; - } - if (!ctx->FragmentProgram._Enabled) { - _mesa_error(ctx, GL_INVALID_OPERATION, - "glGetProgramRegisterfvMESA"); - return; - } - if (reg[0] == 'R') { - /* Temp register */ - GLint i = _mesa_atoi(reg + 1); - if (i >= (GLint)ctx->Const.FragmentProgram.MaxTemps) { - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - ctx->Driver.GetProgramRegister(ctx, PROGRAM_TEMPORARY, - i, v); - } - else if (reg[0] == 'f' && reg[1] == '[') { - /* Fragment input attribute */ - GLuint i; - for (i = 0; i < ctx->Const.FragmentProgram.MaxAttribs; i++) { - const char *name = _mesa_nv_fragment_input_register_name(i); - if (_mesa_strncmp(reg + 2, name, 4) == 0) { - ctx->Driver.GetProgramRegister(ctx, PROGRAM_INPUT, i, v); - return; - } - } - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - else if (_mesa_strcmp(reg, "o[COLR]") == 0 || - _mesa_strcmp(reg, "o[COLH]") == 0) { - /* Fragment output color */ - ctx->Driver.GetProgramRegister(ctx, PROGRAM_OUTPUT, - FRAG_RESULT_COLOR, v); - } - else if (_mesa_strcmp(reg, "o[DEPR]") == 0) { - /* Fragment output depth */ - ctx->Driver.GetProgramRegister(ctx, PROGRAM_OUTPUT, - FRAG_RESULT_DEPTH, v); - } - else { - /* try user-defined identifiers */ - const GLfloat *value = _mesa_lookup_parameter_value( - ctx->FragmentProgram.Current->Base.Parameters, -1, reg); - if (value) { - COPY_4V(v, value); - } - else { - _mesa_error(ctx, GL_INVALID_VALUE, - "glGetProgramRegisterfvMESA(registerName)"); - return; - } - } - break; - default: - _mesa_error(ctx, GL_INVALID_ENUM, - "glGetProgramRegisterfvMESA(target)"); - return; - } -} diff --git a/src/mesa/shader/prog_debug.h b/src/mesa/shader/prog_debug.h deleted file mode 100644 index fc400e19de..0000000000 --- a/src/mesa/shader/prog_debug.h +++ /dev/null @@ -1,44 +0,0 @@ -/* - * Mesa 3-D graphics library - * Version: 6.5.3 - * - * Copyright (C) 1999-2007 Brian Paul All Rights Reserved. - * - * Permission is hereby granted, free of charge, to any person obtaining a - * copy of this software and associated documentation files (the "Software"), - * to deal in the Software without restriction, including without limitation - * the rights to use, copy, modify, merge, publish, distribute, sublicense, - * and/or sell copies of the Software, and to permit persons to whom the - * Software is furnished to do so, subject to the following conditions: - * - * The above copyright notice and this permission notice shall be included - * in all copies or substantial portions of the Software. - * - * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS - * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL - * BRIAN PAUL BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN - * AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN - * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - */ - - -#ifndef PROG_DEBUG_H -#define PROG_DEBUG_H 1 - - -/* - * GL_MESA_program_debug - */ - -extern void -_mesa_ProgramCallbackMESA(GLenum target, GLprogramcallbackMESA callback, - GLvoid *data); - -extern void -_mesa_GetProgramRegisterfvMESA(GLenum target, GLsizei len, - const GLubyte *registerName, GLfloat *v); - - - -#endif /* PROG_DEBUG_H */ diff --git a/src/mesa/shader/prog_execute.c b/src/mesa/shader/prog_execute.c index a93733c085..a60cda674b 100644 --- a/src/mesa/shader/prog_execute.c +++ b/src/mesa/shader/prog_execute.c @@ -186,30 +186,6 @@ get_dst_register_pointer(const struct prog_dst_register *dest, -#if FEATURE_MESA_program_debug -static struct gl_program_machine *CurrentMachine = NULL; - -/** - * For GL_MESA_program_debug. - * Return current value (4*GLfloat) of a program register. - * Called via ctx->Driver.GetProgramRegister(). - */ -void -_mesa_get_program_register(GLcontext *ctx, enum register_file file, - GLuint index, GLfloat val[4]) -{ - if (CurrentMachine) { - struct prog_src_register srcReg; - const GLfloat *src; - srcReg.File = file; - srcReg.Index = index; - src = get_src_register_pointer(&srcReg, CurrentMachine); - COPY_4V(val, src); - } -} -#endif /* FEATURE_MESA_program_debug */ - - /** * Fetch a 4-element float vector from the given source register. * Apply swizzling and negating as needed. @@ -633,10 +609,6 @@ _mesa_execute_program(GLcontext * ctx, printf("execute program %u --------------------\n", program->Id); } -#if FEATURE_MESA_program_debug - CurrentMachine = machine; -#endif - if (program->Target == GL_VERTEX_PROGRAM_ARB) { machine->EnvParams = ctx->VertexProgram.Parameters; } @@ -647,15 +619,6 @@ _mesa_execute_program(GLcontext * ctx, for (pc = 0; pc < numInst; pc++) { const struct prog_instruction *inst = program->Instructions + pc; -#if FEATURE_MESA_program_debug - if (ctx->FragmentProgram.CallbackEnabled && - ctx->FragmentProgram.Callback) { - ctx->FragmentProgram.CurrentPosition = inst->StringPos; - ctx->FragmentProgram.Callback(program->Target, - ctx->FragmentProgram.CallbackData); - } -#endif - if (DEBUG_PROG) { _mesa_print_instruction(inst); } @@ -1780,9 +1743,5 @@ _mesa_execute_program(GLcontext * ctx, } /* for pc */ -#if FEATURE_MESA_program_debug - CurrentMachine = NULL; -#endif - return GL_TRUE; } diff --git a/src/mesa/shader/prog_instruction.h b/src/mesa/shader/prog_instruction.h index 95dd7fda7f..4adce11f95 100644 --- a/src/mesa/shader/prog_instruction.h +++ b/src/mesa/shader/prog_instruction.h @@ -421,11 +421,6 @@ struct prog_instruction /** for driver use (try to remove someday) */ GLint Aux; - - /* XXX obsolete - remove someday */ -#if FEATURE_MESA_program_debug - GLshort StringPos; -#endif }; diff --git a/src/mesa/sources.mak b/src/mesa/sources.mak index 08ba345009..d8d48476e8 100644 --- a/src/mesa/sources.mak +++ b/src/mesa/sources.mak @@ -220,7 +220,6 @@ SHADER_SOURCES = \ shader/nvvertparse.c \ shader/program.c \ shader/prog_cache.c \ - shader/prog_debug.c \ shader/prog_execute.c \ shader/prog_instruction.c \ shader/prog_noise.c \ diff --git a/src/mesa/swrast/swrast.h b/src/mesa/swrast/swrast.h index 015f8a05c3..c319ca62f9 100644 --- a/src/mesa/swrast/swrast.h +++ b/src/mesa/swrast/swrast.h @@ -266,12 +266,6 @@ extern void _swrast_eject_texture_images(GLcontext *ctx); -#if FEATURE_MESA_program_debug -extern void -_swrast_get_program_register(GLcontext *, enum register_file file, - GLuint index, GLfloat val[4]); -#endif /* FEATURE_MESA_program_debug */ - /** * The driver interface for the software rasterizer. -- cgit v1.2.3 From c9caecaffaa6144668a2c732467b49872981b656 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 20 Mar 2009 09:20:53 -0600 Subject: docs: updated Mesa extension enum info --- docs/enums.txt | 14 ++++++++++++-- 1 file changed, 12 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/enums.txt b/docs/enums.txt index 6c43fc1891..b37768e202 100644 --- a/docs/enums.txt +++ b/docs/enums.txt @@ -1,4 +1,6 @@ +See the OpenGL ARB enum registry at http://www.opengl.org/registry/api/enum.spec + Blocks allocated to Mesa: 0x8750-0x875F 0x8BB0-0x8BBF @@ -30,12 +32,12 @@ MESA_ycbcr_texture.spec: GL_MESA_pack_invert.spec GL_PACK_INVERT_MESA 0x8758 -GL_MESA_shader_debug.spec: +GL_MESA_shader_debug.spec: (obsolete) GL_DEBUG_OBJECT_MESA 0x8759 GL_DEBUG_PRINT_MESA 0x875A GL_DEBUG_ASSERT_MESA 0x875B -GL_MESA_program_debug.spec: +GL_MESA_program_debug.spec: (obsolete) GL_FRAGMENT_PROGRAM_CALLBACK_MESA 0x???? GL_VERTEX_PROGRAM_CALLBACK_MESA 0x???? GL_FRAGMENT_PROGRAM_POSITION_MESA 0x???? @@ -45,3 +47,11 @@ GL_MESA_program_debug.spec: GL_VERTEX_PROGRAM_CALLBACK_FUNC_MESA 0x???? GL_VERTEX_PROGRAM_CALLBACK_DATA_MESA 0x???? +GL_MESAX_texture_stack: + GL_TEXTURE_1D_STACK_MESAX 0x8759 + GL_TEXTURE_2D_STACK_MESAX 0x875A + GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B + GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C + GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D + GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E + -- cgit v1.2.3 From c6a6cc191813e8343a17b028146a34f193a6ce44 Mon Sep 17 00:00:00 2001 From: Roland Scheidegger Date: Fri, 27 Mar 2009 19:39:52 +0100 Subject: mesa: add new signed rgba texture format This is a (partial) backport of the signed texture format support in OGL 3.1. Since it wasn't promoted from an existing extension roll our own. --- docs/MESA_texture_signed_rgba.spec | 214 ++++++++++++++++++++++++++++++ docs/extensions.html | 1 + src/mesa/glapi/gl_API.xml | 6 + src/mesa/main/colortab.c | 2 +- src/mesa/main/convolve.c | 6 +- src/mesa/main/extensions.c | 1 + src/mesa/main/histogram.c | 2 +- src/mesa/main/image.c | 17 +-- src/mesa/main/image.h | 2 +- src/mesa/main/macros.h | 22 +++ src/mesa/main/mipmap.c | 111 ++++++++++++++-- src/mesa/main/mtypes.h | 1 + src/mesa/main/texformat.c | 44 +++++- src/mesa/main/texformat.h | 4 +- src/mesa/main/texformat_tmp.h | 22 +++ src/mesa/main/teximage.c | 13 ++ src/mesa/main/texstore.c | 127 +++++++++++++++++- src/mesa/main/texstore.h | 1 + src/mesa/state_tracker/st_cb_readpixels.c | 2 +- src/mesa/swrast/s_readpix.c | 4 +- 20 files changed, 557 insertions(+), 45 deletions(-) create mode 100644 docs/MESA_texture_signed_rgba.spec (limited to 'docs') diff --git a/docs/MESA_texture_signed_rgba.spec b/docs/MESA_texture_signed_rgba.spec new file mode 100644 index 0000000000..49c8e9e5dd --- /dev/null +++ b/docs/MESA_texture_signed_rgba.spec @@ -0,0 +1,214 @@ +Name + + MESA_texture_signed_rgba + +Name Strings + + GL_MESA_texture_signed_rgba + +Contact + + + +Notice + + + +IP Status + + No known IP issues + +Status + + + +Version + + 0.3, 2009-03-24 + +Number + + Not assigned ? + +Dependencies + + Written based on the wording of the OpenGL 2.0 specification. + + This extension trivially interacts with ARB_texture_float. + This extension shares some language with ARB_texture_compression_rgtc + but does not depend on it. + +Overview + + OpenGL prior to 3.1 does not support any signed texture formats. + ARB_texture_compression_rgtc introduces some compressed red and + red_green signed formats but no uncompressed ones, which might + still be useful. NV_texture_shader adds signed texture formats, + but also a lot of functionality which has been superceded by fragment + shaders. + It is usually possible to get the same functionality + using a unsigned format by doing scale and bias in a shader, but this + is undesirable since modern hardware has direct support for this. + This extension adds a signed 4-channel texture format by backporting + the relevant features from OpenGL 3.1, as a means to support this in + OpenGL implementations only supporting older versions. + +Issues + + 1) What should this extension be called? + + RESOLVED: MESA_texture_signed_rgba seems reasonable. + The rgba part is there because only 4 channel format is supported. + + + 2) Should the full set of signed formats (alpha, luminance, rgb, etc.) + be supported? + + RESOLVED: NO. To keep this extension simple, only add the most + universal format, rgba. alpha/luminance can't be trivially supported + since OpenGL 3.1 does not support them any longer, and there is some + implied dependency on ARB_texture_rg for red/red_green formats so + avoid all this. Likewise, only 8 bits per channel is supported. + + + 3) Should this extension use new enums for the texture formats? + + RESOLVED: NO. Same enums as those used in OpenGL 3.1. + + + 4) How are signed integer values mapped to floating-point values? + + RESOLVED: Same as described in issue 5) of + ARB_texture_compression_rgtc (quote): + A signed 8-bit two's complement value X is computed to + a floating-point value Xf with the formula: + + { X / 127.0, X > -128 + Xf = { + { -1.0, X == -128 + + This conversion means -1, 0, and +1 are all exactly representable, + however -128 and -127 both map to -1.0. Mapping -128 to -1.0 + avoids the numerical awkwardness of have a representable value + slightly more negative than -1.0. + + This conversion is intentionally NOT the "byte" conversion listed + in Table 2.9 for component conversions. That conversion says: + + Xf = (2*X + 1) / 255.0 + + The Table 2.9 conversion is incapable of exactly representing + zero. + + (Difference to ARB_texture_compression_rgtc): + This is the same mapping as OpenGL 3.1 uses. + This is also different to what NV_texture_shader used. + The above mapping should be considered the reference, but there + is some leeway so other mappings are allowed for implementations which + cannot do this. Particulary the mapping given in NV_texture_shader or + the standard OpenGL byte/float mapping is considered acceptable too, as + might be a mapping which represents -1.0 by -128, 0.0 by 0 and 1.0 by + 127 (that is, uses different scale factors for negative and positive + numbers). + Also, it is ok to store incoming GL_BYTE user data as-is, without + converting to GL_FLOAT (using the standard OpenGL float/byte mapping) + and converting back (using the mapping described here). + Other than those subtle issues there are no other non-standard + conversions used, so when using for instance CopyTexImage2D with + a framebuffer clamped to [0,1] all converted numbers will be in the range + [0, 127] (and not scaled and biased). + + + 5) How will signed components resulting from RGBA8_SNORM texture + fetches interact with fragment coloring? + + RESOLVED: Same as described in issue 6) of + ARB_texture_compression_rgtc (quote): + The specification language for this extension is silent + about clamping behavior leaving this to the core specification + and other extensions. The clamping or lack of clamping is left + to the core specification and other extensions. + + For assembly program extensions supporting texture fetches + (ARB_fragment_program, NV_fragment_program, NV_vertex_program3, + etc.) or the OpenGL Shading Language, these signed formats will + appear as expected with unclamped signed components as a result + of a texture fetch instruction. + + If ARB_color_buffer_float is supported, its clamping controls + will apply. + + NV_texture_shader extension, if supported, adds support for + fixed-point textures with signed components and relaxed the + fixed-function texture environment clamping appropriately. If the + NV_texture_shader extension is supported, its specified behavior + for the texture environment applies where intermediate values + are clamped to [-1,1] unless stated otherwise as in the case + of explicitly clamped to [0,1] for GL_COMBINE. or clamping the + linear interpolation weight to [0,1] for GL_DECAL and GL_BLEND. + + Otherwise, the conventional core texture environment clamps + incoming, intermediate, and output color components to [0,1]. + + This implies that the conventional texture environment + functionality of unextended OpenGL 1.5 or OpenGL 2.0 without + using GLSL (and with none of the extensions referred to above) + is unable to make proper use of the signed texture formats added + by this extension because the conventional texture environment + requires texture source colors to be clamped to [0,1]. Texture + filtering of these signed formats would be still signed, but + negative values generated post-filtering would be clamped to + zero by the core texture environment functionality. The + expectation is clearly that this extension would be co-implemented + with one of the previously referred to extensions or used with + GLSL for the new signed formats to be useful. + + + 6) Should the RGBA_SNORM tokens also be accepted by CopyTexImage + functions? + + RESOLVED: YES. + + + 7) What to do with GetTexParameter if ARB_texture_float is supported, + in particular what datatype should this return for TEXTURE_RED_TYPE_ARB, + TEXTURE_GREEN_TYPE_ARB, TEXTURE_BLUE_TYPE_ARB, TEXTURE_ALPHA_TYPE_ARB? + + RESOLVED: ARB_texture_float states type is either NONE, + UNSIGNED_NORMALIZED_ARB, or FLOAT. This extension adds a new enum, + SIGNED_NORMALIZED, which will be returned accordingly. This is the + same behaviour as in OpenGL 3.1. + + +New Tokens + + + Accepted by the parameter of + TexImage1D, TexImage2D, TexImage3D, CopyTexImage1D, and CopyTexImage2D: + + RGBA_SNORM 0x8F93 + RGBA8_SNORM 0x8F97 + + Returned by the parameter of GetTexLevelParameter: + + SIGNED_NORMALIZED 0x8F9C + + +Additions to Chapter 3 of the OpenGL 2.0 Specification (Rasterization): + + -- Section 3.8.1, Texture Image Specification + + Add to Table 3.16 (page 154): Sized internal formats + + Sized Base R G B A L I D + Internal Format Internal Format bits bits bits bits bits bits bits + --------------- --------------- ---- ---- ---- ---- ---- ---- ---- + RGBA8_SNORM RGBA 8 8 8 8 0 0 0 + + +Dependencies on ARB_texture_float extension: + + If ARB_texture_float is supported, GetTexParameter queries with + of TEXTURE_RED_TYPE_ARB, TEXTURE_GREEN_TYPE_ARB, TEXTURE_BLUE_TYPE_ARB or + TEXTURE_ALPHA_TYPE_ARB return SIGNED_NORMALIZED if + the base internal format is RGBA_SNORM. diff --git a/docs/extensions.html b/docs/extensions.html index dbb8ebadaf..91ed20e5ce 100644 --- a/docs/extensions.html +++ b/docs/extensions.html @@ -24,6 +24,7 @@ The specifications follow.
      • MESA_resize_buffers.spec
      • MESA_set_3dfx_mode.spec
      • MESA_sprite_point.spec (obsolete) +
      • MESA_texture_signed_rgba.spec
      • MESA_trace.spec (obsolete)
      • MESA_window_pos.spec
      • MESA_ycbcr_texture.spec diff --git a/src/mesa/glapi/gl_API.xml b/src/mesa/glapi/gl_API.xml index cc3e3ae6bf..ef774f2e60 100644 --- a/src/mesa/glapi/gl_API.xml +++ b/src/mesa/glapi/gl_API.xml @@ -12326,6 +12326,12 @@ + + + + + + diff --git a/src/mesa/main/colortab.c b/src/mesa/main/colortab.c index bd9cf438b4..b05c0513aa 100644 --- a/src/mesa/main/colortab.c +++ b/src/mesa/main/colortab.c @@ -718,7 +718,7 @@ _mesa_GetColorTable( GLenum target, GLenum format, } _mesa_pack_rgba_span_float(ctx, table->Size, rgba, - format, type, data, &ctx->Pack, 0x0); + format, type, data, &ctx->Pack, 0x0, GL_FALSE); if (ctx->Pack.BufferObj->Name) { ctx->Driver.UnmapBuffer(ctx, GL_PIXEL_PACK_BUFFER_EXT, diff --git a/src/mesa/main/convolve.c b/src/mesa/main/convolve.c index 814c6a0a5a..63b652bf70 100644 --- a/src/mesa/main/convolve.c +++ b/src/mesa/main/convolve.c @@ -626,7 +626,7 @@ _mesa_GetConvolutionFilter(GLenum target, GLenum format, GLenum type, row, 0); GLfloat (*src)[4] = (GLfloat (*)[4]) (filter->Filter + row * filter->Width * 4); _mesa_pack_rgba_span_float(ctx, filter->Width, src, - format, type, dst, &ctx->Pack, 0x0); + format, type, dst, &ctx->Pack, 0x0, GL_FALSE); } if (ctx->Pack.BufferObj->Name) { @@ -836,7 +836,7 @@ _mesa_GetSeparableFilter(GLenum target, GLenum format, GLenum type, format, type, 0); _mesa_pack_rgba_span_float(ctx, filter->Width, (GLfloat (*)[4]) filter->Filter, - format, type, dst, &ctx->Pack, 0x0); + format, type, dst, &ctx->Pack, 0x0, GL_FALSE); } /* Column filter */ @@ -845,7 +845,7 @@ _mesa_GetSeparableFilter(GLenum target, GLenum format, GLenum type, format, type, 0); GLfloat (*src)[4] = (GLfloat (*)[4]) (filter->Filter + colStart); _mesa_pack_rgba_span_float(ctx, filter->Height, src, - format, type, dst, &ctx->Pack, 0x0); + format, type, dst, &ctx->Pack, 0x0, GL_FALSE); } (void) span; /* unused at this time */ diff --git a/src/mesa/main/extensions.c b/src/mesa/main/extensions.c index 2d2bf51784..147d923e64 100644 --- a/src/mesa/main/extensions.c +++ b/src/mesa/main/extensions.c @@ -150,6 +150,7 @@ static const struct { { OFF, "GL_MESA_packed_depth_stencil", F(MESA_packed_depth_stencil) }, { OFF, "GL_MESA_resize_buffers", F(MESA_resize_buffers) }, { OFF, "GL_MESA_texture_array", F(MESA_texture_array) }, + { OFF, "GL_MESA_texture_signed_rgba", F(MESA_texture_signed_rgba) }, { OFF, "GL_MESA_ycbcr_texture", F(MESA_ycbcr_texture) }, { ON, "GL_MESA_window_pos", F(ARB_window_pos) }, { OFF, "GL_NV_blend_square", F(NV_blend_square) }, diff --git a/src/mesa/main/histogram.c b/src/mesa/main/histogram.c index 905c1ad830..febf8d99c4 100644 --- a/src/mesa/main/histogram.c +++ b/src/mesa/main/histogram.c @@ -684,7 +684,7 @@ _mesa_GetMinmax(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvo minmax[1][BCOMP] = CLAMP(ctx->MinMax.Max[BCOMP], 0.0F, 1.0F); minmax[1][ACOMP] = CLAMP(ctx->MinMax.Max[ACOMP], 0.0F, 1.0F); _mesa_pack_rgba_span_float(ctx, 2, minmax, - format, type, values, &ctx->Pack, 0x0); + format, type, values, &ctx->Pack, 0x0, GL_FALSE); } if (ctx->Pack.BufferObj->Name) { diff --git a/src/mesa/main/image.c b/src/mesa/main/image.c index fa3149d56d..44972ae8e2 100644 --- a/src/mesa/main/image.c +++ b/src/mesa/main/image.c @@ -1686,24 +1686,13 @@ _mesa_pack_rgba_span_float(GLcontext *ctx, GLuint n, GLfloat rgba[][4], GLenum dstFormat, GLenum dstType, GLvoid *dstAddr, const struct gl_pixelstore_attrib *dstPacking, - GLbitfield transferOps) + GLbitfield transferOps, GLboolean noClamp) { GLfloat luminance[MAX_WIDTH]; const GLint comps = _mesa_components_in_format(dstFormat); GLuint i; - /* clamping only applies to colors, not the dudv values, but still need - it if converting to unsigned values (which doesn't make much sense) */ - if (dstFormat == GL_DUDV_ATI || dstFormat == GL_DU8DV8_ATI) { - switch (dstType) { - case GL_UNSIGNED_BYTE: - case GL_UNSIGNED_SHORT: - case GL_UNSIGNED_INT: - transferOps |= IMAGE_CLAMP_BIT; - break; - /* actually might want clamp to [-1,1] otherwise but shouldn't matter? */ - } - } - else if (dstType != GL_FLOAT || ctx->Color.ClampReadColor == GL_TRUE) { + + if ((!noClamp) && (dstType != GL_FLOAT || ctx->Color.ClampReadColor == GL_TRUE)) { /* need to clamp to [0, 1] */ transferOps |= IMAGE_CLAMP_BIT; } diff --git a/src/mesa/main/image.h b/src/mesa/main/image.h index b26c27e5a8..fb7a5c0e90 100644 --- a/src/mesa/main/image.h +++ b/src/mesa/main/image.h @@ -178,7 +178,7 @@ extern void _mesa_pack_rgba_span_float( GLcontext *ctx, GLuint n, GLfloat rgba[][4], GLenum dstFormat, GLenum dstType, GLvoid *dstAddr, const struct gl_pixelstore_attrib *dstPacking, - GLbitfield transferOps ); + GLbitfield transferOps, GLboolean noClamp ); extern void diff --git a/src/mesa/main/macros.h b/src/mesa/main/macros.h index bfd740870e..01d59dd42d 100644 --- a/src/mesa/main/macros.h +++ b/src/mesa/main/macros.h @@ -54,12 +54,20 @@ extern GLfloat _mesa_ubyte_to_float_color_tab[256]; #define FLOAT_TO_BYTE(X) ( (((GLint) (255.0F * (X))) - 1) / 2 ) +/** Convert GLbyte in [-128,127] to GLfloat in [-1.0,1.0], texture/fb data */ +#define BYTE_TO_FLOAT_TEX(B) ((B) == -128 ? -1.0 : (B) * (1.0F/127.0F)) + +/** Convert GLfloat in [-1.0,1.0] to GLbyte in [-128,127], texture/fb data */ +#define FLOAT_TO_BYTE_TEX(X) ( (GLint) (127.0F * (X)) ) + + /** Convert GLushort in [0,65535] to GLfloat in [0.0,1.0] */ #define USHORT_TO_FLOAT(S) ((GLfloat) (S) * (1.0F / 65535.0F)) /** Convert GLfloat in [0.0,1.0] to GLushort in [0, 65535] */ #define FLOAT_TO_USHORT(X) ((GLuint) ((X) * 65535.0)) + /** Convert GLshort in [-32768,32767] to GLfloat in [-1.0,1.0] */ #define SHORT_TO_FLOAT(S) ((2.0F * (S) + 1.0F) * (1.0F/65535.0F)) @@ -67,6 +75,13 @@ extern GLfloat _mesa_ubyte_to_float_color_tab[256]; #define FLOAT_TO_SHORT(X) ( (((GLint) (65535.0F * (X))) - 1) / 2 ) +/** Convert GLshort in [-32768,32767] to GLfloat in [-1.0,1.0], texture/fb data */ +#define SHORT_TO_FLOAT_TEX(S) ((S) == -32768 ? -1.0 : (S) * (1.0F/32767.0F)) + +/** Convert GLfloat in [-1.0,1.0] to GLshort in [-32768,32767], texture/fb data */ +#define FLOAT_TO_SHORT_TEX(X) ( (GLint) (32767.0F * (X)) ) + + /** Convert GLuint in [0,4294967295] to GLfloat in [0.0,1.0] */ #define UINT_TO_FLOAT(U) ((GLfloat) (U) * (1.0F / 4294967295.0F)) @@ -85,6 +100,13 @@ extern GLfloat _mesa_ubyte_to_float_color_tab[256]; #define FLOAT_TO_INT(X) ( (GLint) (2147483647.0 * (X)) ) +/** Convert GLint in [-2147483648,2147483647] to GLfloat in [-1.0,1.0], texture/fb data */ +#define INT_TO_FLOAT_TEX(I) ((I) == -2147483648 ? -1.0 : (I) * (1.0F/2147483647.0)) + +/** Convert GLfloat in [-1.0,1.0] to GLint in [-2147483648,2147483647], texture/fb data */ +#define FLOAT_TO_INT_TEX(X) ( (GLint) (2147483647.0F * (X)) ) + + #define BYTE_TO_UBYTE(b) ((GLubyte) ((b) < 0 ? 0 : (GLubyte) (b))) #define SHORT_TO_UBYTE(s) ((GLubyte) ((s) < 0 ? 0 : (GLubyte) ((s) >> 7))) #define USHORT_TO_UBYTE(s) ((GLubyte) ((s) >> 8)) diff --git a/src/mesa/main/mipmap.c b/src/mesa/main/mipmap.c index 4a79430c34..7001211a13 100644 --- a/src/mesa/main/mipmap.c +++ b/src/mesa/main/mipmap.c @@ -86,6 +86,21 @@ bytes_per_pixel(GLenum datatype, GLuint comps) rowD[j][e], rowD[k][e]); \ } while(0) +#define FILTER_SUM_3D_SIGNED(Aj, Ak, Bj, Bk, Cj, Ck, Dj, Dk) \ + (Aj + Ak \ + + Bj + Bk \ + + Cj + Ck \ + + Dj + Dk \ + + 4) / 8 + +#define FILTER_3D_SIGNED(e) \ + do { \ + dst[i][e] = FILTER_SUM_3D_SIGNED(rowA[j][e], rowA[k][e], \ + rowB[j][e], rowB[k][e], \ + rowC[j][e], rowC[k][e], \ + rowD[j][e], rowD[k][e]); \ + } while(0) + #define FILTER_F_3D(e) \ do { \ dst[i][e] = (rowA[j][e] + rowA[k][e] \ @@ -180,6 +195,53 @@ do_row(GLenum datatype, GLuint comps, GLint srcWidth, } } + if (datatype == GL_BYTE && comps == 4) { + GLuint i, j, k; + const GLbyte(*rowA)[4] = (const GLbyte(*)[4]) srcRowA; + const GLbyte(*rowB)[4] = (const GLbyte(*)[4]) srcRowB; + GLbyte(*dst)[4] = (GLbyte(*)[4]) dstRow; + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + dst[i][0] = (rowA[j][0] + rowA[k][0] + rowB[j][0] + rowB[k][0]) / 4; + dst[i][1] = (rowA[j][1] + rowA[k][1] + rowB[j][1] + rowB[k][1]) / 4; + dst[i][2] = (rowA[j][2] + rowA[k][2] + rowB[j][2] + rowB[k][2]) / 4; + dst[i][3] = (rowA[j][3] + rowA[k][3] + rowB[j][3] + rowB[k][3]) / 4; + } + } + else if (datatype == GL_BYTE && comps == 3) { + GLuint i, j, k; + const GLbyte(*rowA)[3] = (const GLbyte(*)[3]) srcRowA; + const GLbyte(*rowB)[3] = (const GLbyte(*)[3]) srcRowB; + GLbyte(*dst)[3] = (GLbyte(*)[3]) dstRow; + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + dst[i][0] = (rowA[j][0] + rowA[k][0] + rowB[j][0] + rowB[k][0]) / 4; + dst[i][1] = (rowA[j][1] + rowA[k][1] + rowB[j][1] + rowB[k][1]) / 4; + dst[i][2] = (rowA[j][2] + rowA[k][2] + rowB[j][2] + rowB[k][2]) / 4; + } + } + else if (datatype == GL_BYTE && comps == 2) { + GLuint i, j, k; + const GLbyte(*rowA)[2] = (const GLbyte(*)[2]) srcRowA; + const GLbyte(*rowB)[2] = (const GLbyte(*)[2]) srcRowB; + GLbyte(*dst)[2] = (GLbyte(*)[2]) dstRow; + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + dst[i][0] = (rowA[j][0] + rowA[k][0] + rowB[j][0] + rowB[k][0]) / 4; + dst[i][1] = (rowA[j][1] + rowA[k][1] + rowB[j][1] + rowB[k][1]) / 4; + } + } + else if (datatype == GL_BYTE && comps == 1) { + GLuint i, j, k; + const GLbyte *rowA = (const GLbyte *) srcRowA; + const GLbyte *rowB = (const GLbyte *) srcRowB; + GLbyte *dst = (GLbyte *) dstRow; + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + dst[i] = (rowA[j] + rowA[k] + rowB[j] + rowB[k]) / 4; + } + } + else if (datatype == GL_UNSIGNED_SHORT && comps == 4) { GLuint i, j, k; const GLushort(*rowA)[4] = (const GLushort(*)[4]) srcRowA; @@ -470,17 +532,6 @@ do_row(GLenum datatype, GLuint comps, GLint srcWidth, dst[i] = (blue << 5) | (green << 2) | red; } } - else if (datatype == GL_BYTE && comps == 2) { - GLuint i, j, k; - const GLbyte(*rowA)[2] = (const GLbyte(*)[2]) srcRowA; - const GLbyte(*rowB)[2] = (const GLbyte(*)[2]) srcRowB; - GLbyte(*dst)[2] = (GLbyte(*)[2]) dstRow; - for (i = j = 0, k = k0; i < (GLuint) dstWidth; - i++, j += colStride, k += colStride) { - dst[i][0] = (rowA[j][0] + rowA[k][0] + rowB[j][0] + rowB[k][0]) >> 2; - dst[i][1] = (rowA[j][1] + rowA[k][1] + rowB[j][1] + rowB[k][1]) >> 2; - } - } else { _mesa_problem(NULL, "bad format in do_row()"); } @@ -555,6 +606,44 @@ do_row_3D(GLenum datatype, GLuint comps, GLint srcWidth, FILTER_3D(0); } } + if ((datatype == GL_BYTE) && (comps == 4)) { + DECLARE_ROW_POINTERS(GLbyte, 4); + + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + FILTER_3D_SIGNED(0); + FILTER_3D_SIGNED(1); + FILTER_3D_SIGNED(2); + FILTER_3D_SIGNED(3); + } + } + else if ((datatype == GL_BYTE) && (comps == 3)) { + DECLARE_ROW_POINTERS(GLbyte, 3); + + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + FILTER_3D_SIGNED(0); + FILTER_3D_SIGNED(1); + FILTER_3D_SIGNED(2); + } + } + else if ((datatype == GL_BYTE) && (comps == 2)) { + DECLARE_ROW_POINTERS(GLbyte, 2); + + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + FILTER_3D_SIGNED(0); + FILTER_3D_SIGNED(1); + } + } + else if ((datatype == GL_BYTE) && (comps == 1)) { + DECLARE_ROW_POINTERS(GLbyte, 1); + + for (i = j = 0, k = k0; i < (GLuint) dstWidth; + i++, j += colStride, k += colStride) { + FILTER_3D_SIGNED(0); + } + } else if ((datatype == GL_UNSIGNED_SHORT) && (comps == 4)) { DECLARE_ROW_POINTERS(GLushort, 4); diff --git a/src/mesa/main/mtypes.h b/src/mesa/main/mtypes.h index 5293009454..a5d3be3543 100644 --- a/src/mesa/main/mtypes.h +++ b/src/mesa/main/mtypes.h @@ -2503,6 +2503,7 @@ struct gl_extensions GLboolean MESA_resize_buffers; GLboolean MESA_ycbcr_texture; GLboolean MESA_texture_array; + GLboolean MESA_texture_signed_rgba; GLboolean NV_blend_square; GLboolean NV_fragment_program; GLboolean NV_light_max_exponent; diff --git a/src/mesa/main/texformat.c b/src/mesa/main/texformat.c index c372b49398..0ceaaf3ece 100644 --- a/src/mesa/main/texformat.c +++ b/src/mesa/main/texformat.c @@ -699,9 +699,7 @@ const struct gl_texture_format _mesa_texformat_intensity_float16 = { const struct gl_texture_format _mesa_texformat_dudv8 = { MESA_FORMAT_DUDV8, /* MesaFormat */ GL_DUDV_ATI, /* BaseFormat */ - /* FIXME: spec doesn't say since that parameter didn't exist then, - but this should be something like SIGNED_NORMALIZED */ - GL_UNSIGNED_NORMALIZED_ARB, /* DataType */ + GL_SIGNED_NORMALIZED, /* DataType */ /* maybe should add dudvBits field, but spec seems to be lacking the ability to query with GetTexLevelParameter anyway */ 0, /* RedBits */ @@ -724,6 +722,30 @@ const struct gl_texture_format _mesa_texformat_dudv8 = { NULL /* StoreTexel */ }; +const struct gl_texture_format _mesa_texformat_signed_rgba8888 = { + MESA_FORMAT_SIGNED_RGBA8888, /* MesaFormat */ + GL_RGBA, /* BaseFormat */ + GL_SIGNED_NORMALIZED, /* DataType */ + 8, /* RedBits */ + 8, /* GreenBits */ + 8, /* BlueBits */ + 8, /* AlphaBits */ + 0, /* LuminanceBits */ + 0, /* IntensityBits */ + 0, /* IndexBits */ + 0, /* DepthBits */ + 0, /* StencilBits */ + 4, /* TexelBytes */ + _mesa_texstore_signed_rgba8888, /* StoreTexImageFunc */ + NULL, /* FetchTexel1D */ + NULL, /* FetchTexel2D */ + NULL, /* FetchTexel3D */ + fetch_texel_1d_signed_rgba8888, /* FetchTexel1Df */ + fetch_texel_2d_signed_rgba8888, /* FetchTexel2Df */ + fetch_texel_3d_signed_rgba8888, /* FetchTexel3Df */ + store_texel_signed_rgba8888 /* StoreTexel */ +}; + /*@}*/ @@ -1671,6 +1693,17 @@ _mesa_choose_tex_format( GLcontext *ctx, GLint internalFormat, } } + if (ctx->Extensions.MESA_texture_signed_rgba) { + switch (internalFormat) { + case GL_RGBA_SNORM: + case GL_RGBA8_SNORM: + return &_mesa_texformat_signed_rgba8888; + default: + ; /* fallthrough */ + } + } + + #if FEATURE_EXT_texture_sRGB if (ctx->Extensions.EXT_texture_sRGB) { switch (internalFormat) { @@ -1820,6 +1853,11 @@ _mesa_format_to_type_and_comps(const struct gl_texture_format *format, *comps = 2; return; + case MESA_FORMAT_SIGNED_RGBA8888: + *datatype = GL_BYTE; + *comps = 4; + return; + #if FEATURE_EXT_texture_sRGB case MESA_FORMAT_SRGB8: *datatype = GL_UNSIGNED_BYTE; diff --git a/src/mesa/main/texformat.h b/src/mesa/main/texformat.h index 7fa70ad4fe..3a08339adf 100644 --- a/src/mesa/main/texformat.h +++ b/src/mesa/main/texformat.h @@ -168,7 +168,8 @@ enum _format { * \name Signed fixed point texture formats. */ /*@{*/ - MESA_FORMAT_DUDV8 + MESA_FORMAT_DUDV8, + MESA_FORMAT_SIGNED_RGBA8888 /*@}*/ }; @@ -219,6 +220,7 @@ extern const struct gl_texture_format _mesa_texformat_intensity_float16; /** Signed fixed point texture formats */ /*@{*/ extern const struct gl_texture_format _mesa_texformat_dudv8; +extern const struct gl_texture_format _mesa_texformat_signed_rgba8888; /*@}*/ /** \name Assorted hardware-friendly formats */ diff --git a/src/mesa/main/texformat_tmp.h b/src/mesa/main/texformat_tmp.h index 0f6a172ef0..604b1a744c 100644 --- a/src/mesa/main/texformat_tmp.h +++ b/src/mesa/main/texformat_tmp.h @@ -1321,6 +1321,28 @@ static void FETCH(dudv8)(const struct gl_texture_image *texImage, texel[ACOMP] = 0; } +/* MESA_FORMAT_SIGNED_ARGB8888 ***********************************************/ + +static void FETCH(signed_rgba8888)( const struct gl_texture_image *texImage, + GLint i, GLint j, GLint k, GLfloat *texel ) +{ + const GLuint s = *TEXEL_ADDR(GLuint, texImage, i, j, k, 1); + texel[RCOMP] = BYTE_TO_FLOAT_TEX( (s >> 24) ); + texel[GCOMP] = BYTE_TO_FLOAT_TEX( (s >> 16) & 0xff ); + texel[BCOMP] = BYTE_TO_FLOAT_TEX( (s >> 8) & 0xff ); + texel[ACOMP] = BYTE_TO_FLOAT_TEX( (s ) & 0xff ); +} + +#if DIM == 3 +static void store_texel_signed_rgba8888(struct gl_texture_image *texImage, + GLint i, GLint j, GLint k, const void *texel) +{ + const GLbyte *rgba = (const GLbyte *) texel; + GLuint *dst = TEXEL_ADDR(GLuint, texImage, i, j, k, 1); + *dst = PACK_COLOR_8888(rgba[RCOMP], rgba[GCOMP], rgba[BCOMP], rgba[ACOMP]); +} +#endif + /* MESA_FORMAT_YCBCR *********************************************************/ diff --git a/src/mesa/main/teximage.c b/src/mesa/main/teximage.c index 4f297738df..8c03c36c75 100644 --- a/src/mesa/main/teximage.c +++ b/src/mesa/main/teximage.c @@ -349,6 +349,15 @@ _mesa_base_tex_format( GLcontext *ctx, GLint internalFormat ) } } + if (ctx->Extensions.MESA_texture_signed_rgba) { + switch (internalFormat) { + case GL_RGBA_SNORM: + case GL_RGBA8_SNORM: + return GL_RGBA; + default: + ; /* fallthrough */ + } + } if (ctx->Extensions.EXT_packed_depth_stencil) { switch (internalFormat) { @@ -502,6 +511,10 @@ _mesa_is_color_format(GLenum format) case GL_COMPRESSED_SLUMINANCE_ALPHA_EXT: #endif /* FEATURE_EXT_texture_sRGB */ return GL_TRUE; + /* signed texture formats */ + case GL_RGBA_SNORM: + case GL_RGBA8_SNORM: + return GL_TRUE; case GL_YCBCR_MESA: /* not considered to be RGB */ /* fall-through */ default: diff --git a/src/mesa/main/texstore.c b/src/mesa/main/texstore.c index cc3c6958c7..785fb50622 100644 --- a/src/mesa/main/texstore.c +++ b/src/mesa/main/texstore.c @@ -417,7 +417,7 @@ make_temp_float_image(GLcontext *ctx, GLuint dims, (GLfloat (*)[4]) src, logicalBaseFormat, GL_FLOAT, dst, &ctx->DefaultPacking, - postConvTransferOps); + postConvTransferOps, GL_FALSE); src += convWidth * 4; dst += convWidth * logComponents; } @@ -798,6 +798,7 @@ static const GLubyte * type_mapping( GLenum srcType ) { switch (srcType) { + case GL_BYTE: case GL_UNSIGNED_BYTE: return map_identity; case GL_UNSIGNED_INT_8_8_8_8: @@ -819,6 +820,7 @@ byteswap_mapping( GLboolean swapBytes, return map_identity; switch (srcType) { + case GL_BYTE: case GL_UNSIGNED_BYTE: return map_identity; case GL_UNSIGNED_INT_8_8_8_8: @@ -2561,6 +2563,99 @@ _mesa_texstore_dudv8(TEXSTORE_PARAMS) return GL_TRUE; } +/** + * Store a texture in MESA_FORMAT_RGBA8888 or MESA_FORMAT_RGBA8888_REV. + */ +GLboolean +_mesa_texstore_signed_rgba8888(TEXSTORE_PARAMS) +{ + const GLboolean littleEndian = _mesa_little_endian(); + + ASSERT(dstFormat == &_mesa_texformat_signed_rgba8888); + ASSERT(dstFormat->TexelBytes == 4); + + if (!ctx->_ImageTransferState && + !srcPacking->SwapBytes && + dstFormat == &_mesa_texformat_signed_rgba8888 && + baseInternalFormat == GL_RGBA && + ((srcFormat == GL_RGBA && srcType == GL_BYTE && !littleEndian) || + (srcFormat == GL_ABGR_EXT && srcType == GL_BYTE && littleEndian))) { + /* simple memcpy path */ + memcpy_texture(ctx, dims, + dstFormat, dstAddr, dstXoffset, dstYoffset, dstZoffset, + dstRowStride, + dstImageOffsets, + srcWidth, srcHeight, srcDepth, srcFormat, srcType, + srcAddr, srcPacking); + } + else if (!ctx->_ImageTransferState && + (srcType == GL_BYTE) && + can_swizzle(baseInternalFormat) && + can_swizzle(srcFormat)) { + + GLubyte dstmap[4]; + + /* dstmap - how to swizzle from RGBA to dst format: + */ + if (littleEndian && dstFormat == &_mesa_texformat_signed_rgba8888) { + dstmap[3] = 0; + dstmap[2] = 1; + dstmap[1] = 2; + dstmap[0] = 3; + } + else { + dstmap[3] = 3; + dstmap[2] = 2; + dstmap[1] = 1; + dstmap[0] = 0; + } + + _mesa_swizzle_ubyte_image(ctx, dims, + srcFormat, + srcType, + baseInternalFormat, + dstmap, 4, + dstAddr, dstXoffset, dstYoffset, dstZoffset, + dstRowStride, dstImageOffsets, + srcWidth, srcHeight, srcDepth, srcAddr, + srcPacking); + } + else { + /* general path */ + const GLfloat *tempImage = make_temp_float_image(ctx, dims, + baseInternalFormat, + dstFormat->BaseFormat, + srcWidth, srcHeight, srcDepth, + srcFormat, srcType, srcAddr, + srcPacking); + const GLfloat *srcRow = tempImage; + GLint img, row, col; + if (!tempImage) + return GL_FALSE; + _mesa_adjust_image_for_convolution(ctx, dims, &srcWidth, &srcHeight); + for (img = 0; img < srcDepth; img++) { + GLubyte *dstRow = (GLubyte *) dstAddr + + dstImageOffsets[dstZoffset + img] * dstFormat->TexelBytes + + dstYoffset * dstRowStride + + dstXoffset * dstFormat->TexelBytes; + for (row = 0; row < srcHeight; row++) { + GLuint *dstUI = (GLuint *) dstRow; + if (dstFormat == &_mesa_texformat_signed_rgba8888) { + for (col = 0; col < srcWidth; col++) { + dstUI[col] = PACK_COLOR_8888( FLOAT_TO_BYTE_TEX(srcRow[RCOMP]), + FLOAT_TO_BYTE_TEX(srcRow[GCOMP]), + FLOAT_TO_BYTE_TEX(srcRow[BCOMP]), + FLOAT_TO_BYTE_TEX(srcRow[ACOMP]) ); + srcRow += 4; + } + } + dstRow += dstRowStride; + } + } + _mesa_free((void *) tempImage); + } + return GL_TRUE; +} /** * Store a combined depth/stencil texture image. @@ -3820,6 +3915,21 @@ linear_to_nonlinear(GLfloat cl) #endif /* FEATURE_EXT_texture_sRGB */ +static INLINE GLboolean +type_with_negative_values(GLenum type) +{ + switch (type) { + case GL_BYTE: + case GL_SHORT: + case GL_INT: + case GL_FLOAT: + case GL_HALF_FLOAT_ARB: + return GL_TRUE; + default: + return GL_FALSE; + } +} + /** * This is the software fallback for Driver.GetTexImage(). * All error checking will have been done before this routine is called. @@ -3962,7 +4072,7 @@ _mesa_get_teximage(GLcontext *ctx, GLenum target, GLint level, } _mesa_pack_rgba_span_float(ctx, width, (GLfloat (*)[4]) rgba, format, type, dest, - &ctx->Pack, transferOps /*image xfer ops*/); + &ctx->Pack, transferOps, GL_TRUE); } #endif /* FEATURE_EXT_texture_sRGB */ else { @@ -3971,10 +4081,13 @@ _mesa_get_teximage(GLcontext *ctx, GLenum target, GLint level, GLint col; GLbitfield transferOps = 0x0; - if (type == GL_FLOAT && texImage->TexFormat->BaseFormat != GL_DUDV_ATI && - ((ctx->Color.ClampReadColor == GL_TRUE) || - (ctx->Color.ClampReadColor == GL_FIXED_ONLY_ARB && - texImage->TexFormat->DataType != GL_FLOAT))) + /* clamp does not apply to GetTexImage (final conversion)? + Looks like we need clamp though when going from format containing + negative values to unsigned format */ + + if (!type_with_negative_values(type) && + (texImage->TexFormat->DataType == GL_FLOAT || + texImage->TexFormat->DataType == GL_SIGNED_NORMALIZED)) transferOps |= IMAGE_CLAMP_BIT; for (col = 0; col < width; col++) { @@ -4001,7 +4114,7 @@ _mesa_get_teximage(GLcontext *ctx, GLenum target, GLint level, } _mesa_pack_rgba_span_float(ctx, width, (GLfloat (*)[4]) rgba, format, type, dest, - &ctx->Pack, transferOps /*image xfer ops*/); + &ctx->Pack, transferOps, GL_TRUE); } /* format */ } /* row */ } /* img */ diff --git a/src/mesa/main/texstore.h b/src/mesa/main/texstore.h index c9e639be4e..91cb64f377 100644 --- a/src/mesa/main/texstore.h +++ b/src/mesa/main/texstore.h @@ -79,6 +79,7 @@ extern GLboolean _mesa_texstore_sl8(TEXSTORE_PARAMS); extern GLboolean _mesa_texstore_sla8(TEXSTORE_PARAMS); #endif extern GLboolean _mesa_texstore_dudv8(TEXSTORE_PARAMS); +extern GLboolean _mesa_texstore_signed_rgba8888(TEXSTORE_PARAMS); extern GLchan * _mesa_make_temp_chan_image(GLcontext *ctx, GLuint dims, diff --git a/src/mesa/state_tracker/st_cb_readpixels.c b/src/mesa/state_tracker/st_cb_readpixels.c index ce7a8cda4e..c11973cdb3 100644 --- a/src/mesa/state_tracker/st_cb_readpixels.c +++ b/src/mesa/state_tracker/st_cb_readpixels.c @@ -486,7 +486,7 @@ st_readpixels(GLcontext *ctx, GLint x, GLint y, GLsizei width, GLsizei height, df += dfStride; if (!dfStride) { _mesa_pack_rgba_span_float(ctx, width, temp, format, type, dst, - &clippedPacking, transferOps); + &clippedPacking, transferOps, GL_FALSE); dst += dstStride; } } diff --git a/src/mesa/swrast/s_readpix.c b/src/mesa/swrast/s_readpix.c index e901fc6b5d..524ac4ee21 100644 --- a/src/mesa/swrast/s_readpix.c +++ b/src/mesa/swrast/s_readpix.c @@ -396,7 +396,7 @@ read_rgba_pixels( GLcontext *ctx, format, type, row, 0); _mesa_pack_rgba_span_float(ctx, width, (GLfloat (*)[4]) src, format, type, dest, packing, - transferOps & IMAGE_POST_CONVOLUTION_BITS); + transferOps & IMAGE_POST_CONVOLUTION_BITS, GL_FALSE); src += width * 4; } _mesa_free(convImage); @@ -441,7 +441,7 @@ read_rgba_pixels( GLcontext *ctx, /* pack the row of RGBA pixels into user's buffer */ _mesa_pack_rgba_span_float(ctx, width, rgba, format, type, dst, - packing, transferOps); + packing, transferOps, GL_FALSE); dst += dstStride; } -- cgit v1.2.3 From 439909a87d50723c2dba0ee1539467f1f4bf8bf0 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 7 Apr 2009 11:09:53 -0600 Subject: docs: document the MESA_GLSL env var, other misc GLSL updates --- docs/shading.html | 32 +++++++++++++++++++++++++++++--- 1 file changed, 29 insertions(+), 3 deletions(-) (limited to 'docs') diff --git a/docs/shading.html b/docs/shading.html index b77745fbf3..77c86be3aa 100644 --- a/docs/shading.html +++ b/docs/shading.html @@ -22,6 +22,7 @@ Last updated on 15 December 2008. Contents

          +
        • Environment variables
        • GLSL 1.20 support
        • Unsupported Features
        • Implementation Notes @@ -33,11 +34,32 @@ Contents + +

          Environment Variables

          + +

          +The MESA_GLSL environment variable can be set to a comma-separated +list of keywords to control some aspects of the GLSL compiler: +

          +
            +
          • dump - print GLSL shader code to stdout at link time +
          • log - log all GLSL shaders to files. + The filenames will be "shader_X.vert" or "shader_X.frag" where X + the shader ID. +
          • nopt - disable compiler optimizations +
          • opt - force compiler optimizations +
          • uniform - print message to stdout when glUniform is called +
          +

          +Example: export MESA_GLSL=dump,nopt +

          + +

          GLSL 1.20 support

          -GLSL version 1.20 is supported in Mesa 7.3. +GLSL version 1.20 is supported in Mesa 7.3 and later. Among the features/differences of GLSL 1.20 are:

          • mat2x3, mat2x4, etc. types and functions @@ -59,12 +81,14 @@ Among the features/differences of GLSL 1.20 are:

            Unsupported Features

            -The following features of the shading language are not yet supported +The following features of the shading language are not yet fully supported in Mesa:

              -
            • Linking of multiple shaders is not supported +
            • Linking of multiple shaders does not always work. Currently, linking + is implemented through shader concatenation and re-compiling. This + doesn't always work because of some #pragma and preprocessor issues.
            • gl_ClipVertex
            • The gl_Color and gl_SecondaryColor varying vars are interpolated without perspective correction @@ -177,6 +201,8 @@ This tool is useful for: After building Mesa, the glslcompiler can be built by manually running: 

              +    make realclean
+    make linux
     cd src/mesa/drivers/glslcompiler
     make
              -- cgit v1.2.3 From ce01de507563685d4cac4ec45b74e6214887ffc3 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 7 Apr 2009 18:23:21 -0600 Subject: docs: more info for 7.4 release notes --- docs/relnotes-7.5.html | 20 ++++++++++++++++++++ 1 file changed, 20 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index f29553b0fb..3c822da863 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -12,6 +12,13 @@

              Mesa 7.5 is a new development release. +People who are concerned with stability and reliability should stick +with the 7.4.x branch or wait for Mesa 7.6. +

              +

              +The main new feature of Mesa 7.5 is the +Gallium3D infrastructure.

              Mesa 7.5 implements the OpenGL 2.1 API, but the version reported by @@ -32,6 +39,17 @@ tbd

              New features

                +
              • Gallium - this is the new architecture for OS-independent and + API-independent 3D drivers. + Gallium3D is intended for GPUs that fully support vertex/fragment shaders. + The Gallium3D drivers currently included are: +
                  +
                • softpipe - a software/reference driver +
                • i915 - Intel 915/945 driver +
                • Cell - IBM/Sony/Toshiba Cell processor driver +
                • nouveau - preliminary driver for NVIDIA GPUs (still under development) +
                • r300 - preliminary driver for R300 (still under development) +
              • GL_ARB_framebuffer_object extension (software drivers, i965 driver)
              • Reworked two-sided stencil support. This allows a driver to support all three variations of two-sided stencil @@ -45,8 +63,10 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0

                Bug fixes

                  +
                • Lots of i965 driver bug fixes
                +

                Changes

                • Remove support for GL_SGIX_shadow, GL_SGIX_shadow_ambient and -- cgit v1.2.3 From f6b71d02c742063cff9ec6d636e326fd1493571a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 7 Apr 2009 18:26:08 -0600 Subject: docs: updated Cell driver info --- docs/cell.html | 11 +---------- 1 file changed, 1 insertion(+), 10 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index 49b62cac7b..ccf70cd715 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -14,16 +14,7 @@ The Mesa driver is part of the Gallium3D architecture. -

                  - -

                  -Tungsten Graphics -is leading the project. -Two phases are planned. -First, to implement the framework for parallel rasterization using the Cell -SPEs, including texture mapping. -Second, to implement a full-featured OpenGL driver with support for GLSL, etc. -The second phase is now underway. +Tungsten Graphics did the original implementation of the Cell driver.

                  -- cgit v1.2.3 From 9f784647ad60bb591a1dffa0baca27bf55480b3f Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 7 Apr 2009 18:26:45 -0600 Subject: docs: bump Gallium version number --- docs/cell.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index ccf70cd715..ada903cf8a 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -51,7 +51,7 @@ Mesa tree, then set LD_LIBRARY_PATH like this: Verify that the Cell driver is being used by running progs/xdemos/glxinfo and looking for: 
                  -  OpenGL renderer string: Gallium 0.2, Cell on Xlib
+  OpenGL renderer string: Gallium 0.3, Cell on Xlib
                  -- cgit v1.2.3 From a902b6ba48c8ff8bebda95e32310781d9a0763ce Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 16 Apr 2009 10:28:15 -0600 Subject: docs: separate compilation units in 7.5 --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 3c822da863..c75720b699 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -58,6 +58,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
                • GL_NV_texture_env_combine4 extension (software drivers, i965/i915 drivers)
                • GL_EXT_texture_swizzle extension (software drivers, i965 driver)
                • Updated SPARC assembly optimizations (David S. Miller) +
                • Initial support for separate compilation units in GLSL compiler.
                -- cgit v1.2.3 From c953f6620c617feceb79f42c56d08c6df0796f76 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Sat, 18 Apr 2009 13:16:35 -0600 Subject: docs: removed/added demo programs --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index c75720b699..bfeea3f433 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -72,6 +72,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
                • Remove support for GL_SGIX_shadow, GL_SGIX_shadow_ambient and GL_SGIX_depth_texture extensions. Superseded by the ARB versions. +
                • Omittd some old Mesa demos from the release tarballs, added some others.
                -- cgit v1.2.3 From 675b1cacf7e41310771791b15f3d44bd3eb9b70e Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 30 Apr 2009 17:11:20 -0600 Subject: docs: notes about new version number meaning in release notes --- docs/relnotes-7.5.html | 9 ++++++++- 1 file changed, 8 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index bfeea3f433..27c64b42b6 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -27,7 +27,14 @@ Some drivers don't support all the features required in OpenGL 2.1.

                See the Compiling/Installing page for prerequisites -for DRI ardware acceleration. +for DRI hardware acceleration. +

                +

                +Note that the Mesa project is no longer using odd/even version numbers +to indicate development/stable releases. +The so-called development releases have been fairly stable. +If you're especially concerned with stability you should probably look for +"point" releases such as 7.5.1 which will be a bug-fix release.

                -- cgit v1.2.3 From a405cc7b7226ac365f7e9f11bd803bf45dceb49a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 30 Apr 2009 17:13:22 -0600 Subject: docs: bring in 7.4 doc updates from mesa_7_4_branch --- docs/news.html | 14 +++++++++ docs/relnotes-7.4.1.html | 79 ++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes-7.4.html | 26 ++++++++++++++-- docs/relnotes.html | 1 + 4 files changed, 117 insertions(+), 3 deletions(-) create mode 100644 docs/relnotes-7.4.1.html (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index b177f3bca2..e032a6a494 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,20 @@

                News

                +

                April 18, 2009

                +

                +Mesa 7.4.1 is released. +This is a stable release fixing bugs since the 7.4 release. +

                + + +

                March 27, 2009

                +

                +Mesa 7.4 is released. +This is a stable release fixing bugs since the 7.3 release. +

                + +

                January 22, 2009

                Mesa 7.3 is released. diff --git a/docs/relnotes-7.4.1.html b/docs/relnotes-7.4.1.html new file mode 100644 index 0000000000..40f4fb1722 --- /dev/null +++ b/docs/relnotes-7.4.1.html @@ -0,0 +1,79 @@ + + +Mesa Release Notes + + + + + + + +

                Mesa 7.4.1 Release Notes / 18 April 2009

                + +

                +Mesa 7.4.1 is a stable development release fixing bugs since the 7.4 release. +

                +

                +Mesa 7.4.1 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

                +

                +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

                + + +

                MD5 checksums

                +
                +0c3a72f3295a53a134c04bd7d209ea62  MesaLib-7.4.1.tar.gz
+423260578b653818ba66c2fcbde6d7ad  MesaLib-7.4.1.tar.bz2
+84f78b154d4bd5c3ecc42eeff2e56676  MesaLib-7.4.1.zip
+aa0ad323e59d6d10ff33ac0dde462a60  MesaDemos-7.4.1.tar.gz
+1e169fb6abc2b45613f1c98a82dfe690  MesaDemos-7.4.1.tar.bz2
+294e42be2d74176596c994ec23322fcf  MesaDemos-7.4.1.zip
+92373bfa48e7b68dddf356e86b0e5699  MesaGLUT-7.4.1.tar.gz
+336f3824b578b072211e0beecf4f04f4  MesaGLUT-7.4.1.tar.bz2
+20751388d8ef16b42d25d9e3d705d101  MesaGLUT-7.4.1.zip
+
                + + +

                Bug fixes

                +
                  +
                • Fixed a two-sided lighting bug in fixed-function-to-GPU code generation +
                • Fixed some Darwin issues (Jeremy Huddleston) +
                • Indexing the GLSL gl_EyePlane[] or gl_ObjectPlane[] arrays with a variable + was broken, bug 20986 +
                • Fixed incorrect texture unit bias in TXB instruction +
                • glTexParameter settings weren't always propogated to drivers +
                • Assorted vertex/fragment program bug fixes +
                • Fixed point rendering in software rasterizer +
                • Fixed potential deadlock in object hash functions +
                • Fix a couple bugs surrounding front-buffer rendering with DRI2, but this + is not quite complete. +
                • Fixed glPopAttrib() bug when restoring user clip planes +
                + + + +

                Driver Status

                + +
                +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
                + + + diff --git a/docs/relnotes-7.4.html b/docs/relnotes-7.4.html index 60ada854c1..55ba019b22 100644 --- a/docs/relnotes-7.4.html +++ b/docs/relnotes-7.4.html @@ -8,7 +8,7 @@ -

                Mesa 7.4 Release Notes / date TBD

                +

                Mesa 7.4 Release Notes / 27 March 2009

                Mesa 7.4 is a stable development release fixing bugs since the 7.3 release. @@ -20,28 +20,48 @@ Some drivers don't support all the features required in OpenGL 2.1.

                See the Compiling/Installing page for prerequisites -for DRI ardware acceleration. +for DRI hardware acceleration.

                MD5 checksums

                -tbd
+ed6bd7437177307e51e16d0c7c381dfa  MesaLib-7.4.tar.gz
+7ecddb341a2691e0dfdb02f697109834  MesaLib-7.4.tar.bz2
+433e823f8245f9fd5f397e7b719a8e47  MesaLib-7.4.zip
+656eee6128016fb237e01aa8dabbc703  MesaDemos-7.4.tar.gz
+02816f10f30b1dc5e069e0f68c177c98  MesaDemos-7.4.tar.bz2
+44a70d6db4aa4c64ecc47871b6aceee8  MesaDemos-7.4.zip
+25f80db4f8645cd3e58e2c9af53ec341  MesaGLUT-7.4.tar.gz
+04ec01caebde44f5b0d619f00716b368  MesaGLUT-7.4.tar.bz2
+019dc213baecaa3cb1278847d41b8591  MesaGLUT-7.4.zip

                New features

                  +
                • Added MESA_GLX_FORCE_DIRECT env var for Xlib/software driver +
                • GLSL version 1.20 is returnd by the GL_SHADING_LANGUAGE_VERSION query

                Bug fixes

                  +
                • glGetActiveUniform() returned wrong size for some array types +
                • Fixed some error checking in glUniform() +
                • Fixed a potential glTexImage('proxy target') segfault +
                • Fixed bad reference counting for 1D/2D texture arrays +
                • Fixed VBO + glPush/PopClientAttrib() bug #19835
                • Assorted i965 driver bug fixes +
                • Fixed a Windows compilation failure in s_triangle.c +
                • Fixed a GLSL array indexing bug +
                • Fixes for building on Haiku

                Changes

                  +
                • Updated GL/glxext.h to version 48 +
                • Assorted updates for building on Solaris
                diff --git a/docs/relnotes.html b/docs/relnotes.html index c5ed109390..298352038c 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -21,6 +21,7 @@ The release notes summarize what's new or changed in each Mesa release.
                • 7.5 release notes +
                • 7.4.1 release notes
                • 7.4 release notes
                • 7.3 release notes
                • 7.2 release notes -- cgit v1.2.3 From e4e7ecc221fc1ed5714ac4c13e5cea204d37c6ad Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 30 Apr 2009 17:17:31 -0600 Subject: docs: asst. updates for 7.5 release --- docs/download.html | 6 ------ docs/news.html | 6 ++++++ docs/relnotes-7.5.html | 2 +- 3 files changed, 7 insertions(+), 7 deletions(-) (limited to 'docs') diff --git a/docs/download.html b/docs/download.html index 37b0b3da47..cf1cc21d37 100644 --- a/docs/download.html +++ b/docs/download.html @@ -8,12 +8,6 @@

                  Downloading

                  -

                  -Current development release: 7.3 -
                  -Last stable release: 7.2 -

                  -

                  Primary download site: News +

                  May tbd, 2009

                  +

                  +Mesa 7.5 is released. +

                  + +

                  April 18, 2009

                  Mesa 7.4.1 is released. diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 27c64b42b6..c10ccd7a5c 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -13,7 +13,7 @@

                  Mesa 7.5 is a new development release. People who are concerned with stability and reliability should stick -with the 7.4.x branch or wait for Mesa 7.6. +with the 7.4.x branch or wait for Mesa 7.5.1.

                  The main new feature of Mesa 7.5 is the -- cgit v1.2.3 From edd2bbe4a70fcb9f8e8365f19c1aba6deb4a272d Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 30 Apr 2009 17:27:51 -0600 Subject: docs: fix typo --- docs/relnotes-7.5.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index c10ccd7a5c..3de243d1b2 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -79,7 +79,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0

                  • Remove support for GL_SGIX_shadow, GL_SGIX_shadow_ambient and GL_SGIX_depth_texture extensions. Superseded by the ARB versions. -
                  • Omittd some old Mesa demos from the release tarballs, added some others. +
                  • Omitted some old Mesa demos from the release tarballs, added some others.
                  -- cgit v1.2.3 From 7ca04273387fb1af1b67d1359f2b0da4874a0e4c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 1 May 2009 09:24:19 -0600 Subject: docs: initial 7.6 release notes page --- docs/relnotes-7.6.html | 61 ++++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 62 insertions(+) create mode 100644 docs/relnotes-7.6.html (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html new file mode 100644 index 0000000000..77ce013d43 --- /dev/null +++ b/docs/relnotes-7.6.html @@ -0,0 +1,61 @@ + + +Mesa Release Notes + + + + + + + +

                  Mesa 7.6 Release Notes / date TBD

                  + +

                  +Mesa 7.6 is a new development release. +People who are concerned with stability and reliability should stick +with a previous release or wait for Mesa 7.6.1. +

                  +

                  +Mesa 7.6 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

                  +

                  +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

                  +

                  +Note that the Mesa project is no longer using odd/even version numbers +to indicate development/stable releases. +The so-called development releases have been fairly stable. +If you're especially concerned with stability you should probably look for +"point" releases such as 7.5.1 which will be a bug-fix release. +

                  + + +

                  MD5 checksums

                  +
                  +tbd
+
                  + + +

                  New features

                  +
                    +
                  • OpenVG front-end (state tracker for Gallium). +This was written by Zack Rusin at Tungsten Graphics. +
                  + + +

                  Bug fixes

                  +
                    +
                  • i965 DRI driver fixes, including support for "unlimited" size constant + buffers (GLSL uniforms) +
                  + + +

                  Changes

                  +
                    +
                  + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 298352038c..936f565236 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -20,6 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

                    +
                  • 7.6 release notes
                  • 7.5 release notes
                  • 7.4.1 release notes
                  • 7.4 release notes -- cgit v1.2.3 From 544dd4b11f7be76bb00fe29a60eaf2772dcc69ca Mon Sep 17 00:00:00 2001 From: Zack Rusin Date: Fri, 1 May 2009 12:41:38 -0400 Subject: OpenVG 1.0 State Tracker Import of the OpenVG 1.0 state tracker for Gallium. --- docs/openvg.html | 48 + include/VG/openvg.h | 686 ++++++++ include/VG/vgext.h | 233 +++ include/VG/vgplatform.h | 106 ++ include/VG/vgu.h | 130 ++ progs/openvg/demos/Makefile | 40 + progs/openvg/demos/gears.c | 394 +++++ progs/openvg/demos/lion-render.c | 1573 ++++++++++++++++++ progs/openvg/demos/lion-render.h | 16 + progs/openvg/demos/lion.c | 288 ++++ progs/openvg/demos/sp.c | 103 ++ progs/openvg/trivial/Makefile | 127 ++ progs/openvg/trivial/arc.c | 139 ++ progs/openvg/trivial/cap.c | 75 + progs/openvg/trivial/clear.c | 42 + progs/openvg/trivial/coord.c | 66 + progs/openvg/trivial/dash.c | 95 ++ progs/openvg/trivial/eglcommon.c | 288 ++++ progs/openvg/trivial/eglcommon.h | 20 + progs/openvg/trivial/ellipse.c | 84 + progs/openvg/trivial/filter.c | 107 ++ progs/openvg/trivial/gradorigin.c | 98 ++ progs/openvg/trivial/lineto.c | 56 + progs/openvg/trivial/lingrad.c | 87 + progs/openvg/trivial/lookup.c | 71 + progs/openvg/trivial/mask.c | 58 + progs/openvg/trivial/mask4.c | 132 ++ progs/openvg/trivial/path3.c | 77 + progs/openvg/trivial/radialgrad.c | 99 ++ progs/openvg/trivial/readpixels.c | 75 + progs/openvg/trivial/roundedrect.c | 67 + progs/openvg/trivial/star-nonzero.c | 55 + progs/openvg/trivial/star-oddeven.c | 102 ++ progs/openvg/trivial/stroke.c | 116 ++ progs/openvg/trivial/stroke2.c | 207 +++ progs/openvg/trivial/vguarc.c | 74 + src/gallium/state_trackers/vega/Makefile | 128 ++ src/gallium/state_trackers/vega/api_consts.h | 56 + src/gallium/state_trackers/vega/api_context.c | 75 + src/gallium/state_trackers/vega/api_filters.c | 805 +++++++++ src/gallium/state_trackers/vega/api_images.c | 489 ++++++ src/gallium/state_trackers/vega/api_masks.c | 373 +++++ src/gallium/state_trackers/vega/api_misc.c | 83 + src/gallium/state_trackers/vega/api_paint.c | 166 ++ src/gallium/state_trackers/vega/api_params.c | 1673 +++++++++++++++++++ src/gallium/state_trackers/vega/api_path.c | 488 ++++++ src/gallium/state_trackers/vega/api_text.c | 258 +++ src/gallium/state_trackers/vega/api_transform.c | 128 ++ src/gallium/state_trackers/vega/arc.c | 708 ++++++++ src/gallium/state_trackers/vega/arc.h | 80 + src/gallium/state_trackers/vega/asm_fill.h | 246 +++ src/gallium/state_trackers/vega/asm_filters.h | 117 ++ src/gallium/state_trackers/vega/asm_util.h | 136 ++ src/gallium/state_trackers/vega/bezier.c | 704 ++++++++ src/gallium/state_trackers/vega/bezier.h | 81 + src/gallium/state_trackers/vega/image.c | 654 ++++++++ src/gallium/state_trackers/vega/image.h | 104 ++ src/gallium/state_trackers/vega/mask.c | 690 ++++++++ src/gallium/state_trackers/vega/mask.h | 68 + src/gallium/state_trackers/vega/matrix.h | 462 +++++ src/gallium/state_trackers/vega/paint.c | 699 ++++++++ src/gallium/state_trackers/vega/paint.h | 118 ++ src/gallium/state_trackers/vega/path.c | 2034 +++++++++++++++++++++++ src/gallium/state_trackers/vega/path.h | 126 ++ src/gallium/state_trackers/vega/path_utils.h | 109 ++ src/gallium/state_trackers/vega/polygon.c | 550 ++++++ src/gallium/state_trackers/vega/polygon.h | 75 + src/gallium/state_trackers/vega/renderer.c | 592 +++++++ src/gallium/state_trackers/vega/renderer.h | 76 + src/gallium/state_trackers/vega/shader.c | 310 ++++ src/gallium/state_trackers/vega/shader.h | 56 + src/gallium/state_trackers/vega/shaders_cache.c | 439 +++++ src/gallium/state_trackers/vega/shaders_cache.h | 77 + src/gallium/state_trackers/vega/st_inlines.h | 159 ++ src/gallium/state_trackers/vega/stroker.c | 1349 +++++++++++++++ src/gallium/state_trackers/vega/stroker.h | 89 + src/gallium/state_trackers/vega/util_array.h | 122 ++ src/gallium/state_trackers/vega/vg_context.c | 543 ++++++ src/gallium/state_trackers/vega/vg_context.h | 292 ++++ src/gallium/state_trackers/vega/vg_state.c | 124 ++ src/gallium/state_trackers/vega/vg_state.h | 109 ++ src/gallium/state_trackers/vega/vg_tracker.c | 406 +++++ src/gallium/state_trackers/vega/vg_tracker.h | 102 ++ src/gallium/state_trackers/vega/vg_translate.c | 1030 ++++++++++++ src/gallium/state_trackers/vega/vg_translate.h | 49 + src/gallium/state_trackers/vega/vgu.c | 450 +++++ 86 files changed, 24891 insertions(+) create mode 100644 docs/openvg.html create mode 100644 include/VG/openvg.h create mode 100644 include/VG/vgext.h create mode 100644 include/VG/vgplatform.h create mode 100644 include/VG/vgu.h create mode 100644 progs/openvg/demos/Makefile create mode 100644 progs/openvg/demos/gears.c create mode 100644 progs/openvg/demos/lion-render.c create mode 100644 progs/openvg/demos/lion-render.h create mode 100644 progs/openvg/demos/lion.c create mode 100644 progs/openvg/demos/sp.c create mode 100644 progs/openvg/trivial/Makefile create mode 100644 progs/openvg/trivial/arc.c create mode 100644 progs/openvg/trivial/cap.c create mode 100644 progs/openvg/trivial/clear.c create mode 100644 progs/openvg/trivial/coord.c create mode 100644 progs/openvg/trivial/dash.c create mode 100644 progs/openvg/trivial/eglcommon.c create mode 100644 progs/openvg/trivial/eglcommon.h create mode 100644 progs/openvg/trivial/ellipse.c create mode 100644 progs/openvg/trivial/filter.c create mode 100644 progs/openvg/trivial/gradorigin.c create mode 100644 progs/openvg/trivial/lineto.c create mode 100644 progs/openvg/trivial/lingrad.c create mode 100644 progs/openvg/trivial/lookup.c create mode 100644 progs/openvg/trivial/mask.c create mode 100644 progs/openvg/trivial/mask4.c create mode 100644 progs/openvg/trivial/path3.c create mode 100644 progs/openvg/trivial/radialgrad.c create mode 100644 progs/openvg/trivial/readpixels.c create mode 100644 progs/openvg/trivial/roundedrect.c create mode 100644 progs/openvg/trivial/star-nonzero.c create mode 100644 progs/openvg/trivial/star-oddeven.c create mode 100644 progs/openvg/trivial/stroke.c create mode 100644 progs/openvg/trivial/stroke2.c create mode 100644 progs/openvg/trivial/vguarc.c create mode 100644 src/gallium/state_trackers/vega/Makefile create mode 100644 src/gallium/state_trackers/vega/api_consts.h create mode 100644 src/gallium/state_trackers/vega/api_context.c create mode 100644 src/gallium/state_trackers/vega/api_filters.c create mode 100644 src/gallium/state_trackers/vega/api_images.c create mode 100644 src/gallium/state_trackers/vega/api_masks.c create mode 100644 src/gallium/state_trackers/vega/api_misc.c create mode 100644 src/gallium/state_trackers/vega/api_paint.c create mode 100644 src/gallium/state_trackers/vega/api_params.c create mode 100644 src/gallium/state_trackers/vega/api_path.c create mode 100644 src/gallium/state_trackers/vega/api_text.c create mode 100644 src/gallium/state_trackers/vega/api_transform.c create mode 100644 src/gallium/state_trackers/vega/arc.c create mode 100644 src/gallium/state_trackers/vega/arc.h create mode 100644 src/gallium/state_trackers/vega/asm_fill.h create mode 100644 src/gallium/state_trackers/vega/asm_filters.h create mode 100644 src/gallium/state_trackers/vega/asm_util.h create mode 100644 src/gallium/state_trackers/vega/bezier.c create mode 100644 src/gallium/state_trackers/vega/bezier.h create mode 100644 src/gallium/state_trackers/vega/image.c create mode 100644 src/gallium/state_trackers/vega/image.h create mode 100644 src/gallium/state_trackers/vega/mask.c create mode 100644 src/gallium/state_trackers/vega/mask.h create mode 100644 src/gallium/state_trackers/vega/matrix.h create mode 100644 src/gallium/state_trackers/vega/paint.c create mode 100644 src/gallium/state_trackers/vega/paint.h create mode 100644 src/gallium/state_trackers/vega/path.c create mode 100644 src/gallium/state_trackers/vega/path.h create mode 100644 src/gallium/state_trackers/vega/path_utils.h create mode 100644 src/gallium/state_trackers/vega/polygon.c create mode 100644 src/gallium/state_trackers/vega/polygon.h create mode 100644 src/gallium/state_trackers/vega/renderer.c create mode 100644 src/gallium/state_trackers/vega/renderer.h create mode 100644 src/gallium/state_trackers/vega/shader.c create mode 100644 src/gallium/state_trackers/vega/shader.h create mode 100644 src/gallium/state_trackers/vega/shaders_cache.c create mode 100644 src/gallium/state_trackers/vega/shaders_cache.h create mode 100644 src/gallium/state_trackers/vega/st_inlines.h create mode 100644 src/gallium/state_trackers/vega/stroker.c create mode 100644 src/gallium/state_trackers/vega/stroker.h create mode 100644 src/gallium/state_trackers/vega/util_array.h create mode 100644 src/gallium/state_trackers/vega/vg_context.c create mode 100644 src/gallium/state_trackers/vega/vg_context.h create mode 100644 src/gallium/state_trackers/vega/vg_state.c create mode 100644 src/gallium/state_trackers/vega/vg_state.h create mode 100644 src/gallium/state_trackers/vega/vg_tracker.c create mode 100644 src/gallium/state_trackers/vega/vg_tracker.h create mode 100644 src/gallium/state_trackers/vega/vg_translate.c create mode 100644 src/gallium/state_trackers/vega/vg_translate.h create mode 100644 src/gallium/state_trackers/vega/vgu.c (limited to 'docs') diff --git a/docs/openvg.html b/docs/openvg.html new file mode 100644 index 0000000000..a8153b9db9 --- /dev/null +++ b/docs/openvg.html @@ -0,0 +1,48 @@ + + +Mesa Release Notes + + + + + + + +

                    OpenVG State Tracker

                    + +

                    +The current version of the OpenVG state tracker implements OpenVG 1.0. +

                    +

                    +More informations about OpenVG can be found at http://www.khronos.org/openvg/ . +

                    +

                    +The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation. +

                    + + +

                    Building the library

                    +
                      +
                    1. Build Mesa3D with Gallium3D. Any build that builds Gallium3D libraries and EGL will suffice
                      2. +
                    2. cd src/gallium/state_trackers/vega; make
                      3. +
                    3. The last step will build libOpenVG library. You can add the libdir to LD_LIBRARY_PATH or install libOpenVG
                      4. +
                    + +

                    Sample build

                    +A sample build looks as follows: +
                    +make linux-x86-64-debug
+cd src/gallium/state_trackers/vega
+make
+cd ../../../..
+export LD_LIBRARY_PATH=$PWD/lib64
+export EGL_DRIVER="egl_softpipe"
+
                    + +

                    Notes

                    +
                      +
                    • EGL_DRIVER environmental variable: forces usage of a specific EGL driver. Unless you force egl_softpipe the implementation will look for a DRI hardware accelerate driver and unless you have a Gallium driver that supports it, you'll see crashes
                      • +
                    + + + diff --git a/include/VG/openvg.h b/include/VG/openvg.h new file mode 100644 index 0000000000..60167e45d6 --- /dev/null +++ b/include/VG/openvg.h @@ -0,0 +1,686 @@ +/* $Revision: 6822 $ on $Date:: 2008-10-30 05:14:19 -0400 #$ */ + +/*------------------------------------------------------------------------ + * + * OpenVG 1.0.1 Reference Implementation + * ------------------------------------- + * + * Copyright (c) 2008 The Khronos Group Inc. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and /or associated documentation files + * (the "Materials "), to deal in the Materials without restriction, + * including without limitation the rights to use, copy, modify, merge, + * publish, distribute, sublicense, and/or sell copies of the Materials, + * and to permit persons to whom the Materials are furnished to do so, + * subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Materials. + * + * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR + * THE USE OR OTHER DEALINGS IN THE MATERIALS. + * + *//** + * \file + * \brief OpenVG 1.0.1 API. + *//*-------------------------------------------------------------------*/ + +#ifndef _OPENVG_H +#define _OPENVG_H + +#include + +#ifdef __cplusplus +extern "C" { +#endif + +#define OPENVG_VERSION_1_0 1 +#define OPENVG_VERSION_1_0_1 1 + +#ifndef VG_MAXSHORT +#define VG_MAXSHORT 0x7FFF +#endif + +#ifndef VG_MAXINT +#define VG_MAXINT 0x7FFFFFFF +#endif + +#ifndef VG_MAX_ENUM +#define VG_MAX_ENUM 0x7FFFFFFF +#endif + +typedef long VGHandle; + +typedef VGHandle VGPath; +typedef VGHandle VGImage; +typedef VGHandle VGPaint; + +#define VG_INVALID_HANDLE ((VGHandle)0) + +typedef enum { + VG_FALSE = 0, + VG_TRUE = 1, + + VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM +} VGboolean; + +typedef enum { + VG_NO_ERROR = 0, + VG_BAD_HANDLE_ERROR = 0x1000, + VG_ILLEGAL_ARGUMENT_ERROR = 0x1001, + VG_OUT_OF_MEMORY_ERROR = 0x1002, + VG_PATH_CAPABILITY_ERROR = 0x1003, + VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004, + VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005, + VG_IMAGE_IN_USE_ERROR = 0x1006, + VG_NO_CONTEXT_ERROR = 0x1007, + + VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM +} VGErrorCode; + +typedef enum { + /* Mode settings */ + VG_MATRIX_MODE = 0x1100, + VG_FILL_RULE = 0x1101, + VG_IMAGE_QUALITY = 0x1102, + VG_RENDERING_QUALITY = 0x1103, + VG_BLEND_MODE = 0x1104, + VG_IMAGE_MODE = 0x1105, + + /* Scissoring rectangles */ + VG_SCISSOR_RECTS = 0x1106, + + /* Stroke parameters */ + VG_STROKE_LINE_WIDTH = 0x1110, + VG_STROKE_CAP_STYLE = 0x1111, + VG_STROKE_JOIN_STYLE = 0x1112, + VG_STROKE_MITER_LIMIT = 0x1113, + VG_STROKE_DASH_PATTERN = 0x1114, + VG_STROKE_DASH_PHASE = 0x1115, + VG_STROKE_DASH_PHASE_RESET = 0x1116, + + /* Edge fill color for VG_TILE_FILL tiling mode */ + VG_TILE_FILL_COLOR = 0x1120, + + /* Color for vgClear */ + VG_CLEAR_COLOR = 0x1121, + + /* Enable/disable alpha masking and scissoring */ + VG_MASKING = 0x1130, + VG_SCISSORING = 0x1131, + + /* Pixel layout information */ + VG_PIXEL_LAYOUT = 0x1140, + VG_SCREEN_LAYOUT = 0x1141, + + /* Source format selection for image filters */ + VG_FILTER_FORMAT_LINEAR = 0x1150, + VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151, + + /* Destination write enable mask for image filters */ + VG_FILTER_CHANNEL_MASK = 0x1152, + + /* Implementation limits (read-only) */ + VG_MAX_SCISSOR_RECTS = 0x1160, + VG_MAX_DASH_COUNT = 0x1161, + VG_MAX_KERNEL_SIZE = 0x1162, + VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163, + VG_MAX_COLOR_RAMP_STOPS = 0x1164, + VG_MAX_IMAGE_WIDTH = 0x1165, + VG_MAX_IMAGE_HEIGHT = 0x1166, + VG_MAX_IMAGE_PIXELS = 0x1167, + VG_MAX_IMAGE_BYTES = 0x1168, + VG_MAX_FLOAT = 0x1169, + VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A, + + VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGParamType; + +typedef enum { + VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200, + VG_RENDERING_QUALITY_FASTER = 0x1201, + VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */ + + VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM +} VGRenderingQuality; + +typedef enum { + VG_PIXEL_LAYOUT_UNKNOWN = 0x1300, + VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301, + VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302, + VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303, + VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304, + + VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM +} VGPixelLayout; + +typedef enum { + VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400, + VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401, + VG_MATRIX_FILL_PAINT_TO_USER = 0x1402, + VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403, + + VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGMatrixMode; + +typedef enum { + VG_CLEAR_MASK = 0x1500, + VG_FILL_MASK = 0x1501, + VG_SET_MASK = 0x1502, + VG_UNION_MASK = 0x1503, + VG_INTERSECT_MASK = 0x1504, + VG_SUBTRACT_MASK = 0x1505, + + VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM +} VGMaskOperation; + +#define VG_PATH_FORMAT_STANDARD 0 + +typedef enum { + VG_PATH_DATATYPE_S_8 = 0, + VG_PATH_DATATYPE_S_16 = 1, + VG_PATH_DATATYPE_S_32 = 2, + VG_PATH_DATATYPE_F = 3, + + VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPathDatatype; + +typedef enum { + VG_ABSOLUTE = 0, + VG_RELATIVE = 1, + + VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM +} VGPathAbsRel; + +typedef enum { + VG_CLOSE_PATH = ( 0 << 1), + VG_MOVE_TO = ( 1 << 1), + VG_LINE_TO = ( 2 << 1), + VG_HLINE_TO = ( 3 << 1), + VG_VLINE_TO = ( 4 << 1), + VG_QUAD_TO = ( 5 << 1), + VG_CUBIC_TO = ( 6 << 1), + VG_SQUAD_TO = ( 7 << 1), + VG_SCUBIC_TO = ( 8 << 1), + VG_SCCWARC_TO = ( 9 << 1), + VG_SCWARC_TO = (10 << 1), + VG_LCCWARC_TO = (11 << 1), + VG_LCWARC_TO = (12 << 1), + + VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM +} VGPathSegment; + +typedef enum { + VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE, + VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE, + VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE, + VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE, + VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE, + VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE, + VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE, + VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE, + VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE, + VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE, + VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE, + VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE, + VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE, + VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE, + VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE, + VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE, + VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE, + VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE, + VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE, + VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE, + VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE, + VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE, + VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE, + VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE, + + VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM +} VGPathCommand; + +typedef enum { + VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0), + VG_PATH_CAPABILITY_APPEND_TO = (1 << 1), + VG_PATH_CAPABILITY_MODIFY = (1 << 2), + VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3), + VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4), + VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5), + VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6), + VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7), + VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8), + VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9), + VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10), + VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11), + VG_PATH_CAPABILITY_ALL = (1 << 12) - 1, + + VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM +} VGPathCapabilities; + +typedef enum { + VG_PATH_FORMAT = 0x1600, + VG_PATH_DATATYPE = 0x1601, + VG_PATH_SCALE = 0x1602, + VG_PATH_BIAS = 0x1603, + VG_PATH_NUM_SEGMENTS = 0x1604, + VG_PATH_NUM_COORDS = 0x1605, + + VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPathParamType; + +typedef enum { + VG_CAP_BUTT = 0x1700, + VG_CAP_ROUND = 0x1701, + VG_CAP_SQUARE = 0x1702, + + VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM +} VGCapStyle; + +typedef enum { + VG_JOIN_MITER = 0x1800, + VG_JOIN_ROUND = 0x1801, + VG_JOIN_BEVEL = 0x1802, + + VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM +} VGJoinStyle; + +typedef enum { + VG_EVEN_ODD = 0x1900, + VG_NON_ZERO = 0x1901, + + VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM +} VGFillRule; + +typedef enum { + VG_STROKE_PATH = (1 << 0), + VG_FILL_PATH = (1 << 1), + + VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintMode; + +typedef enum { + /* Color paint parameters */ + VG_PAINT_TYPE = 0x1A00, + VG_PAINT_COLOR = 0x1A01, + VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02, + VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07, + VG_PAINT_COLOR_RAMP_STOPS = 0x1A03, + + /* Linear gradient paint parameters */ + VG_PAINT_LINEAR_GRADIENT = 0x1A04, + + /* Radial gradient paint parameters */ + VG_PAINT_RADIAL_GRADIENT = 0x1A05, + + /* Pattern paint parameters */ + VG_PAINT_PATTERN_TILING_MODE = 0x1A06, + + VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintParamType; + +typedef enum { + VG_PAINT_TYPE_COLOR = 0x1B00, + VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01, + VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02, + VG_PAINT_TYPE_PATTERN = 0x1B03, + + VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintType; + +typedef enum { + VG_COLOR_RAMP_SPREAD_PAD = 0x1C00, + VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01, + VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02, + + VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGColorRampSpreadMode; + +typedef enum { + VG_TILE_FILL = 0x1D00, + VG_TILE_PAD = 0x1D01, + VG_TILE_REPEAT = 0x1D02, + VG_TILE_REFLECT = 0x1D03, + + VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGTilingMode; + +typedef enum { + /* RGB{A,X} channel ordering */ + VG_sRGBX_8888 = 0, + VG_sRGBA_8888 = 1, + VG_sRGBA_8888_PRE = 2, + VG_sRGB_565 = 3, + VG_sRGBA_5551 = 4, + VG_sRGBA_4444 = 5, + VG_sL_8 = 6, + VG_lRGBX_8888 = 7, + VG_lRGBA_8888 = 8, + VG_lRGBA_8888_PRE = 9, + VG_lL_8 = 10, + VG_A_8 = 11, + VG_BW_1 = 12, + + /* {A,X}RGB channel ordering */ + VG_sXRGB_8888 = 0 | (1 << 6), + VG_sARGB_8888 = 1 | (1 << 6), + VG_sARGB_8888_PRE = 2 | (1 << 6), + VG_sARGB_1555 = 4 | (1 << 6), + VG_sARGB_4444 = 5 | (1 << 6), + VG_lXRGB_8888 = 7 | (1 << 6), + VG_lARGB_8888 = 8 | (1 << 6), + VG_lARGB_8888_PRE = 9 | (1 << 6), + + /* BGR{A,X} channel ordering */ + VG_sBGRX_8888 = 0 | (1 << 7), + VG_sBGRA_8888 = 1 | (1 << 7), + VG_sBGRA_8888_PRE = 2 | (1 << 7), + VG_sBGR_565 = 3 | (1 << 7), + VG_sBGRA_5551 = 4 | (1 << 7), + VG_sBGRA_4444 = 5 | (1 << 7), + VG_lBGRX_8888 = 7 | (1 << 7), + VG_lBGRA_8888 = 8 | (1 << 7), + VG_lBGRA_8888_PRE = 9 | (1 << 7), + + /* {A,X}BGR channel ordering */ + VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7), + VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7), + VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7), + VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7), + VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7), + VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7), + VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7), + VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7), + + VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM +} VGImageFormat; + +typedef enum { + VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0), + VG_IMAGE_QUALITY_FASTER = (1 << 1), + VG_IMAGE_QUALITY_BETTER = (1 << 2), + + VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM +} VGImageQuality; + +typedef enum { + VG_IMAGE_FORMAT = 0x1E00, + VG_IMAGE_WIDTH = 0x1E01, + VG_IMAGE_HEIGHT = 0x1E02, + + VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGImageParamType; + +typedef enum { + VG_DRAW_IMAGE_NORMAL = 0x1F00, + VG_DRAW_IMAGE_MULTIPLY = 0x1F01, + VG_DRAW_IMAGE_STENCIL = 0x1F02, + + VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGImageMode; + +typedef enum { + VG_RED = (1 << 3), + VG_GREEN = (1 << 2), + VG_BLUE = (1 << 1), + VG_ALPHA = (1 << 0), + + VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM +} VGImageChannel; + +typedef enum { + VG_BLEND_SRC = 0x2000, + VG_BLEND_SRC_OVER = 0x2001, + VG_BLEND_DST_OVER = 0x2002, + VG_BLEND_SRC_IN = 0x2003, + VG_BLEND_DST_IN = 0x2004, + VG_BLEND_MULTIPLY = 0x2005, + VG_BLEND_SCREEN = 0x2006, + VG_BLEND_DARKEN = 0x2007, + VG_BLEND_LIGHTEN = 0x2008, + VG_BLEND_ADDITIVE = 0x2009, + + VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGBlendMode; + +typedef enum { + VG_IMAGE_FORMAT_QUERY = 0x2100, + VG_PATH_DATATYPE_QUERY = 0x2101, + + VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGHardwareQueryType; + +typedef enum { + VG_HARDWARE_ACCELERATED = 0x2200, + VG_HARDWARE_UNACCELERATED = 0x2201, + + VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM +} VGHardwareQueryResult; + +typedef enum { + VG_VENDOR = 0x2300, + VG_RENDERER = 0x2301, + VG_VERSION = 0x2302, + VG_EXTENSIONS = 0x2303, + + VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM +} VGStringID; + +/* Function Prototypes */ + +#ifndef VG_API_CALL +# error VG_API_CALL must be defined +#endif + +#ifndef VG_API_ENTRY +# error VG_API_ENTRY must be defined +#endif + +#ifndef VG_API_EXIT +# error VG_API_EXIT must be defined +#endif + +VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT; + +VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT; + +/* Getters and Setters */ +VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count, + const VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count, + const VGint * values) VG_API_EXIT; + +VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT; + +VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object, + VGint paramType, + VGfloat value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object, + VGint paramType, + VGint value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object, + VGint paramType, + VGint count, const VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object, + VGint paramType, + VGint count, const VGint * values) VG_API_EXIT; + +VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object, + VGint paramType) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object, + VGint paramType); +VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object, + VGint paramType) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object, + VGint paramType, + VGint count, VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object, + VGint paramType, + VGint count, VGint * values) VG_API_EXIT; + +/* Matrix Manipulation */ +VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT; + +/* Masking and Clearing */ +VG_API_CALL void VG_API_ENTRY vgMask(VGImage mask, VGMaskOperation operation, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; + +/* Paths */ +VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat, + VGPathDatatype datatype, + VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path, + VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex, + VGint numSegments, + const void * pathData) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT; +VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath, + VGPath startPath, + VGPath endPath, + VGfloat amount) VG_API_EXIT; +VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path, + VGint startSegment, VGint numSegments) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path, + VGint startSegment, VGint numSegments, + VGfloat distance, + VGfloat * x, VGfloat * y, + VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path, + VGfloat * minX, VGfloat * minY, + VGfloat * width, VGfloat * height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path, + VGfloat * minX, VGfloat * minY, + VGfloat * width, VGfloat * height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT; + +/* Paint */ +VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT; +VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT; +VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT; + +/* Images */ +VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format, + VGint width, VGint height, + VGbitfield allowedQuality) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image, + const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image, + void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint dx, VGint dy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; + +/* Image Filters */ +VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src, + const VGfloat * matrix) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src, + VGint kernelWidth, VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernel, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src, + VGint kernelWidth, + VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernelX, + const VGshort * kernelY, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src, + VGfloat stdDeviationX, + VGfloat stdDeviationY, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src, + const VGubyte * redLUT, + const VGubyte * greenLUT, + const VGubyte * blueLUT, + const VGubyte * alphaLUT, + VGboolean outputLinear, + VGboolean outputPremultiplied) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src, + const VGuint * lookupTable, + VGImageChannel sourceChannel, + VGboolean outputLinear, + VGboolean outputPremultiplied) VG_API_EXIT; + +/* Hardware Queries */ +VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key, + VGint setting) VG_API_EXIT; + +/* Renderer and Extension Information */ +VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT; + +#ifdef __cplusplus +} /* extern "C" */ +#endif + +#endif /* _OPENVG_H */ diff --git a/include/VG/vgext.h b/include/VG/vgext.h new file mode 100644 index 0000000000..97e3e779e1 --- /dev/null +++ b/include/VG/vgext.h @@ -0,0 +1,233 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */ + +/*------------------------------------------------------------------------ + * + * VG extensions Reference Implementation + * ------------------------------------- + * + * Copyright (c) 2008 The Khronos Group Inc. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and /or associated documentation files + * (the "Materials "), to deal in the Materials without restriction, + * including without limitation the rights to use, copy, modify, merge, + * publish, distribute, sublicense, and/or sell copies of the Materials, + * and to permit persons to whom the Materials are furnished to do so, + * subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Materials. + * + * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR + * THE USE OR OTHER DEALINGS IN THE MATERIALS. + * + *//** + * \file + * \brief VG extensions + *//*-------------------------------------------------------------------*/ + + + +#ifndef _VGEXT_H +#define _VGEXT_H + +#ifdef __cplusplus +extern "C" { +#endif + +#include +#include + +#ifndef VG_API_ENTRYP +# define VG_API_ENTRYP VG_API_ENTRY* +#endif + +#ifndef VGU_API_ENTRYP +# define VGU_API_ENTRYP VGU_API_ENTRY* +#endif + +/*------------------------------------------------------------------------------- + * KHR extensions + *------------------------------------------------------------------------------*/ + +typedef enum { + +#ifndef VG_KHR_iterative_average_blur + VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B, + VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C, + VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D, +#endif + + VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM +} VGParamTypeKHR; + +#ifndef VG_KHR_EGL_image +#define VG_KHR_EGL_image 1 +/* VGEGLImageKHR is an opaque handle to an EGLImage */ +typedef void* VGeglImageKHR; + +#ifdef VG_VGEXT_PROTOTYPES +VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image); +#endif +typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image); + +#endif + + +#ifndef VG_KHR_iterative_average_blur +#define VG_KHR_iterative_average_blur 1 + +#ifdef VG_VGEXT_PROTOTYPES +VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode); +#endif +typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode); + +#endif + + +#ifndef VG_KHR_advanced_blending +#define VG_KHR_advanced_blending 1 + +typedef enum { + VG_BLEND_OVERLAY_KHR = 0x2010, + VG_BLEND_HARDLIGHT_KHR = 0x2011, + VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012, + VG_BLEND_SOFTLIGHT_KHR = 0x2013, + VG_BLEND_COLORDODGE_KHR = 0x2014, + VG_BLEND_COLORBURN_KHR = 0x2015, + VG_BLEND_DIFFERENCE_KHR = 0x2016, + VG_BLEND_SUBTRACT_KHR = 0x2017, + VG_BLEND_INVERT_KHR = 0x2018, + VG_BLEND_EXCLUSION_KHR = 0x2019, + VG_BLEND_LINEARDODGE_KHR = 0x201a, + VG_BLEND_LINEARBURN_KHR = 0x201b, + VG_BLEND_VIVIDLIGHT_KHR = 0x201c, + VG_BLEND_LINEARLIGHT_KHR = 0x201d, + VG_BLEND_PINLIGHT_KHR = 0x201e, + VG_BLEND_HARDMIX_KHR = 0x201f, + VG_BLEND_CLEAR_KHR = 0x2020, + VG_BLEND_DST_KHR = 0x2021, + VG_BLEND_SRC_OUT_KHR = 0x2022, + VG_BLEND_DST_OUT_KHR = 0x2023, + VG_BLEND_SRC_ATOP_KHR = 0x2024, + VG_BLEND_DST_ATOP_KHR = 0x2025, + VG_BLEND_XOR_KHR = 0x2026, + + VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM +} VGBlendModeKHR; +#endif + +#ifndef VG_KHR_parametric_filter +#define VG_KHR_parametric_filter 1 + +typedef enum { + VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0), + VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1), + VG_PF_OUTER_FLAG_KHR = (1 << 2), + VG_PF_INNER_FLAG_KHR = (1 << 3), + + VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM +} VGPfTypeKHR; + +typedef enum { + VGU_IMAGE_IN_USE_ERROR = 0xF010, + + VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM +} VGUErrorCodeKHR; + +#ifdef VG_VGEXT_PROTOTYPES +VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint); +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA); +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ; +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA); +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops); +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops); +#endif +typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint); +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA); +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA); +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA); +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops); +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops); + +#endif + + +/*------------------------------------------------------------------------------- + * NDS extensions + *------------------------------------------------------------------------------*/ + +#ifndef VG_NDS_paint_generation +#define VG_NDS_paint_generation 1 + +typedef enum { + VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10, + VG_COLOR_MATRIX_NDS = 0x1A11, + VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12, + + VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGPaintParamTypeNds; + +typedef enum { + VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10, + + VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGImageModeNds; +#endif + + +#ifndef VG_NDS_projective_geometry +#define VG_NDS_projective_geometry 1 + +typedef enum { + VG_CLIP_MODE_NDS = 0x1180, + VG_CLIP_LINES_NDS = 0x1181, + VG_MAX_CLIP_LINES_NDS = 0x1182, + + VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGParamTypeNds; + +typedef enum { + VG_CLIPMODE_NONE_NDS = 0x3000, + VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001, + VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002, + VG_CLIPMODE_CULL_NDS = 0x3003, + + VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGClipModeNds; + +typedef enum { + VG_RQUAD_TO_NDS = ( 13 << 1 ), + VG_RCUBIC_TO_NDS = ( 14 << 1 ), + + VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGPathSegmentNds; + +typedef enum { + VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE), + VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE), + VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE), + VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE), + + VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM +} VGPathCommandNds; + +#ifdef VG_VGEXT_PROTOTYPES +VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ; +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout); +#endif +typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ; +typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout); + +#endif + +#ifdef __cplusplus +} /* extern "C" */ +#endif + +#endif /* _VGEXT_H */ diff --git a/include/VG/vgplatform.h b/include/VG/vgplatform.h new file mode 100644 index 0000000000..e4f269f658 --- /dev/null +++ b/include/VG/vgplatform.h @@ -0,0 +1,106 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */ + +/*------------------------------------------------------------------------ + * + * VG platform specific header Reference Implementation + * ---------------------------------------------------- + * + * Copyright (c) 2008 The Khronos Group Inc. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and /or associated documentation files + * (the "Materials "), to deal in the Materials without restriction, + * including without limitation the rights to use, copy, modify, merge, + * publish, distribute, sublicense, and/or sell copies of the Materials, + * and to permit persons to whom the Materials are furnished to do so, + * subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Materials. + * + * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR + * THE USE OR OTHER DEALINGS IN THE MATERIALS. + * + *//** + * \file + * \brief VG platform specific header + *//*-------------------------------------------------------------------*/ + +#ifndef _VGPLATFORM_H +#define _VGPLATFORM_H + +#ifdef __cplusplus +extern "C" { +#endif + +#ifndef VG_API_CALL +#if defined(OPENVG_STATIC_LIBRARY) +# define VG_API_CALL +#else +# if defined(_WIN32) || defined(__VC32__) /* Win32 */ +# if defined (OPENVG_DLL_EXPORTS) +# define VG_API_CALL __declspec(dllexport) +# else +# define VG_API_CALL __declspec(dllimport) +# endif +# else +# define VG_API_CALL extern +# endif /* defined(_WIN32) ||... */ +#endif /* defined OPENVG_STATIC_LIBRARY */ +#endif /* ifndef VG_API_CALL */ + +#ifndef VGU_API_CALL +#if defined(OPENVG_STATIC_LIBRARY) +# define VGU_API_CALL +#else +# if defined(_WIN32) || defined(__VC32__) /* Win32 */ +# if defined (OPENVG_DLL_EXPORTS) +# define VGU_API_CALL __declspec(dllexport) +# else +# define VGU_API_CALL __declspec(dllimport) +# endif +# else +# define VGU_API_CALL extern +# endif /* defined(_WIN32) ||... */ +#endif /* defined OPENVG_STATIC_LIBRARY */ +#endif /* ifndef VGU_API_CALL */ + + +#ifndef VG_API_ENTRY +#define VG_API_ENTRY +#endif + +#ifndef VG_API_EXIT +#define VG_API_EXIT +#endif + +#ifndef VGU_API_ENTRY +#define VGU_API_ENTRY +#endif + +#ifndef VGU_API_EXIT +#define VGU_API_EXIT +#endif + +typedef float VGfloat; +typedef signed char VGbyte; +typedef unsigned char VGubyte; +typedef signed short VGshort; +typedef signed int VGint; +typedef unsigned int VGuint; +typedef unsigned int VGbitfield; + +#ifndef VG_VGEXT_PROTOTYPES +#define VG_VGEXT_PROTOTYPES +#endif + +#ifdef __cplusplus +} /* extern "C" */ +#endif + +#endif /* _VGPLATFORM_H */ diff --git a/include/VG/vgu.h b/include/VG/vgu.h new file mode 100644 index 0000000000..2799684e5e --- /dev/null +++ b/include/VG/vgu.h @@ -0,0 +1,130 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */ + +/*------------------------------------------------------------------------ + * + * VGU 1.0.1 Reference Implementation + * ------------------------------------- + * + * Copyright (c) 2008 The Khronos Group Inc. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and /or associated documentation files + * (the "Materials "), to deal in the Materials without restriction, + * including without limitation the rights to use, copy, modify, merge, + * publish, distribute, sublicense, and/or sell copies of the Materials, + * and to permit persons to whom the Materials are furnished to do so, + * subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Materials. + * + * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR + * THE USE OR OTHER DEALINGS IN THE MATERIALS. + * + *//** + * \file + * \brief VGU 1.0.1 API. + *//*-------------------------------------------------------------------*/ + +#ifndef _VGU_H +#define _VGU_H + +#ifdef __cplusplus +extern "C" { +#endif + +#include + +#define VGU_VERSION_1_0 1 + +#ifndef VGU_API_CALL +# error VGU_API_CALL must be defined +#endif + +#ifndef VGU_API_ENTRY +# error VGU_API_ENTRY must be defined +#endif + +#ifndef VGU_API_EXIT +# error VGU_API_EXIT must be defined +#endif + + +typedef enum { + VGU_NO_ERROR = 0, + VGU_BAD_HANDLE_ERROR = 0xF000, + VGU_ILLEGAL_ARGUMENT_ERROR = 0xF001, + VGU_OUT_OF_MEMORY_ERROR = 0xF002, + VGU_PATH_CAPABILITY_ERROR = 0xF003, + VGU_BAD_WARP_ERROR = 0xF004, + + VGU_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM +} VGUErrorCode; + +typedef enum { + VGU_ARC_OPEN = 0xF100, + VGU_ARC_CHORD = 0xF101, + VGU_ARC_PIE = 0xF102, + + VGU_ARC_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGUArcType; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path, + VGfloat x0, VGfloat y0, + VGfloat x1, VGfloat y1) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path, + const VGfloat * points, VGint count, + VGboolean closed) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height, + VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path, + VGfloat cx, VGfloat cy, + VGfloat width, VGfloat height) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height, + VGfloat startAngle, VGfloat angleExtent, + VGUArcType arcType) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat * matrix) VGU_API_EXIT; + +VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) VGU_API_EXIT; + +#ifdef __cplusplus +} /* extern "C" */ +#endif + +#endif /* #ifndef _VGU_H */ diff --git a/progs/openvg/demos/Makefile b/progs/openvg/demos/Makefile new file mode 100644 index 0000000000..7ecb987f9d --- /dev/null +++ b/progs/openvg/demos/Makefile @@ -0,0 +1,40 @@ +# progs/vg/Makefile + +TOP = ../../.. +include $(TOP)/configs/current + +VG_LIBS=-lm -pthread -lEGL -lOpenVG +INCLUDE_DIRS = -I$(TOP)/include + +PROGRAMS = \ + gears \ + lion + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + + +default: $(PROGRAMS) + + +gears: gears.o + $(CC) $(CFLAGS) gears.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@ + +gears.o: gears.c $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include gears.c + + +lion: lion.o lion-render.o + $(CC) $(CFLAGS) lion.o lion-render.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@ + +lion.o: lion.c lion-render.h $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include lion.c +lion-render.o: lion-render.c lion-render.h $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include lion-render.c + + +clean: + rm -f *.o *~ + rm -f *.so + rm -f $(PROGRAMS) diff --git a/progs/openvg/demos/gears.c b/progs/openvg/demos/gears.c new file mode 100644 index 0000000000..7dcb3954a8 --- /dev/null +++ b/progs/openvg/demos/gears.c @@ -0,0 +1,394 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static VGint width, height; +static VGPath gear1; +static VGPath gear2; +static VGPath gear3; + +static VGPaint fill; +const VGfloat color[4] = {0.5, 0.5, 0.5, 1.0}; + +static VGfloat gear1_angle = 35; +static VGfloat gear2_angle = 24; +static VGfloat gear3_angle = 33.5; + +static void moveTo(VGPath path, VGfloat x, VGfloat y) +{ + static VGubyte moveTo = VG_MOVE_TO | VG_ABSOLUTE; + VGfloat pathData[2]; + pathData[0] = x; pathData[1] = y; + vgAppendPathData(path, 1, &moveTo, pathData); +} + +static void lineTo(VGPath path, VGfloat x, VGfloat y) +{ + static VGubyte lineTo = VG_LINE_TO | VG_ABSOLUTE; + VGfloat pathData[2]; + pathData[0] = x; pathData[1] = y; + vgAppendPathData(path, 1, &lineTo, pathData); +} + +static void closeSubpath(VGPath path) +{ + static VGubyte close = VG_CLOSE_PATH | VG_ABSOLUTE; + VGfloat pathData[2]; + vgAppendPathData(path, 1, &close, pathData); +} + +static void cubicTo(VGPath path, VGfloat x1, VGfloat y1, VGfloat x2, VGfloat y2, + VGfloat midx, VGfloat midy) +{ + static VGubyte cubic = VG_CUBIC_TO | VG_ABSOLUTE; + VGfloat pathData[6]; + pathData[0] = x1; + pathData[1] = y1; + pathData[2] = x2; + pathData[3] = y2; + pathData[4] = midx; + pathData[5] = midy; + vgAppendPathData(path, 1, &cubic, pathData); +} + +static VGPath gearsPath(double inner_radius, double outer_radius, + int teeth, double tooth_depth) +{ + VGPath path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL); + + int i; + double r0, r1, r2; + double angle, da; + + r0 = inner_radius; + r1 = outer_radius - tooth_depth / 2.0; + r2 = outer_radius + tooth_depth / 2.0; + + da = 2.0 * M_PI / (VGfloat) teeth / 4.0; + + angle = 0.0; + moveTo(path, r1 * cos(angle + 3 * da), r1 * sin(angle + 3 * da)); + + for (i = 1; i <= teeth; i++) { + angle = i * 2.0 * M_PI / (VGfloat)teeth; + + lineTo(path, r1 * cos(angle), r1 * sin(angle)); + lineTo(path, r2 * cos(angle + da), r2 * sin(angle + da)); + lineTo(path, r2 * cos(angle + 2 * da), r2 * sin(angle + 2 * da)); + + if (i < teeth) + lineTo(path, r1 * cos(angle + 3 * da), + r1 * sin(angle + 3 * da)); + } + + closeSubpath(path); + + moveTo(path, r0 * cos(angle + 3 * da), r0 * sin(angle + 3 * da)); + + for (i = 1; i <= teeth; i++) { + angle = i * 2.0 * M_PI / (VGfloat) teeth; + + lineTo(path, r0 * cos(angle), r0 * sin(angle)); + } + + closeSubpath(path); + return path; +} + +static void +draw(void) +{ + vgClear(0, 0, width, height); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + + vgLoadIdentity(); + vgLoadIdentity(); + vgTranslate(170, 330); + vgRotate(gear1_angle); + vgDrawPath(gear1, VG_FILL_PATH); + + vgLoadIdentity(); + vgTranslate(369, 330); + vgRotate(gear2_angle); + vgDrawPath(gear2, VG_FILL_PATH); + + vgLoadIdentity(); + vgTranslate(170, 116); + vgRotate(gear3_angle); + vgDrawPath(gear3, VG_FILL_PATH); + + gear1_angle += 1; + gear2_angle -= (20.0 / 12.0); + gear3_angle -= (20.0 / 14.0); +} + + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + width = w; + height = h; +} + + +static void +init(void) +{ + float clear_color[4] = {1.0, 1.0, 1.0, 1.0}; + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + + gear1 = gearsPath(30.0, 120.0, 20, 20.0); + gear2 = gearsPath(15.0, 75.0, 12, 20.0); + gear3 = gearsPath(20.0, 90.0, 14, 20.0); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); +} + + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + XEvent event; + + while (XPending(dpy) > 0) { + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + break; + case ConfigureNotify: + reshape(event.xconfigure.width, event.xconfigure.height); + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + break; + default: + ; /*no-op*/ + } + } + + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } +} + + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int +main(int argc, char *argv[]) +{ + const int winWidth = 500, winHeight = 500; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + else { + usage(); + return -1; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "xegl_tri", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} diff --git a/progs/openvg/demos/lion-render.c b/progs/openvg/demos/lion-render.c new file mode 100644 index 0000000000..f3f151f552 --- /dev/null +++ b/progs/openvg/demos/lion-render.c @@ -0,0 +1,1573 @@ +#include "lion-render.h" + +#include +#include + +#define ELEMENTS(x) (sizeof(x)/sizeof((x)[0])) + +static void init(struct lion *l, int i, VGint hexColor, const VGfloat *coords, int elems) +{ + static VGubyte cmds[128]; + VGfloat color[4]; + VGint j; + + color[0] = ((hexColor >> 16) & 0xff) / 255.f; + color[1] = ((hexColor >> 8) & 0xff) / 255.f; + color[2] = ((hexColor >> 0) & 0xff) / 255.f; + color[3] = 1.0; + + l->paths[i] = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL); + l->fills[i] = vgCreatePaint(); + vgSetParameterfv(l->fills[i], VG_PAINT_COLOR, 4, color); + + cmds[0] = VG_MOVE_TO_ABS; + for (j = 1; j < elems; ++j) { + cmds[j] = VG_LINE_TO_ABS; + } + + vgAppendPathData(l->paths[i], elems, cmds, coords); +} + +static void poly0(struct lion *l) +{ + VGfloat color = 0xf2cc99; + static const VGfloat coords[] = {69,18, 82,8, 99,3, 118,5, 135,12, 149,21, 156,13, 165,9, 177,13, 183,28, + 180,50, 164,91, 155,107, 154,114, 151,121, 141,127, 139,136, 155,206, 157,251, 126,342, + 133,357, 128,376, 83,376, 75,368, 67,350, 61,350, 53,369, 4,369, 2,361, 5,354, + 12,342, 16,321, 4,257, 4,244, 7,218, 9,179, 26,127, 43,93, 32,77, 30,70, + 24,67, 16,49, 17,35, 18,23, 30,12, 40,7, 53,7, 62,12 + }; + + init(l, 0, color, coords, ELEMENTS(coords)/2); +} + +static void poly1(struct lion *l) +{ + VGfloat color = 0xe5b27f; + static const VGfloat coords[] = {142,79, 136,74, 138,82, 133,78, 133,84, 127,78, 128,85, + 124,80, 125,87, 119,82, 119,90, 125,99, 125,96, 128,100, 128,94, + 131,98, 132,93, 135,97, 136,93, 138,97, 139,94, 141,98, 143,94, + 144,85 + }; + + init(l, 1, color, coords, ELEMENTS(coords)/2); +} + +static void poly2(struct lion *l) +{ + VGfloat color = 0xeb8080; + static const VGfloat coords[] = {127,101, 132,100, 137,99, 144,101, 143,105, 135,110 + }; + + init(l, 2, color, coords, ELEMENTS(coords)/2); +} + +static void poly3(struct lion *l) +{ + VGfloat color = 0xf2cc99; + static const VGfloat coords[] = {178,229, 157,248, 139,296, 126,349, 137,356, + 158,357, 183,342, 212,332, 235,288, 235,261, + 228,252, 212,250, 188,251 + }; + + init(l, 3, color, coords, ELEMENTS(coords)/2); +} + +static void poly4(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {56,229, 48,241, 48,250, 57,281, 63,325, 71,338, + 81,315, 76,321, 79,311, 83,301, 75,308, 80,298, + 73,303, 76,296, 71,298, 74,292, 69,293, 74,284, + 78,278, 71,278, 74,274, 68,273, 70,268, 66,267, + 68,261, 60,266, 62,259, 65,253, 57,258, 59,251, + 55,254, 55,248, 60,237, 54,240, 58,234, 54,236 + }; + + init(l, 4, color, coords, ELEMENTS(coords)/2); +} + +static void poly5(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {74,363, 79,368, 81,368, 85,362, 89,363, 92,370, 96,373, + 101,372, 108,361, 110,371, 113,373, 116,371, 120,358, 122,363, + 123,371, 126,371, 129,367, 132,357, 135,361, 130,376, 127,377, + 94,378, 84,376, 76,371 + }; + + init(l, 5, color, coords, ELEMENTS(coords)/2); +} + +static void poly6(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {212,250, 219,251, 228,258, 236,270, 235,287, 225,304, + 205,332, 177,343, 171,352, 158,357, 166,352, 168,346, + 168,339, 165,333, 155,327, 155,323, 161,320, 165,316, + 169,316, 167,312, 171,313, 168,308, 173,309, 170,306, + 177,306, 175,308, 177,311, 174,311, 176,316, 171,315, + 174,319, 168,320, 168,323, 175,327, 179,332, 183,326, + 184,332, 189,323, 190,328, 194,320, 194,325, 199,316, + 201,320, 204,313, 206,316, 208,310, 211,305, 219,298, + 226,288, 229,279, 228,266, 224,259, 217,253 + }; + + init(l, 6, color, coords, ELEMENTS(coords)/2); +} + +static void poly7(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {151,205, 151,238, 149,252, 141,268, 128,282, 121,301, + 130,300, 126,313, 118,324, 116,337, 120,346, 133,352, + 133,340, 137,333, 145,329, 156,327, 153,319, 153,291, + 157,271, 170,259, 178,277, 193,250, 174,216 + }; + + init(l, 7, color, coords, ELEMENTS(coords)/2); +} + +static void poly8(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,127, 90,142, 95,155, 108,164, 125,167, 139,175, + 150,206, 152,191, 141,140, 121,148, 100,136 + }; + + init(l, 8, color, coords, ELEMENTS(coords)/2); +} + +static void poly9(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {21,58, 35,63, 38,68, 32,69, 42,74, 40,79, 47,80, 54,83, + 45,94, 34,81, 32,73, 24,66 + }; + + init(l, 9, color, coords, ELEMENTS(coords)/2); +} + +static void poly10(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {71,34, 67,34, 66,27, 59,24, 54,17, 48,17, 39,22, + 30,26, 28,31, 31,39, 38,46, 29,45, 36,54, 41,61, + 41,70, 50,69, 54,71, 55,58, 67,52, 76,43, 76,39, + 68,44 + }; + + init(l, 10, color, coords, ELEMENTS(coords)/2); +} + +static void poly11(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {139,74, 141,83, 143,89, 144,104, 148,104, 155,106, + 154,86, 157,77, 155,72, 150,77, 144,77 + }; + + init(l, 11, color, coords, ELEMENTS(coords)/2); +} + +static void poly12(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {105,44, 102,53, 108,58, 111,62, 112,55 + }; + + init(l, 12, color, coords, ELEMENTS(coords)/2); +} + +static void poly13(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {141,48, 141,54, 144,58, 139,62, 137,66, 136,59, 137,52 + }; + + init(l, 13, color, coords, ELEMENTS(coords)/2); +} + +static void poly14(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {98,135, 104,130, 105,134, 108,132, 108,135, 112,134, + 113,137, 116,136, 116,139, 119,139, 124,141, 128,140, + 133,138, 140,133, 139,140, 126,146, 104,144 + }; + + init(l, 14, color, coords, ELEMENTS(coords)/2); +} + +static void poly15(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {97,116, 103,119, 103,116, 111,118, 116,117, 122,114, + 127,107, 135,111, 142,107, 141,114, 145,118, 149,121, + 145,125, 140,124, 127,121, 113,125, 100,124 + }; + + init(l, 15, color, coords, ELEMENTS(coords)/2); +} + +static void poly16(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {147,33, 152,35, 157,34, 153,31, 160,31, 156,28, 161,28, + 159,24, 163,25, 163,21, 165,22, 170,23, 167,17, 172,21, + 174,18, 175,23, 176,22, 177,28, 177,33, 174,37, 176,39, + 174,44, 171,49, 168,53, 164,57, 159,68, 156,70, 154,60, + 150,51, 146,43, 144,35 + }; + + init(l, 16, color, coords, ELEMENTS(coords)/2); +} + +static void poly17(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {85,72, 89,74, 93,75, 100,76, 105,75, 102,79, 94,79, 88,76 + }; + + init(l, 17, color, coords, ELEMENTS(coords)/2); +} + +static void poly18(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {86,214, 79,221, 76,232, 82,225, 78,239, 82,234, 78,245, + 81,243, 79,255, 84,250, 84,267, 87,254, 90,271, 90,257, + 95,271, 93,256, 95,249, 92,252, 93,243, 89,253, 89,241, + 86,250, 87,236, 83,245, 87,231, 82,231, 90,219, 84,221 + }; + + init(l, 18, color, coords, ELEMENTS(coords)/2); +} + +static void poly19(struct lion *l) +{ + VGfloat color = 0xffcc7f; + static const VGfloat coords[] = {93,68, 96,72, 100,73, 106,72, 108,66, 105,63, 100,62 + }; + + init(l, 19, color, coords, ELEMENTS(coords)/2); +} + +static void poly20(struct lion *l) +{ + VGfloat color = 0xffcc7f; + static const VGfloat coords[] = {144,64, 142,68, 142,73, 146,74, 150,73, 154,64, 149,62 + }; + + init(l, 20, color, coords, ELEMENTS(coords)/2); +} + +static void poly21(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {57,91, 42,111, 52,105, 41,117, 53,112, 46,120, 53,116, + 50,124, 57,119, 55,127, 61,122, 60,130, 67,126, 66,134, + 71,129, 72,136, 77,130, 76,137, 80,133, 82,138, 86,135, + 96,135, 94,129, 86,124, 83,117, 77,123, 79,117, 73,120, + 75,112, 68,116, 71,111, 65,114, 69,107, 63,110, 68,102, + 61,107, 66,98, 61,103, 63,97, 57,99 + }; + + init(l, 21, color, coords, ELEMENTS(coords)/2); +} + +static void poly22(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {83,79, 76,79, 67,82, 75,83, 65,88, 76,87, 65,92, 76,91, + 68,96, 77,95, 70,99, 80,98, 72,104, 80,102, 76,108, 85,103, + 92,101, 87,98, 93,96, 86,94, 91,93, 85,91, 93,89, 99,89, 105,93, + 107,85, 102,82, 92,80 + }; + + init(l, 22, color, coords, ELEMENTS(coords)/2); +} + +static void poly23(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {109,77, 111,83, 109,89, 113,94, 117,90, 117,81, 114,78 + }; + + init(l, 23, color, coords, ELEMENTS(coords)/2); +} + +static void poly24(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {122,128, 127,126, 134,127, 136,129, 134,130, 130,128, 124,129 + }; + + init(l, 24, color, coords, ELEMENTS(coords)/2); +} + +static void poly25(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,27, 82,32, 80,33, 82,36, 78,37, 82,40, 78,42, 81,46, 76,47, + 78,49, 74,50, 82,52, 87,50, 83,48, 91,46, 86,45, 91,42, 88,40, + 92,37, 86,34, 90,31, 86,29, 89,26 + }; + + init(l, 25, color, coords, ELEMENTS(coords)/2); +} + +static void poly26(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {82,17, 92,20, 79,21, 90,25, 81,25, 94,28, 93,26, 101,30, + 101,26, 107,33, 108,28, 111,40, 113,34, 115,45, 117,39, + 119,54, 121,46, 124,58, 126,47, 129,59, 130,49, 134,58, + 133,44, 137,48, 133,37, 137,40, 133,32, 126,20, 135,26, + 132,19, 138,23, 135,17, 142,18, 132,11, 116,6, 94,6, 78,11, + 92,12, 80,14, 90,16 + }; + + init(l, 26, color, coords, ELEMENTS(coords)/2); +} + +static void poly27(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {142,234, 132,227, 124,223, 115,220, 110,225, 118,224, 127,229, + 135,236, 122,234, 115,237, 113,242, 121,238, 139,243, 121,245, + 111,254, 95,254, 102,244, 104,235, 110,229, 100,231, 104,224, + 113,216, 122,215, 132,217, 141,224, 145,230, 149,240 + }; + + init(l, 27, color, coords, ELEMENTS(coords)/2); +} + +static void poly28(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {115,252, 125,248, 137,249, 143,258, 134,255, 125,254 + }; + + init(l, 28, color, coords, ELEMENTS(coords)/2); +} + +static void poly29(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {114,212, 130,213, 140,219, 147,225, 144,214, 137,209, 128,207 + }; + + init(l, 29, color, coords, ELEMENTS(coords)/2); +} + +static void poly30(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {102,263, 108,258, 117,257, 131,258, 116,260, 109,265 + }; + + init(l, 30, color, coords, ELEMENTS(coords)/2); +} + +static void poly31(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {51,241, 35,224, 40,238, 23,224, 31,242, 19,239, 28,247, 17,246, + 25,250, 37,254, 39,263, 44,271, 47,294, 48,317, 51,328, 60,351, + 60,323, 53,262, 47,246 + }; + + init(l, 31, color, coords, ELEMENTS(coords)/2); +} + +static void poly32(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {2,364, 9,367, 14,366, 18,355, 20,364, 26,366, 31,357, 35,364, + 39,364, 42,357, 47,363, 53,360, 59,357, 54,369, 7,373 + }; + + init(l, 32, color, coords, ELEMENTS(coords)/2); +} + +static void poly33(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {7,349, 19,345, 25,339, 18,341, 23,333, 28,326, 23,326, 27,320, + 23,316, 25,311, 20,298, 15,277, 12,264, 9,249, 10,223, 3,248, + 5,261, 15,307, 17,326, 11,343 + }; + + init(l, 33, color, coords, ELEMENTS(coords)/2); +} + +static void poly34(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {11,226, 15,231, 25,236, 18,227 + }; + + init(l, 34, color, coords, ELEMENTS(coords)/2); +} + +static void poly35(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {13,214, 19,217, 32,227, 23,214, 16,208, 15,190, 24,148, + 31,121, 24,137, 14,170, 8,189 + }; + + init(l, 35, color, coords, ELEMENTS(coords)/2); +} + +static void poly36(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {202,254, 195,258, 199,260, 193,263, 197,263, 190,268, + 196,268, 191,273, 188,282, 200,272, 194,272, 201,266, + 197,265, 204,262, 200,258, 204,256 + }; + + init(l, 36, color, coords, ELEMENTS(coords)/2); +} + +static void poly37(struct lion *l) +{ + VGfloat color = 0x845433; + static const VGfloat coords[] = {151,213, 165,212, 179,225, 189,246, 187,262, 179,275, + 176,263, 177,247, 171,233, 163,230, 165,251, 157,264, + 146,298, 145,321, 133,326, 143,285, 154,260, 153,240 + }; + + init(l, 37, color, coords, ELEMENTS(coords)/2); +} + +static void poly38(struct lion *l) +{ + VGfloat color = 0x845433; + static const VGfloat coords[] = {91,132, 95,145, 97,154, 104,148, 107,155, 109,150, 111,158, + 115,152, 118,159, 120,153, 125,161, 126,155, 133,164, 132,154, + 137,163, 137,152, 142,163, 147,186, 152,192, 148,167, 141,143, + 124,145, 105,143 + }; + + init(l, 38, color, coords, ELEMENTS(coords)/2); +} + +static void poly39(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {31,57, 23,52, 26,51, 20,44, 23,42, 21,36, 22,29, 25,23, + 24,32, 30,43, 26,41, 30,50, 26,48 + }; + + init(l, 39, color, coords, ELEMENTS(coords)/2); +} + +static void poly40(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {147,21, 149,28, 155,21, 161,16, 167,14, 175,15, 173,11, 161,9 + }; + + init(l, 40, color, coords, ELEMENTS(coords)/2); +} + +static void poly41(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {181,39, 175,51, 169,57, 171,65, 165,68, 165,75, 160,76, + 162,91, 171,71, 180,51 + }; + + init(l, 41, color, coords, ELEMENTS(coords)/2); +} + +static void poly42(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {132,346, 139,348, 141,346, 142,341, 147,342, 143,355, 133,350 + }; + + init(l, 42, color, coords, ELEMENTS(coords)/2); +} + +static void poly43(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {146,355, 151,352, 155,348, 157,343, 160,349, 151,356, 147,357 + }; + + init(l, 43, color, coords, ELEMENTS(coords)/2); +} + +static void poly44(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {99,266, 100,281, 94,305, 86,322, 78,332, 72,346, 73,331, 91,291 + }; + + init(l, 44, color, coords, ELEMENTS(coords)/2); +} + +static void poly45(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {20,347, 32,342, 45,340, 54,345, 45,350, 42,353, 38,350, + 31,353, 29,356, 23,350, 19,353, 15,349 + }; + + init(l, 45, color, coords, ELEMENTS(coords)/2); +} + +static void poly46(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,344, 86,344, 92,349, 88,358, 84,352 + }; + + init(l, 46, color, coords, ELEMENTS(coords)/2); +} + +static void poly47(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {93,347, 104,344, 117,345, 124,354, 121,357, 116,351, + 112,351, 108,355, 102,351 + }; + + init(l, 47, color, coords, ELEMENTS(coords)/2); +} + +static void poly48(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {105,12, 111,18, 113,24, 113,29, 119,34, 116,23, 112,16 + }; + + init(l, 48, color, coords, ELEMENTS(coords)/2); +} + +static void poly49(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {122,27, 125,34, 127,43, 128,34, 125,29 + }; + + init(l, 49, color, coords, ELEMENTS(coords)/2); +} + +static void poly50(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {115,13, 122,19, 122,15, 113,10 + }; + + init(l, 50, color, coords, ELEMENTS(coords)/2); +} + +static void poly51(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {116,172, 107,182, 98,193, 98,183, 90,199, 89,189, 84,207, + 88,206, 87,215, 95,206, 93,219, 91,230, 98,216, 97,226, + 104,214, 112,209, 104,208, 113,202, 126,200, 139,207, 132,198, + 142,203, 134,192, 142,195, 134,187, 140,185, 130,181, 136,177, + 126,177, 125,171, 116,180 + }; + + init(l, 51, color, coords, ELEMENTS(coords)/2); +} + +static void poly52(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {74,220, 67,230, 67,221, 59,235, 63,233, 60,248, 70,232, 65,249, + 71,243, 67,256, 73,250, 69,262, 73,259, 71,267, 76,262, 72,271, + 78,270, 76,275, 82,274, 78,290, 86,279, 86,289, 92,274, 88,275, + 87,264, 82,270, 82,258, 77,257, 78,247, 73,246, 77,233, 72,236 + }; + + init(l, 52, color, coords, ELEMENTS(coords)/2); +} + +static void poly53(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {133,230, 147,242, 148,250, 145,254, 138,247, 129,246, 142,245, + 138,241, 128,237, 137,238 + }; + + init(l, 53, color, coords, ELEMENTS(coords)/2); +} + +static void poly54(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {133,261, 125,261, 116,263, 111,267, 125,265 + }; + + init(l, 54, color, coords, ELEMENTS(coords)/2); +} + +static void poly55(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {121,271, 109,273, 103,279, 99,305, 92,316, 85,327, 83,335, + 89,340, 97,341, 94,336, 101,336, 96,331, 103,330, 97,327, 108,325, + 99,322, 109,321, 100,318, 110,317, 105,314, 110,312, 107,310, 113,308, + 105,306, 114,303, 105,301, 115,298, 107,295, 115,294, 108,293, 117,291, + 109,289, 117,286, 109,286, 118,283, 112,281, 118,279, 114,278, + 119,276, 115,274 + }; + + init(l, 55, color, coords, ELEMENTS(coords)/2); +} + +static void poly56(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {79,364, 74,359, 74,353, 76,347, 80,351, 83,356, 82,360 + }; + + init(l, 56, color, coords, ELEMENTS(coords)/2); +} + +static void poly57(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {91,363, 93,356, 97,353, 103,355, 105,360, 103,366, 99,371, 94,368 + }; + + init(l, 57, color, coords, ELEMENTS(coords)/2); +} + +static void poly58(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {110,355, 114,353, 118,357, 117,363, 113,369, 111,362 + }; + + init(l, 58, color, coords, ELEMENTS(coords)/2); +} + +static void poly59(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {126,354, 123,358, 124,367, 126,369, 129,361, 129,357 + }; + + init(l, 59, color, coords, ELEMENTS(coords)/2); +} + +static void poly60(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {30,154, 24,166, 20,182, 23,194, 29,208, 37,218, 41,210, 41,223, + 46,214, 46,227, 52,216, 52,227, 61,216, 59,225, 68,213, 73,219, + 70,207, 77,212, 69,200, 77,202, 70,194, 78,197, 68,187, 76,182, + 64,182, 58,175, 58,185, 53,177, 50,186, 46,171, 44,182, 39,167, + 36,172, 36,162, 30,166 + }; + + init(l, 60, color, coords, ELEMENTS(coords)/2); +} + +static void poly61(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {44,130, 41,137, 45,136, 43,150, 48,142, 48,157, 53,150, + 52,164, 60,156, 61,169, 64,165, 66,175, 70,167, 74,176, + 77,168, 80,183, 85,172, 90,182, 93,174, 98,181, 99,173, + 104,175, 105,169, 114,168, 102,163, 95,157, 94,166, 90,154, + 87,162, 82,149, 75,159, 72,148, 68,155, 67,143, 62,148, 62,138, + 58,145, 56,133, 52,142, 52,128, 49,134, 47,125 + }; + + init(l, 61, color, coords, ELEMENTS(coords)/2); +} + +static void poly62(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {13,216, 19,219, 36,231, 22,223, 16,222, 22,227, 12,224, 13,220, 16,220 + }; + + init(l, 62, color, coords, ELEMENTS(coords)/2); +} + +static void poly63(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {10,231, 14,236, 25,239, 27,237, 19,234 + }; + + init(l, 63, color, coords, ELEMENTS(coords)/2); +} + +static void poly64(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {9,245, 14,242, 25,245, 13,245 + }; + + init(l, 64, color, coords, ELEMENTS(coords)/2); +} + +static void poly65(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {33,255, 26,253, 18,254, 25,256, 18,258, 27,260, 18,263, + 27,265, 19,267, 29,270, 21,272, 29,276, 21,278, 30,281, + 22,283, 31,287, 24,288, 32,292, 23,293, 34,298, 26,299, + 37,303, 32,305, 39,309, 33,309, 39,314, 34,314, 40,318, + 34,317, 40,321, 34,321, 41,326, 33,326, 40,330, 33,332, + 39,333, 33,337, 42,337, 54,341, 49,337, 52,335, 47,330, + 50,330, 45,325, 49,325, 45,321, 48,321, 45,316, 46,306, + 45,286, 43,274, 36,261 + }; + + init(l, 65, color, coords, ELEMENTS(coords)/2); +} + +static void poly66(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {7,358, 9,351, 14,351, 17,359, 11,364 + }; + + init(l, 66, color, coords, ELEMENTS(coords)/2); +} + +static void poly67(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {44,354, 49,351, 52,355, 49,361 + }; + + init(l, 67, color, coords, ELEMENTS(coords)/2); +} + +static void poly68(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {32,357, 37,353, 40,358, 36,361 + }; + + init(l, 68, color, coords, ELEMENTS(coords)/2); +} + +static void poly69(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {139,334, 145,330, 154,330, 158,334, 154,341, 152,348, + 145,350, 149,340, 147,336, 141,339, 139,345, 136,342, + 136,339 + }; + + init(l, 69, color, coords, ELEMENTS(coords)/2); +} + +static void poly70(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {208,259, 215,259, 212,255, 220,259, 224,263, 225,274, 224,283, + 220,292, 208,300, 206,308, 203,304, 199,315, 197,309, 195,318, + 193,313, 190,322, 190,316, 185,325, 182,318, 180,325, 172,321, + 178,320, 176,313, 186,312, 180,307, 188,307, 184,303, 191,302, + 186,299, 195,294, 187,290, 197,288, 192,286, 201,283, 194,280, + 203,277, 198,275, 207,271, 200,269, 209,265, 204,265, 212,262 + }; + + init(l, 70, color, coords, ELEMENTS(coords)/2); +} + +static void poly71(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {106,126, 106,131, 109,132, 111,134, 115,132, 115,135, 119,133, 118,137, + 123,137, 128,137, 133,134, 136,130, 136,127, 132,124, 118,128, 112,128, + 106,126, 106,126, 106,126 + }; + + init(l, 71, color, coords, ELEMENTS(coords)/2); +} + +static void poly72(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {107,114, 101,110, 98,102, 105,97, 111,98, 119,102, 121,108, 118,112, 113,115 + }; + + init(l, 72, color, coords, ELEMENTS(coords)/2); +} + +static void poly73(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {148,106, 145,110, 146,116, 150,118, 152,111, 151,107 + }; + + init(l, 73, color, coords, ELEMENTS(coords)/2); +} + +static void poly74(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {80,55, 70,52, 75,58, 63,57, 72,61, 57,61, 67,66, 57,67, 62,69, 54,71, + 61,73, 54,77, 63,78, 53,85, 60,84, 56,90, 69,84, 63,82, 75,76, 70,75, + 77,72, 72,71, 78,69, 72,66, 81,67, 78,64, 82,63, 80,60, 86,62 + }; + + init(l, 74, color, coords, ELEMENTS(coords)/2); +} + +static void poly75(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {87,56, 91,52, 96,50, 102,56, 98,56, 92,60 + }; + + init(l, 75, color, coords, ELEMENTS(coords)/2); +} + +static void poly76(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {85,68, 89,73, 98,76, 106,74, 96,73, 91,70 + }; + + init(l, 76, color, coords, ELEMENTS(coords)/2); +} + +static void poly77(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {115,57, 114,64, 111,64, 115,75, 122,81, 122,74, 126,79, + 126,74, 131,78, 130,72, 133,77, 131,68, 126,61, 119,57 + }; + + init(l, 77, color, coords, ELEMENTS(coords)/2); +} + +static void poly78(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {145,48, 143,53, 147,59, 151,59, 150,55 + }; + + init(l, 78, color, coords, ELEMENTS(coords)/2); +} + +static void poly79(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {26,22, 34,15, 43,10, 52,10, 59,16, 47,15, 32,22 + }; + + init(l, 79, color, coords, ELEMENTS(coords)/2); +} + +static void poly80(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {160,19, 152,26, 149,34, 154,33, 152,30, 157,30, 155,26, 158,27, + 157,23, 161,23 + }; + + init(l, 80, color, coords, ELEMENTS(coords)/2); +} + +static void poly81(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {98,117, 105,122, 109,122, 105,117, 113,120, 121,120, 130,112, 128,108, + 123,103, 123,99, 128,101, 132,106, 135,109, 142,105, 142,101, 145,101, + 145,91, 148,101, 145,105, 136,112, 135,116, 143,124, 148,120, 150,122, + 142,128, 133,122, 121,125, 112,126, 103,125, 100,129, 96,124 + }; + + init(l, 81, color, coords, ELEMENTS(coords)/2); +} + +static void poly82(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {146,118, 152,118, 152,115, 149,115 + }; + + init(l, 82, color, coords, ELEMENTS(coords)/2); +} + +static void poly83(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {148,112, 154,111, 154,109, 149,109 + }; + + init(l, 83, color, coords, ELEMENTS(coords)/2); +} + +static void poly84(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,112, 108,115, 114,116, 118,114 + }; + + init(l, 84, color, coords, ELEMENTS(coords)/2); +} + +static void poly85(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {108,108, 111,110, 116,110, 119,108 + }; + + init(l, 85, color, coords, ELEMENTS(coords)/2); +} + +static void poly86(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,104, 109,105, 117,106, 115,104 + }; + + init(l, 86, color, coords, ELEMENTS(coords)/2); +} + +static void poly87(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {50,25, 41,26, 34,33, 39,43, 49,58, 36,51, 47,68, 55,69, 54,59, + 61,57, 74,46, 60,52, 67,42, 57,48, 61,40, 54,45, 60,36, 59,29, + 48,38, 52,30, 47,32 + }; + + init(l, 87, color, coords, ELEMENTS(coords)/2); +} + +static void poly88(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {147,34, 152,41, 155,49, 161,53, 157,47, 164,47, 158,43, 168,44, + 159,40, 164,37, 169,37, 164,33, 169,34, 165,28, 170,30, 170,25, + 173,29, 175,27, 176,32, 173,36, 175,39, 172,42, 172,46, 168,49, + 170,55, 162,57, 158,63, 155,58, 153,50, 149,46 + }; + + init(l, 88, color, coords, ELEMENTS(coords)/2); +} + +static void poly89(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {155,71, 159,80, 157,93, 157,102, 155,108, 150,101, 149,93, + 154,101, 152,91, 151,83, 155,79 + }; + + init(l, 89, color, coords, ELEMENTS(coords)/2); +} + +static void poly90(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {112,78, 115,81, 114,91, 112,87, 113,82 + }; + + init(l, 90, color, coords, ELEMENTS(coords)/2); +} + +static void poly91(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {78,28, 64,17, 58,11, 47,9, 36,10, 28,16, 21,26, 18,41, + 20,51, 23,61, 33,65, 28,68, 37,74, 36,81, 43,87, 48,90, + 43,100, 40,98, 39,90, 31,80, 30,72, 22,71, 17,61, 14,46, + 16,28, 23,17, 33,9, 45,6, 54,6, 65,12 + }; + + init(l, 91, color, coords, ELEMENTS(coords)/2); +} + +static void poly92(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {67,18, 76,9, 87,5, 101,2, 118,3, 135,8, 149,20, 149,26, + 144,19, 132,12, 121,9, 105,7, 89,8, 76,14, 70,20 + }; + + init(l, 92, color, coords, ELEMENTS(coords)/2); +} + +static void poly93(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {56,98, 48,106, 56,103, 47,112, 56,110, 52,115, 57,113, 52,121, 62,115, + 58,123, 65,119, 63,125, 69,121, 68,127, 74,125, 74,129, 79,128, 83,132, + 94,135, 93,129, 85,127, 81,122, 76,126, 75,121, 71,124, 71,117, 66,121, + 66,117, 62,117, 64,112, 60,113, 60,110, 57,111, 61,105, 57,107, 60,101, + 55,102 + }; + + init(l, 93, color, coords, ELEMENTS(coords)/2); +} + +static void poly94(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {101,132, 103,138, 106,134, 106,139, 112,136, 111,142, 115,139, + 114,143, 119,142, 125,145, 131,142, 135,138, 140,134, 140,129, + 143,135, 145,149, 150,171, 149,184, 145,165, 141,150, 136,147, + 132,151, 131,149, 126,152, 125,150, 121,152, 117,148, 111,152, + 110,148, 105,149, 104,145, 98,150, 96,138, 94,132, 94,130, 98,132 + }; + + init(l, 94, color, coords, ELEMENTS(coords)/2); +} + +static void poly95(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {41,94, 32,110, 23,132, 12,163, 6,190, 7,217, 5,236, + 3,247, 9,230, 12,211, 12,185, 18,160, 26,134, 35,110, + 43,99 + }; + + init(l, 95, color, coords, ELEMENTS(coords)/2); +} + +static void poly96(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {32,246, 41,250, 50,257, 52,267, 53,295, 53,323, 59,350, + 54,363, 51,365, 44,366, 42,360, 40,372, 54,372, 59,366, + 62,353, 71,352, 75,335, 73,330, 66,318, 68,302, 64,294, + 67,288, 63,286, 63,279, 59,275, 58,267, 56,262, 50,247, + 42,235, 44,246, 32,236, 35,244 + }; + + init(l, 96, color, coords, ELEMENTS(coords)/2); +} + +static void poly97(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {134,324, 146,320, 159,322, 173,327, 179,337, 179,349, + 172,355, 158,357, 170,350, 174,343, 170,333, 163,328, 152,326, + 134,329 + }; + + init(l, 97, color, coords, ELEMENTS(coords)/2); +} + +static void poly98(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {173,339, 183,334, 184,338, 191,329, 194,332, 199,323, 202,325, + 206,318, 209,320, 213,309, 221,303, 228,296, 232,289, 234,279, + 233,269, 230,262, 225,256, 219,253, 208,252, 198,252, 210,249, + 223,250, 232,257, 237,265, 238,277, 238,291, 232,305, 221,323, + 218,335, 212,342, 200,349, 178,348 + }; + + init(l, 98, color, coords, ELEMENTS(coords)/2); +} + +static void poly99(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {165,296, 158,301, 156,310, 156,323, 162,324, 159,318, + 162,308, 162,304 + }; + + init(l, 99, color, coords, ELEMENTS(coords)/2); +} + +static void poly100(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {99,252, 105,244, 107,234, 115,228, 121,228, 131,235, + 122,233, 113,235, 109,246, 121,239, 133,243, 121,243, + 110,251 + }; + + init(l, 100, color, coords, ELEMENTS(coords)/2); +} + +static void poly101(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {117,252, 124,247, 134,249, 136,253, 126,252 + }; + + init(l, 101, color, coords, ELEMENTS(coords)/2); +} + +static void poly102(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {117,218, 132,224, 144,233, 140,225, 132,219, 117,218, + 117,218, 117,218 + }; + + init(l, 102, color, coords, ELEMENTS(coords)/2); +} + +static void poly103(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {122,212, 134,214, 143,221, 141,213, 132,210 + }; + + init(l, 103, color, coords, ELEMENTS(coords)/2); +} + +static void poly104(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {69,352, 70,363, 76,373, 86,378, 97,379, 108,379, 120,377, + 128,378, 132,373, 135,361, 133,358, 132,366, 127,375, 121,374, + 121,362, 119,367, 117,374, 110,376, 110,362, 107,357, 106,371, + 104,375, 97,376, 90,375, 90,368, 86,362, 83,364, 86,369, 85,373, + 78,370, 73,362, 71,351 + }; + + init(l, 104, color, coords, ELEMENTS(coords)/2); +} + +static void poly105(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {100,360, 96,363, 99,369, 102,364 + }; + + init(l, 105, color, coords, ELEMENTS(coords)/2); +} + +static void poly106(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {115,360, 112,363, 114,369, 117,364 + }; + + init(l, 106, color, coords, ELEMENTS(coords)/2); +} + +static void poly107(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {127,362, 125,364, 126,369, 128,365 + }; + + init(l, 107, color, coords, ELEMENTS(coords)/2); +} + +static void poly108(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {5,255, 7,276, 11,304, 15,320, 13,334, 6,348, 2,353, 0,363, + 5,372, 12,374, 25,372, 38,372, 44,369, 42,367, 36,368, 31,369, + 30,360, 27,368, 20,370, 16,361, 15,368, 10,369, 3,366, 3,359, 6,352, + 11,348, 17,331, 19,316, 12,291, 9,274 + }; + + init(l, 108, color, coords, ELEMENTS(coords)/2); +} + +static void poly109(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {10,358, 7,362, 10,366, 11,362 + }; + + init(l, 109, color, coords, ELEMENTS(coords)/2); +} + +static void poly110(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {25,357, 22,360, 24,366, 27,360 + }; + + init(l, 110, color, coords, ELEMENTS(coords)/2); +} + +static void poly111(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {37,357, 34,361, 36,365, 38,361 + }; + + init(l, 111, color, coords, ELEMENTS(coords)/2); +} + +static void poly112(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {49,356, 46,359, 47,364, 50,360 + }; + + init(l, 112, color, coords, ELEMENTS(coords)/2); +} + +static void poly113(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {130,101, 132,102, 135,101, 139,102, 143,103, + 142,101, 137,100, 133,100 + }; + + init(l, 113, color, coords, ELEMENTS(coords)/2); +} + +static void poly114(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,48, 105,52, 108,56, 109,52 + }; + + init(l, 114, color, coords, ELEMENTS(coords)/2); +} + +static void poly115(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {139,52, 139,56, 140,60, 142,58, 141,56 + }; + + init(l, 115, color, coords, ELEMENTS(coords)/2); +} + +static void poly116(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {25,349, 29,351, 30,355, 33,350, 37,348, 42,351, 45,347, + 49,345, 44,343, 36,345 + }; + + init(l, 116, color, coords, ELEMENTS(coords)/2); +} + +static void poly117(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {98,347, 105,351, 107,354, 109,349, 115,349, 120,353, 118,349, + 113,346, 104,346 + }; + + init(l, 117, color, coords, ELEMENTS(coords)/2); +} + +static void poly118(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {83,348, 87,352, 87,357, 89,351, 87,348 + }; + + init(l, 118, color, coords, ELEMENTS(coords)/2); +} + +static void poly119(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {155,107, 163,107, 170,107, 186,108, 175,109, 155,109 + }; + + init(l, 119, color, coords, ELEMENTS(coords)/2); +} + +static void poly120(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {153,114, 162,113, 175,112, 192,114, 173,114, 154,115 + }; + + init(l, 120, color, coords, ELEMENTS(coords)/2); +} + +static void poly121(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {152,118, 164,120, 180,123, 197,129, 169,123, 151,120 + }; + + init(l, 121, color, coords, ELEMENTS(coords)/2); +} + +static void poly122(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {68,109, 87,106, 107,106, 106,108, 88,108 + }; + + init(l, 122, color, coords, ELEMENTS(coords)/2); +} + +static void poly123(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {105,111, 95,112, 79,114, 71,116, 85,115, 102,113 + }; + + init(l, 123, color, coords, ELEMENTS(coords)/2); +} + +static void poly124(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {108,101, 98,99, 87,99, 78,99, 93,100, 105,102 + }; + + init(l, 124, color, coords, ELEMENTS(coords)/2); +} + +static void poly125(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {85,63, 91,63, 97,60, 104,60, 108,62, 111,69, 112,75, + 110,74, 108,71, 103,73, 106,69, 105,65, 103,64, 103,67, + 102,70, 99,70, 97,66, 94,67, 97,72, 88,67, 84,66 + }; + + init(l, 125, color, coords, ELEMENTS(coords)/2); +} + +static void poly126(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {140,74, 141,66, 144,61, 150,61, 156,62, 153,70, 150,73, + 152,65, 150,65, 151,68, 149,71, 146,71, 144,66, 143,70, + 143,74 + }; + + init(l, 126, color, coords, ELEMENTS(coords)/2); +} + +static void poly127(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {146,20, 156,11, 163,9, 172,9, 178,14, 182,18, 184,32, 182,42, + 182,52, 177,58, 176,67, 171,76, 165,90, 157,105, 160,92, 164,85, + 168,78, 167,73, 173,66, 172,62, 175,59, 174,55, 177,53, 180,46, + 181,29, 179,21, 173,13, 166,11, 159,13, 153,18, 148,23 + }; + + init(l, 127, color, coords, ELEMENTS(coords)/2); +} + +static void poly128(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {150,187, 148,211, 150,233, 153,247, 148,267, 135,283, 125,299, + 136,292, 131,313, 122,328, 122,345, 129,352, 133,359, 133,367, + 137,359, 148,356, 140,350, 131,347, 129,340, 132,332, 140,328, + 137,322, 140,304, 154,265, 157,244, 155,223, 161,220, 175,229, + 186,247, 185,260, 176,275, 178,287, 185,277, 188,261, 196,253, + 189,236, 174,213 + }; + + init(l, 128, color, coords, ELEMENTS(coords)/2); +} + +static void poly129(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {147,338, 142,341, 143,345, 141,354, 147,343 + }; + + init(l, 129, color, coords, ELEMENTS(coords)/2); +} + +static void poly130(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {157,342, 156,349, 150,356, 157,353, 163,346, 162,342 + }; + + init(l, 130, color, coords, ELEMENTS(coords)/2); +} + +static void poly131(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {99,265, 96,284, 92,299, 73,339, 73,333, 87,300 + }; + + init(l, 131, color, coords, ELEMENTS(coords)/2); +} + + +struct lion * lion_create(void) +{ + struct lion *l = calloc(1, sizeof(struct lion)); + + poly0(l); + poly1(l); + poly2(l); + poly3(l); + poly4(l); + poly5(l); + poly6(l); + poly7(l); + poly8(l); + poly9(l); + + poly10(l); + poly11(l); + poly12(l); + poly13(l); + poly14(l); + poly15(l); + poly16(l); + poly17(l); + poly18(l); + poly19(l); + + poly20(l); + poly21(l); + poly22(l); + poly23(l); + poly24(l); + poly25(l); + poly26(l); + poly27(l); + poly28(l); + poly29(l); + + poly30(l); + poly31(l); + poly32(l); + poly33(l); + poly34(l); + poly35(l); + poly36(l); + poly37(l); + poly38(l); + poly39(l); + + poly40(l); + poly41(l); + poly42(l); + poly43(l); + poly44(l); + poly45(l); + poly46(l); + poly47(l); + poly48(l); + poly49(l); + + poly50(l); + poly51(l); + poly52(l); + poly53(l); + poly54(l); + poly55(l); + poly56(l); + poly57(l); + poly58(l); + poly59(l); + + poly60(l); + poly61(l); + poly62(l); + poly63(l); + poly64(l); + poly65(l); + poly66(l); + poly67(l); + poly68(l); + poly69(l); + + poly70(l); + poly71(l); + poly72(l); + poly73(l); + poly74(l); + poly75(l); + poly76(l); + poly77(l); + poly78(l); + poly79(l); + + poly80(l); + poly81(l); + poly82(l); + poly83(l); + poly84(l); + poly85(l); + poly86(l); + poly87(l); + poly88(l); + poly89(l); + + poly90(l); + poly91(l); + poly92(l); + poly93(l); + poly94(l); + poly95(l); + poly96(l); + poly97(l); + poly98(l); + poly99(l); + + poly100(l); + poly101(l); + poly102(l); + poly103(l); + poly104(l); + poly105(l); + poly106(l); + poly107(l); + poly108(l); + poly109(l); + + poly110(l); + poly111(l); + poly112(l); + poly113(l); + poly114(l); + poly115(l); + poly116(l); + poly117(l); + poly118(l); + poly119(l); + + poly120(l); + poly121(l); + poly122(l); + poly123(l); + poly124(l); + poly125(l); + poly126(l); + poly127(l); + poly128(l); + poly129(l); + + poly130(l); + poly131(l); + + return l; +} + +void lion_render(struct lion *l) +{ + VGint i; + + for (i = 0; i < LION_SIZE; ++i) { + vgSetPaint(l->fills[i], VG_FILL_PATH); + vgDrawPath(l->paths[i], VG_FILL_PATH); + } +} + +void lion_destroy(struct lion *l) +{ + VGint i; + for (i = 0; i < LION_SIZE; ++i) { + vgDestroyPaint(l->fills[i]); + vgDestroyPath(l->paths[i]); + } + free(l); +} diff --git a/progs/openvg/demos/lion-render.h b/progs/openvg/demos/lion-render.h new file mode 100644 index 0000000000..c4c020b7ed --- /dev/null +++ b/progs/openvg/demos/lion-render.h @@ -0,0 +1,16 @@ +#ifndef LION_RENDER_H +#define LION_RENDER_H + +#include + +#define LION_SIZE 132 +struct lion { + VGPath paths[LION_SIZE]; + VGPaint fills[LION_SIZE]; +}; + +struct lion *lion_create(void); +void lion_render(struct lion *l); +void lion_destroy(struct lion *l); + +#endif diff --git a/progs/openvg/demos/lion.c b/progs/openvg/demos/lion.c new file mode 100644 index 0000000000..7224fed399 --- /dev/null +++ b/progs/openvg/demos/lion.c @@ -0,0 +1,288 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +#include "lion-render.h" + +static VGint width, height; +struct lion *lion = 0; +VGfloat angle = 0; + +static void +draw(void) +{ + vgClear(0, 0, width, height); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(width/2, height/2); + vgRotate(angle); + vgTranslate(-width/2, -height/2); + + lion_render(lion); + + ++angle; +} + + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + width = w; + height = h; +} + + +static void +init(void) +{ + float clear_color[4] = {1.0, 1.0, 1.0, 1.0}; + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + + lion = lion_create(); +} + + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + XEvent event; + + while (XPending(dpy) > 0) { + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + break; + case ConfigureNotify: + reshape(event.xconfigure.width, event.xconfigure.height); + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + break; + default: + ; /*no-op*/ + } + } + + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } +} + + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int +main(int argc, char *argv[]) +{ + const int winWidth = 350, winHeight = 450; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + else { + usage(); + return -1; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "Lion Example", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} diff --git a/progs/openvg/demos/sp.c b/progs/openvg/demos/sp.c new file mode 100644 index 0000000000..d04f252e2e --- /dev/null +++ b/progs/openvg/demos/sp.c @@ -0,0 +1,103 @@ +#include "eglcommon.h" + +#include +#include +#include +#include +#include + +#include + +struct object { + VGPath path; + VGPaint fill; + VGPaint stroke; + VGint draw_mode; +}; + +struct character { + struct object objects[32]; + VGint num_objects; +}; + +struct character cartman; + +static void init_character() +{ + struct object object; + VGint num_objects = 0; + + { + const VGint num_segments = 6; + const VGubyte segments[] = {VG_MOVE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CLOSE_PATH}; + const VGfloat coords[] = {181.83267, 102.60408, + 181.83267,102.60408 185.53793,114.5749 186.5355,115.00243, + 187.53306,115.42996 286.0073,115.00243 286.0073,115.00243, + 286.0073,115.00243 292.70526,103.45914 290.85263,101.03648, + 289.00001,98.61381 181.54765,102.31906 181.83267,102.60408 + }; + VGuint color = 0x7c4e32ff; + object.path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + vgAppendPathData(object.path, num_segments, segments, coords); + + object.fill = vgCreatePaint(); + vgSetColor(object.fill, color); + character.objects[objects.num_objects] = object; + ++objects.num_objects; + } + { + + } +} + + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +int key_press(unsigned key) +{ + switch(key) { + case XK_Right: + + break; + case XK_Left: + break; + case XK_Up: + break; + case XK_Down: + break; + case 'a': + break; + case 's': + break; + default: + break; + } + return VG_FALSE; +} + +static void +draw(void) +{ +} + + +int main(int argc, char **argv) +{ + set_window_size(400, 400); + return run(argc, argv, init, reshape, draw, key_press); +} diff --git a/progs/openvg/trivial/Makefile b/progs/openvg/trivial/Makefile new file mode 100644 index 0000000000..362360e596 --- /dev/null +++ b/progs/openvg/trivial/Makefile @@ -0,0 +1,127 @@ +# These programs aren't intended to be included with the normal distro. +# They're not too interesting but they're good for testing. + +TOP = ../../../ +include $(TOP)/configs/current + +INCLUDES = -I. -I$(TOP)/include +LIBS=-L$(TOP)/$(LIB_DIR) -lm -lEGL -lOpenVG -lpthread +CFLAGS += $(INCLUDES) + +HEADERS=eglcommon.h + +PROGRAMS = \ + arc \ + cap \ + clear \ + coord \ + dash \ + ellipse \ + filter \ + gradorigin \ + lineto \ + lingrad \ + lookup \ + mask4 \ + mask \ + path3 \ + radialgrad \ + readpixels \ + roundedrect \ + star-nonzero \ + star-oddeven \ + stroke2 \ + stroke \ + vguarc + + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + + +default: $(PROGRAMS) + + +arc: arc.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +cap: cap.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +clear: clear.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +coord: coord.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +dash: dash.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +ellipse: ellipse.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +filter: filter.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +gradorigin: gradorigin.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +image: image.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lineto: lineto.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lingrad: lingrad.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lookup: lookup.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +mask: mask.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +mask4: mask4.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +path3: path3.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +pattern: pattern.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +radialgrad: radialgrad.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +readpixels: readpixels.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +roundedrect: roundedrect.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +star-nonzero: star-nonzero.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +star-oddeven: star-oddeven.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +stroke: stroke.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +stroke2: stroke2.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +vguarc: vguarc.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + + + +eglcommon.o: eglcommon.c $(HEADERS) + $(CC) -c $(CFLAGS) eglcommon.c + + +clean: + rm -f *.o *~ + rm -f *.so + rm -f $(PROGRAMS) diff --git a/progs/openvg/trivial/arc.c b/progs/openvg/trivial/arc.c new file mode 100644 index 0000000000..db686bea6b --- /dev/null +++ b/progs/openvg/trivial/arc.c @@ -0,0 +1,139 @@ +#include "eglcommon.h" + +#include +#include + +const VGfloat clear_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; + +VGPath vgPath; + +static void ellipse(VGPath vgPath, VGfloat rx, VGfloat ry, VGfloat angle) +{ + static const VGubyte cmd[] = + { VG_MOVE_TO_ABS, VG_SCCWARC_TO_REL, VG_SCCWARC_TO_REL, VG_CLOSE_PATH }; + + VGfloat val[12]; + VGfloat c = cos(angle) * rx; + VGfloat s = sin(angle) * rx; + + val[0] = c; + val[1] = s; + val[2] = rx; + val[3] = ry; + val[4] = angle; + val[5] = -2.0f * c; + val[6] = -2.0f * s; + val[7] = rx; + val[8] = ry; + val[9] = angle; + val[10] = 2.0f * c; + val[11] = 2.0f * s; + + vgClearPath(vgPath, VG_PATH_CAPABILITY_ALL); + vgAppendPathData(vgPath, sizeof(cmd), cmd, val); + vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH); +} + +static void +init(void) +{ + VGPaint vgPaint; + + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + vgPath = vgCreatePath(VG_PATH_FORMAT_STANDARD, + VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0, + VG_PATH_CAPABILITY_ALL); + + vgPaint = vgCreatePaint(); + vgSetParameteri(vgPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetColor(vgPaint, 0x00ff00ff); + vgSetPaint(vgPaint, VG_FILL_PATH); + + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + vgSeti(VG_BLEND_MODE, VG_BLEND_SRC_OVER); + vgSetf(VG_STROKE_LINE_WIDTH, 2.0f); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_MITER); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + +#if 0 + vgLoadIdentity(); + vgTranslate(40.0f, 24.0f); + vgScale(0.61804f, 0.61804f); + vgShear(-1.0f, 0.0f); + vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH); +#else + + /* row 1, col 1: Identity transform. */ + + vgLoadIdentity(); + vgTranslate(8.0f, 8.0f); + ellipse(vgPath, 4.0f, 4.0f, 0.0f); + + /* row 1, col 2: 10^3 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(24.0f, 8.0f); + vgScale(1.0e-3f, 1.0f); + ellipse(vgPath, 4.0e3f, 4.0f, 0.0f); + + /* row 1, col 3: 10^6 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(40.0f, 8.0f); + vgScale(1.0e-6f, 1.0f); + ellipse(vgPath, 4.0e6f, 4.0f, 0.0f); + + /* row 1, col 4: 10^9 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(56.0f, 8.0f); + vgScale(1.0e-9f, 1.0f); + ellipse(vgPath, 4.0e9f, 4.0f, 0.0f); + + /* row 2, col 1: 10^3 vertical squeeze. */ + + vgLoadIdentity(); + vgTranslate(8.0f, 24.0f); + vgScale(1.0f, 1.0e-3f); + ellipse(vgPath, 4.0f, 4.0e3f, 0.0f); + + /* row 2, col 2: Shear 0. */ + + vgLoadIdentity(); + vgTranslate(24.0f, 24.0f); + vgShear(0.0f, 0.0f); + ellipse(vgPath, 4.0f, 4.0f, 0.0f); + + /* row 2, col 3: Horizontal shear -1. */ + + vgLoadIdentity(); + vgTranslate(40.0f, 24.0f); + vgScale(0.61804f, 0.61804f); + vgShear(-1.0f, 0.0f); + ellipse(vgPath, 10.47213f, 4.0f, 31.717f); +#endif + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/cap.c b/progs/openvg/trivial/cap.c new file mode 100644 index 0000000000..cd84fe3ac0 --- /dev/null +++ b/progs/openvg/trivial/cap.c @@ -0,0 +1,75 @@ +#include "eglcommon.h" + +#include + +#include +#include +#include + +static void +init(void) +{ + +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +const int subtest = 0; +static void +draw(void) +{ + VGPath line; + VGPaint fillPaint; + VGubyte lineCommands[3] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat lineCoords[] = {-2.0f,-1.0f, 0.0f,0.0f, -1.0f, -2.0f}; + VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */ + VGfloat fillColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + //VGfloat testRadius = 60.0f; + VGfloat testRadius = 10.0f; + int WINDSIZEX = window_width(); + int WINDSIZEY = window_height(); + + line = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + fillPaint = vgCreatePaint(); + + vgSetf(VG_STROKE_LINE_WIDTH, 1.0f); + //vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_ROUND); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + //vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL); + + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_BETTER); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(60, 60); + vgScale(testRadius * 2, testRadius * 2); + + vgAppendPathData(line, 3, lineCommands, lineCoords); + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + + vgSetPaint(fillPaint, VG_STROKE_PATH); + + vgSetParameterfv(fillPaint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( fillPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + vgDrawPath(line, VG_STROKE_PATH); + + vgDestroyPath(line); + vgDestroyPaint(fillPaint); +} + + +int main(int argc, char **argv) +{ + set_window_size(100, 100); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/clear.c b/progs/openvg/trivial/clear.c new file mode 100644 index 0000000000..efb6bf4182 --- /dev/null +++ b/progs/openvg/trivial/clear.c @@ -0,0 +1,42 @@ +#include "eglcommon.h" + +#include +#include + +float red_color[4] = {1.0, 0.0, 0.0, 1.0}; +float blue_color[4] = {0.0, 0.0, 1.0, 1.0}; + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + VGint scissor[4] = {100, 100, 25, 25}; + vgSetfv(VG_CLEAR_COLOR, 4, red_color); + vgClear(0, 0, window_width(), window_height()); + + vgSetfv(VG_CLEAR_COLOR, 4, blue_color); + vgClear(50, 50, 50, 50); + + //vgSetiv(VG_SCISSOR_RECTS, 4, scissor); + //vgSeti(VG_SCISSORING, VG_TRUE); + vgCopyPixels(100, 100, 50, 50, 50, 50); + vgClear(150, 150, 50, 50); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/coord.c b/progs/openvg/trivial/coord.c new file mode 100644 index 0000000000..81f7cb6fc9 --- /dev/null +++ b/progs/openvg/trivial/coord.c @@ -0,0 +1,66 @@ +#include "eglcommon.h" + +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + /* Absent VG_CLOSE_PATH */ + VGubyte commands[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + VGfloat coords[] = {-16.0f, -16.0f, 0.0f, -16.0f, 0.0f, 0.0f, -16.0f, 0.0f, + 0.0f, 0.0f, 16.0f, 0.0f, 16.0f, 16.0f, 0.0f, 16.0f}; + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(32.0f, 32.0f); + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0, + VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) + return; + fill = vgCreatePaint(); + if (fill == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + vgAppendPathData(path, 8, commands, coords); + vgSetPaint(fill, VG_FILL_PATH); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/dash.c b/progs/openvg/trivial/dash.c new file mode 100644 index 0000000000..2e84ddbd4e --- /dev/null +++ b/progs/openvg/trivial/dash.c @@ -0,0 +1,95 @@ +#include "eglcommon.h" + +#include +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + +VGint cap_style = VG_CAP_BUTT; + +static void +init(void) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_LINE_TO_ABS + }; +#if 1 + static const VGfloat coords[] = {100, 100, 150, 100, + 150, 200 + }; +#else + static const VGfloat coords[] = {100, 20, 100, 220, + }; +#endif + VGfloat dash_pattern[2] = { 20.f, 20.f }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 3, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 20); + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern); + vgSetf(VG_STROKE_DASH_PHASE, 0.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + ++cap_style; + if (cap_style > VG_CAP_SQUARE) + cap_style = VG_CAP_BUTT; + switch(cap_style) { + case VG_CAP_BUTT: + fprintf(stderr, "Cap style 'butt'\n"); + break; + case VG_CAP_ROUND: + fprintf(stderr, "Cap style 'round'\n"); + break; + case VG_CAP_SQUARE: + fprintf(stderr, "Cap style 'square'\n"); + break; + } + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/eglcommon.c b/progs/openvg/trivial/eglcommon.c new file mode 100644 index 0000000000..bacd5685d7 --- /dev/null +++ b/progs/openvg/trivial/eglcommon.c @@ -0,0 +1,288 @@ +#include "eglcommon.h" + + +#include +#include +#include +#include +#include +#include +#include +#include +#include /* using full OpenGL for now */ +#include + + +static init_func init = 0; +static draw_func draw = 0; +static reshape_func reshape = 0; +static key_func keyPress = 0; +static VGint width = 300, height = 300; + + +void set_window_size(int w, int h) +{ + width = w; + height = h; +} + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + int redraw = 0; + XEvent event; + + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + redraw = 1; + break; + case ConfigureNotify: + if (reshape) { + width = event.xconfigure.width; + height = event.xconfigure.height; + reshape(event.xconfigure.width, event.xconfigure.height); + } + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + if (!keyPress || !keyPress(code)) { + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + } + redraw = 1; + break; + default: + ; /*no-op*/ + } + + if (redraw) { + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } + } +} + +int window_width(void) +{ + return width; +} + +int window_height(void) +{ + return height; +} + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int run(int argc, char **argv, + init_func init_f, + reshape_func resh_f, + draw_func draw_f, + key_func key_f) +{ + const int winWidth = width, winHeight = height; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + init = init_f; + draw = draw_f; + reshape = resh_f; + keyPress = key_f; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "OpenVG Example", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + if (init) + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + if (reshape) + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglMakeCurrent(egl_dpy, 0, 0, 0); + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} + diff --git a/progs/openvg/trivial/eglcommon.h b/progs/openvg/trivial/eglcommon.h new file mode 100644 index 0000000000..958dae9f98 --- /dev/null +++ b/progs/openvg/trivial/eglcommon.h @@ -0,0 +1,20 @@ +#ifndef EGLCOMMON_H +#define EGLCOMMON_H + +typedef void (*init_func)(); +typedef void (*reshape_func)(int, int); +typedef void (*draw_func)(); +typedef int (*key_func)(unsigned key); + + +void set_window_size(int width, int height); +int window_width(void); +int window_height(void); + +int run(int argc, char **argv, + init_func init, + reshape_func resh, + draw_func draw, + key_func key); + +#endif diff --git a/progs/openvg/trivial/ellipse.c b/progs/openvg/trivial/ellipse.c new file mode 100644 index 0000000000..4c7d4904f8 --- /dev/null +++ b/progs/openvg/trivial/ellipse.c @@ -0,0 +1,84 @@ +#include "eglcommon.h" + +#include + +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.0, 0.0, 0.0, 1.0}; + +VGPath path; +VGPaint paint; + +static void +init(void) +{ + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + static const VGubyte segments[4] = {VG_MOVE_TO_ABS, + VG_SCCWARC_TO_ABS, + VG_SCCWARC_TO_ABS, + VG_CLOSE_PATH}; + VGfloat data[12]; + const VGfloat cx = 0, cy=29, width=80, height=40; + const VGfloat hw = width * 0.5f; + const VGfloat hh = height * 0.5f; + + data[0] = cx + hw; + data[1] = cy; + data[2] = hw; + data[3] = hh; + data[4] = 0; + data[5] = cx - hw; + data[6] = cy; + data[7] = hw; + data[8] = hh; + data[9] = 0; + data[10] = data[0]; + data[11] = cy; + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) { + return; + } + paint = vgCreatePaint(); + if (paint == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + + vgAppendPathData(path, 4, segments, data); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetPaint(paint, VG_FILL_PATH); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgLoadIdentity(); + vgTranslate(50, 21); + vgDrawPath(path, VG_FILL_PATH); + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(100, 100); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/filter.c b/progs/openvg/trivial/filter.c new file mode 100644 index 0000000000..d96257a933 --- /dev/null +++ b/progs/openvg/trivial/filter.c @@ -0,0 +1,107 @@ +#include "eglcommon.h" + +#include + +#include +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; + +VGImage srcImg; +VGImage dstImg; + +VGPaint fill; + +VGfloat bgCol[4] = {0.906f, 0.914f, 0.761f, 1.0f}; + +static void +init(void) +{ + VGfloat red[4]; + VGfloat grey[4]; + VGfloat orange[4]; + VGfloat blue[4]; + VGfloat black[4]; + VGfloat white[4]; + VGshort transKernel[49] = {0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0}; + + red[0] = 0.6710f; + red[1] = 0.1060f; + red[2] = 0.1330f; + red[3] = 1.0f; + + grey[0] = 0.6347f; + grey[1] = 0.6561f; + grey[2] = 0.6057f; + grey[3] = 1.0f; + + orange[0] = 1.0000f; + orange[1] = 0.8227f; + orange[2] = 0.5057f; + orange[3] = 1.0f; + + blue[0] = 0.0000f; + blue[1] = 0.6908f; + blue[2] = 0.8595f; + blue[3] = 1.0f; + + black[0] = 0; + black[1] = 0; + black[2] = 0; + black[3] = 1.0f; + + white[0] = 1; + white[1] = 1; + white[2] = 1; + white[3] = 1.0f; + + vgSetfv(VG_TILE_FILL_COLOR, 4, blue); + + vgSeti(VG_FILTER_CHANNEL_MASK, 14); + + /* Setup images */ + srcImg = vgCreateImage(VG_sRGBA_8888, 32, 32, + VG_IMAGE_QUALITY_NONANTIALIASED); + dstImg = vgCreateImage(VG_sRGBA_8888, 32, 32, + VG_IMAGE_QUALITY_NONANTIALIASED); + + vgSetfv(VG_CLEAR_COLOR, 4, black); + vgClearImage(srcImg, 0, 0, 32, 32); + vgSetfv(VG_CLEAR_COLOR, 4, red); + vgClearImage(srcImg, 3, 3, 27, 27); + + vgSetfv(VG_CLEAR_COLOR, 4, orange); + vgClearImage(dstImg, 0, 0, 32, 32); + + transKernel[8] = 1; + vgConvolve(dstImg, srcImg, 3, 3, 3, 0, transKernel, + 1, 0, VG_TILE_FILL); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgClear(0, 0, window_width(), window_height()); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(10, 10); + vgDrawImage(dstImg); + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/gradorigin.c b/progs/openvg/trivial/gradorigin.c new file mode 100644 index 0000000000..b376263fe5 --- /dev/null +++ b/progs/openvg/trivial/gradorigin.c @@ -0,0 +1,98 @@ +#include "eglcommon.h" + +#include + +#include +#include + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + VGubyte commands[5] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_CLOSE_PATH}; + VGfloat coords[8] = {0.0f,0.0f, 32.0f,0.0f, 32.0f,32.0f, 0.0f,32.0f }; + + VGfloat rampStop[20] = {-0.5f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.25f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.75f, 0.0f, 0.0f, 1.0f, 1.0f, + 1.5f, 0.0f, 0.0f, 0.0f, 0.0f}; + + VGfloat defaultColor[] = {1.0f, 1.0f, 1.0f, 1.0f}; + VGfloat linearGradient[4] = {0.0f, 0.0f, 0.0f, 32.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) + return; + + fill = vgCreatePaint(); + if (fill == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + + vgSetfv(VG_CLEAR_COLOR, 4, defaultColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgAppendPathData(path, 5, commands, coords); + + vgSetPaint(fill, VG_FILL_PATH); + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, + VG_COLOR_RAMP_SPREAD_REPEAT); + vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + if (argc > 1) { + const char *arg = argv[1]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(200, 200); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lineto.c b/progs/openvg/trivial/lineto.c new file mode 100644 index 0000000000..94e2981811 --- /dev/null +++ b/progs/openvg/trivial/lineto.c @@ -0,0 +1,56 @@ +#include "eglcommon.h" + +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 10); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_STROKE_PAINT_TO_USER); + vgLoadIdentity(); + vgScale(2.25, 2.25); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lingrad.c b/progs/openvg/trivial/lingrad.c new file mode 100644 index 0000000000..bcaad1f101 --- /dev/null +++ b/progs/openvg/trivial/lingrad.c @@ -0,0 +1,87 @@ +#include "eglcommon.h" + +#include + +#include +#include + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f}; + + VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.33f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.66f, 0.0f, 1.0f, 0.0f, 1.0f, + 1.00f, 0.0f, 0.0f, 1.0f, 1.0f}; + VGfloat linearGradient[4] = {100.0f, 100.0f, 300.0f, 300.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread); + vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + if (argc > 1) { + const char *arg = argv[1]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(400, 400); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lookup.c b/progs/openvg/trivial/lookup.c new file mode 100644 index 0000000000..a103ba4488 --- /dev/null +++ b/progs/openvg/trivial/lookup.c @@ -0,0 +1,71 @@ +#include "eglcommon.h" + +#include + +#include +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; +VGfloat clearColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ +VGImage parent; + +VGPaint fill; + +static void +init(void) +{ + VGImage child1, child2; + VGubyte *data; + VGuint LUT[256]; + VGint i; + + data = (VGubyte *)malloc(sizeof(VGubyte)*window_width()*window_height()); + + for (i=0;i + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 10); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); + + vgSeti(VG_MASKING, VG_TRUE); + + vgMask(VG_INVALID_HANDLE, VG_CLEAR_MASK, + 25, 25, 100, 100); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/mask4.c b/progs/openvg/trivial/mask4.c new file mode 100644 index 0000000000..fe6db39648 --- /dev/null +++ b/progs/openvg/trivial/mask4.c @@ -0,0 +1,132 @@ +#include "eglcommon.h" + +#include +#include +#include +#include +#include + +#include + +//VGint x_pos = -10, y_pos = -10; +VGint x_pos = 0, y_pos = 4; +VGint img_width = 120, img_height = 120; + +static void RectToPath(VGPath path, VGfloat x, VGfloat y, VGfloat width, VGfloat height) +{ + static const VGubyte segments[5] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_ABS, + VG_VLINE_TO_ABS, + VG_HLINE_TO_ABS, + VG_CLOSE_PATH}; + VGfloat data[5]; + + data[0] = x; + data[1] = y; + data[2] = x + width; + data[3] = y + height; + data[4] = x; + + vgAppendPathData(path, 5, segments, data); +} + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +int key_press(unsigned key) +{ + switch(key) { + case XK_Right: + x_pos +=1; + break; + case XK_Left: + x_pos -=1; + break; + case XK_Up: + y_pos +=1; + break; + case XK_Down: + y_pos -=1; + break; + case 'a': + img_width -= 5; + img_height -= 5; + break; + case 's': + img_width += 5; + img_height += 5; + break; + default: + break; + } + fprintf(stderr, "Posi = %dx%d\n", x_pos, y_pos); + fprintf(stderr, "Size = %dx%d\n", img_width, img_height); + return VG_FALSE; +} + +static void +draw(void) +{ + VGint WINDSIZEX = window_width(); + VGint WINDSIZEY = window_height(); + + VGPaint fill; + VGPath box; + VGfloat color[4] = {1.f, 0.f, 0.f, 1.f}; + VGfloat bgCol[4] = {0.7f, 0.7f, 0.7f, 1.0f}; + VGfloat transCol[4] = {0.f, 0.f, 0.f, 0.f}; + VGImage image = vgCreateImage(VG_sRGBA_8888, img_width, img_height, + VG_IMAGE_QUALITY_NONANTIALIASED); + + /* Background clear */ + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + box = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + /* Rectangle to cover completely 16x16 pixel area. */ + RectToPath(box, 0, 0, 64, 64); + + vgSetfv(VG_CLEAR_COLOR, 4, transCol); + vgClearImage(image, 0, 0, img_width, img_height); + vgSetfv(VG_CLEAR_COLOR, 4, color); + vgClearImage(image, 10, 10, 12, 12); + //vgImageSubData(image, pukki_64x64_data, pukki_64x64_stride, + // VG_sRGBA_8888, 0, 0, 32, 32); + vgSeti(VG_MASKING, VG_TRUE); + vgLoadIdentity(); + + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + + + vgMask(image, VG_FILL_MASK, 0, 0, window_width(), window_height()); + vgMask(image, VG_SET_MASK, x_pos, y_pos, 100, 100); + + vgDrawPath(box, VG_FILL_PATH); + + //vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE); + //vgTranslate(-10, -10); + //vgDrawImage(image); + + + vgDestroyPaint(fill); + vgDestroyPath(box); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/path3.c b/progs/openvg/trivial/path3.c new file mode 100644 index 0000000000..5ce600f65a --- /dev/null +++ b/progs/openvg/trivial/path3.c @@ -0,0 +1,77 @@ +#include "eglcommon.h" + +#include +#include +#include +#include +#include + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + + +static void +draw(void) +{ + VGint WINDSIZEX = window_width(); + VGint WINDSIZEY = window_height(); + VGPath path; + VGPaint paint; + + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 0.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + +#if 1 + VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_LCWARC_TO_ABS, VG_SCWARC_TO_ABS, VG_CLOSE_PATH}; +#else + VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_SCCWARC_TO_ABS, VG_LCCWARC_TO_ABS,VG_CLOSE_PATH}; +#endif + VGfloat coords[] = {32.0f, 0.0f, + -32.0f, -32.0f, 0.0f, 64.0f, 32.0f, + -32.0f, -32.0f, 0.0f, 32.0f, 0.0f}; + + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + //vgTranslate(32.0f, 32.0f); + + path = vgCreatePath( VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL ); + if ( path == VG_INVALID_HANDLE ) { + return; + } + paint = vgCreatePaint(); + if ( paint == VG_INVALID_HANDLE ) { + vgDestroyPath(path); + return; + } + + vgAppendPathData(path, 4, commands, coords); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetPaint(paint, VG_FILL_PATH); + vgDrawPath(path, VG_FILL_PATH); + + vgDestroyPath(path); + vgDestroyPaint(paint); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/radialgrad.c b/progs/openvg/trivial/radialgrad.c new file mode 100644 index 0000000000..cf3b1d522d --- /dev/null +++ b/progs/openvg/trivial/radialgrad.c @@ -0,0 +1,99 @@ +#include "eglcommon.h" + +#include + +#include +#include + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + + +VGfloat centeredGradient[5] = {200.0f, 200.0f, 200.0f, 200.0f, 100}; +VGfloat noncenteredGradient[5] = {200.0f, 200.0f, 250.0f, 250.0f, 100}; +VGfloat *radialGradient = centeredGradient; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f}; + + VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.33f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.66f, 0.0f, 1.0f, 0.0f, 1.0f, + 1.00f, 0.0f, 0.0f, 1.0f, 1.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_RADIAL_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread); + vgSetParameterfv(fill, VG_PAINT_RADIAL_GRADIENT, 5, radialGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + VGint i; + for (i = 1; i < argc; ++i) { + const char *arg = argv[i]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + else if (!strcmp("-center", arg)) { + printf("Centered radial gradient\n"); + radialGradient = centeredGradient; + } else if (!strcmp("-noncenter", arg)) { + printf("Non centered radial gradient\n"); + radialGradient = noncenteredGradient; + } + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(400, 400); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/readpixels.c b/progs/openvg/trivial/readpixels.c new file mode 100644 index 0000000000..c8e286db9a --- /dev/null +++ b/progs/openvg/trivial/readpixels.c @@ -0,0 +1,75 @@ +#include "eglcommon.h" + +#include + +#include +#include +#include +#include + +float red_color[4] = {1.0, 0.0, 0.0, 1.0}; +float blue_color[4] = {0.0, 0.0, 1.0, 1.0}; +VGint *data; + +static void +init(void) +{ + data = malloc(sizeof(VGint)*2048*2048); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + static const VGint red_pixel = 255 << 24 | 255 << 16 | 0 << 8 | 0; + static const VGint blue_pixel = 255 << 24 | 0 << 16 | 0 << 8 | 255; + VGint i; + + vgSetfv(VG_CLEAR_COLOR, 4, red_color); + vgClear(0, 0, window_width(), window_height()); + vgFlush(); + + memset(data, 0, window_width() * window_height() * sizeof(VGint)); + + vgReadPixels(data, window_width() * sizeof(VGint), + VG_lARGB_8888, + 0, 0, window_width(), window_height()); + + fprintf(stderr, "Red 0 = 0x%x and at 600 = 0x%x\n", + data[0], data[600]); + for (i = 0; i < window_width() * window_height(); ++i) { + assert(data[i] == red_pixel); + } + + vgSetfv(VG_CLEAR_COLOR, 4, blue_color); + vgClear(50, 50, 50, 50); + vgFlush(); + + memset(data, 0, window_width() * window_height() * sizeof(VGint)); + + vgReadPixels(data, 50 * sizeof(VGint), + VG_lARGB_8888, + 50, 50, 50, 50); + + fprintf(stderr, "Blue 0 = 0x%x and at 100 = 0x%x\n", + data[0], data[100]); + for (i = 0; i < 50 * 50; ++i) { + assert(data[i] == blue_pixel); + } +} + + +int main(int argc, char **argv) +{ + int ret = run(argc, argv, init, reshape, + draw, 0); + + free(data); + return ret; +} diff --git a/progs/openvg/trivial/roundedrect.c b/progs/openvg/trivial/roundedrect.c new file mode 100644 index 0000000000..c80a4ed299 --- /dev/null +++ b/progs/openvg/trivial/roundedrect.c @@ -0,0 +1,67 @@ +#include "eglcommon.h" + +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.9, 0.1, 0.1, 0.8}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[10] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CLOSE_PATH}; + static const VGfloat sqrCoords[] = { + 45.885571, 62.857143, + 154.11442, 62.857143, + 162.1236, 62.857143, 168.57142, 70.260744, 168.57142, 79.457144, + 168.57142, 123.4, + 168.57142, 132.5964, 162.1236, 140, 154.11442, 140, + 45.885571, 140, + 37.876394, 140, 31.428572, 132.5964, 31.428572, 123.4, + 31.428572, 79.457144, + 31.428572, 70.260744, 37.876394,62.857143, 45.885571,62.857143 + }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 10, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 6); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/star-nonzero.c b/progs/openvg/trivial/star-nonzero.c new file mode 100644 index 0000000000..012fbd3929 --- /dev/null +++ b/progs/openvg/trivial/star-nonzero.c @@ -0,0 +1,55 @@ +#include "eglcommon.h" + +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat coords[] = { 0, 200, + 300, 200, + 50, 0, + 150, 300, + 250, 0}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 6, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSeti(VG_FILL_RULE, VG_NON_ZERO); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH | VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/star-oddeven.c b/progs/openvg/trivial/star-oddeven.c new file mode 100644 index 0000000000..17311cf720 --- /dev/null +++ b/progs/openvg/trivial/star-oddeven.c @@ -0,0 +1,102 @@ +#include "eglcommon.h" + +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8}; +const VGfloat black_color[4] = {0.0, 0.0, 0.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void draw_point(VGfloat x, VGfloat y) +{ + + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + const VGfloat coords[] = { x - 2, y - 2, + x + 2, y - 2, + x + 2, y + 2, + x - 2, y + 2}; + VGPath path; + VGPaint fill; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_ALL); + vgAppendPathData(path, 5, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, black_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgDrawPath(path, VG_FILL_PATH); + + vgDestroyPath(path); + vgDestroyPaint(fill); +} + +static void draw_marks(VGPath path) +{ + VGfloat point[2], tangent[2]; + int i = 0; + + for (i = 0; i < 1300; i += 50) { + vgPointAlongPath(path, 0, 6, i, + point + 0, point + 1, + tangent + 0, tangent + 1); + draw_point(point[0], point[1]); + } +} + +static void +init(void) +{ + static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat coords[] = { 0, 200, + 300, 200, + 50, 0, + 150, 300, + 250, 0}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_ALL); + vgAppendPathData(path, 6, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + VGfloat point[2], tangent[2]; + int i = 0; + + vgClear(0, 0, window_width(), window_height()); + + vgSetPaint(fill, VG_FILL_PATH); + vgDrawPath(path, VG_FILL_PATH); + + draw_marks(path); + + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/stroke.c b/progs/openvg/trivial/stroke.c new file mode 100644 index 0000000000..58ae5b7bc8 --- /dev/null +++ b/progs/openvg/trivial/stroke.c @@ -0,0 +1,116 @@ +#include "eglcommon.h" + +#include +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + +VGint cap_style = VG_CAP_BUTT; +VGint join_style = VG_JOIN_MITER; + +static void +init(void) +{ +#if 0 + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_CUBIC_TO_ABS, + }; + static const VGfloat coords[] = {30, 30, 264, 0, 0, 264, 234, 234 + }; +#else + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_LINE_TO_ABS + }; + static const VGfloat coords[] = {30, 30, 202, 30, 150, 224 + }; +#endif + VGfloat dash_pattern[2] = { 20.f, 20.f }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 3, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 20); + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + vgSeti(VG_STROKE_JOIN_STYLE, join_style); + vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern); + vgSetf(VG_STROKE_DASH_PHASE, 0.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + ++cap_style; + if (cap_style > VG_CAP_SQUARE) + cap_style = VG_CAP_BUTT; + switch(cap_style) { + case VG_CAP_BUTT: + fprintf(stderr, "Cap style 'butt'\n"); + break; + case VG_CAP_ROUND: + fprintf(stderr, "Cap style 'round'\n"); + break; + case VG_CAP_SQUARE: + fprintf(stderr, "Cap style 'square'\n"); + break; + } + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + break; + case XK_j: + case XK_J: + ++join_style; + if (join_style > VG_JOIN_BEVEL) + join_style = VG_JOIN_MITER; + switch(join_style) { + case VG_JOIN_MITER: + fprintf(stderr, "Join style 'miter'\n"); + break; + case VG_JOIN_ROUND: + fprintf(stderr, "Join style 'round'\n"); + break; + case VG_JOIN_BEVEL: + fprintf(stderr, "Join style 'bevel'\n"); + break; + } + vgSeti(VG_STROKE_JOIN_STYLE, join_style); + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/stroke2.c b/progs/openvg/trivial/stroke2.c new file mode 100644 index 0000000000..ce950c1886 --- /dev/null +++ b/progs/openvg/trivial/stroke2.c @@ -0,0 +1,207 @@ +#include "eglcommon.h" + +#include +#include +#include + +VGPaint stroke; +VGPath target; +VGPath lines; + +VGfloat xform[9]; +VGfloat color1[4]; +VGfloat color2[4]; +VGfloat bgCol[4]; + +static void +init(void) +{ + VGubyte lineCmds[6]; + VGfloat lineCoords[8]; + VGfloat arcCoords[5]; + VGubyte sccCmd[1]; + VGubyte scCmd[1]; + VGubyte lccCmd[1]; + VGubyte lcCmd[1]; + VGubyte moveCmd[1]; + VGfloat moveCoords[2]; + VGint i; + + bgCol[0] = 1.0f; + bgCol[1] = 1.0f; + bgCol[2] = 1.0f; + bgCol[3] = 1.0f; + + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + stroke = vgCreatePaint(); + /* Red */ + color1[0] = 1.0f; + color1[1] = 0.0f; + color1[2] = 0.0f; + color1[3] = 1.0f; + + /* Orange */ + color2[0] = 1.0000f; + color2[1] = 1.0f; + color2[2] = 0.0f; + color2[3] = 1.0f; + vgSetPaint(stroke, VG_STROKE_PATH); + + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE); + + { + VGfloat temp[9] = {0, 0, 0, 0, 0, 0, 0, 0, 0}; + for (i = 0; i < 9; i++) + { + xform[i] = temp[i]; + } + } + vgGetMatrix(xform); + + target = vgCreatePath(VG_PATH_FORMAT_STANDARD, + VG_PATH_DATATYPE_F, 1, 0, 0, 0, VG_PATH_CAPABILITY_TRANSFORM_TO); + +#if 0 + /* Line path */ + { + VGubyte temp[6] = {VG_MOVE_TO_ABS, VG_VLINE_TO_REL, + VG_MOVE_TO_ABS, VG_VLINE_TO_REL, + VG_HLINE_TO_REL, VG_VLINE_TO_REL}; + for (i = 0; i < 6; i++) + { + lineCmds[i] = temp[i]; + } + } + { + VGfloat temp[8] = {0.5f, 0.8f, -0.6f, 0.28f, 0.6f, -0.4f, 0.44f, 0.4f}; + for (i = 0; i < 8; i++) + { + lineCoords[i] = temp[i] * window_width(); + } + } +#else + { + VGfloat temp[5] = {0.35f, 0.15f, 29, 0.3f, 0.4f}; + for (i = 0; i < 5; i++) + { + arcCoords[i] = temp[i] * window_width(); + } + arcCoords[2] = 29; + } + + { + VGubyte temp[1] = {VG_SCCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + sccCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_SCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + scCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_LCCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + lccCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_LCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + lcCmd[i] = temp[i]; + } + } + + { + VGubyte temp[1] = {VG_MOVE_TO_ABS}; + for (i = 0; i < 1; i++) + { + moveCmd[i] = temp[i]; + } + } + { + VGfloat temp[2] = {0.7f, 0.6f}; + for (i = 0; i < 2; i++) + { + moveCoords[i] = temp[i] * window_width(); + } + } +#endif + + lines = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, + 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO| + VG_PATH_CAPABILITY_TRANSFORM_FROM); +#if 0 + vgAppendPathData(lines, 6, lineCmds, lineCoords); +#else + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, sccCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, scCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, lccCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, lcCmd, arcCoords); +#endif + + vgLoadIdentity(); + vgTranslate(0.25f * window_width(), 0.25f * window_height()); + vgRotate(30); + vgTranslate(-0.25f * window_width(), -0.25f * window_height()); + vgTransformPath(target, lines);} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgLoadMatrix(xform); + vgLoadIdentity(); + vgTranslate(0.25f * window_width(), 0.25f * window_height()); + vgRotate(30); + vgTranslate(-0.25f * window_width(), -0.25f * window_height()); + vgSetf(VG_STROKE_LINE_WIDTH, 7); + vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color1); + vgDrawPath(lines, VG_STROKE_PATH); + + vgLoadMatrix(xform); + vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color2); + vgSetf(VG_STROKE_LINE_WIDTH, 3); + vgDrawPath(target, VG_STROKE_PATH); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + break; + case XK_j: + case XK_J: + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/vguarc.c b/progs/openvg/trivial/vguarc.c new file mode 100644 index 0000000000..8d971d5c09 --- /dev/null +++ b/progs/openvg/trivial/vguarc.c @@ -0,0 +1,74 @@ +#include "eglcommon.h" + +#include +#include + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint paint; + + +static void +init(void) +{ + VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */ + VGfloat greenColor[] = {0.0f, 1.0f, 0.0f, 1.0f};/* green color */ + VGint arcType = VGU_ARC_OPEN; + VGfloat x, y, w, h, startAngle, angleExtent; + + x = 150; + y = 150; + w = 150; + h = 150; +#if 0 + startAngle = -540.0f; + angleExtent = 270.0f; +#else + startAngle = 270.0f; + angleExtent = 90.0f; +#endif + + paint = vgCreatePaint(); + + vgSetPaint(paint, VG_STROKE_PATH); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, greenColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetf(VG_STROKE_LINE_WIDTH, 6.0f); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + + vguArc(path, x, y, w, h, startAngle, angleExtent, arcType); + + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + // set_window_size(64, 63); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/src/gallium/state_trackers/vega/Makefile b/src/gallium/state_trackers/vega/Makefile new file mode 100644 index 0000000000..b8c805b06c --- /dev/null +++ b/src/gallium/state_trackers/vega/Makefile @@ -0,0 +1,128 @@ +# src/mesa/Makefile + +TOP = ../../../.. +include $(TOP)/configs/current +GALLIUM = $(TOP) + +### Lists of source files, included by Makefiles + +VG_SOURCES = \ + api_context.c \ + api_filters.c \ + api_images.c \ + api_masks.c \ + api_misc.c \ + api_paint.c \ + api_params.c \ + api_path.c \ + api_text.c \ + api_transform.c \ + vgu.c \ + vg_context.c \ + vg_state.c \ + vg_tracker.c \ + vg_translate.c \ + polygon.c \ + bezier.c \ + path.c \ + paint.c \ + arc.c \ + image.c \ + renderer.c \ + stroker.c \ + mask.c \ + shader.c \ + shaders_cache.c + + +### All the core C sources + +ALL_SOURCES = \ + $(VG_SOURCES) + + +### Object files +VG_OBJECTS = \ + $(VG_SOURCES:.c=.o) + +### Include directories + +INCLUDE_DIRS = \ + -I$(TOP)/include \ + -I$(GALLIUM)/include \ + -I$(GALLIUM)/src/gallium/include \ + -I$(GALLIUM)/src/gallium/auxiliary + +VG_LIB = OpenVG +VG_LIB_NAME = lib$(VG_LIB).so + +VG_MAJOR = 1 +VG_MINOR = 0 +VG_TINY = 0 + +GALLIUM_LIBS = \ + $(GALLIUM)/src/gallium/auxiliary/pipebuffer/libpipebuffer.a \ + $(GALLIUM)/src/gallium/auxiliary/sct/libsct.a \ + $(GALLIUM)/src/gallium/auxiliary/draw/libdraw.a \ + $(GALLIUM)/src/gallium/auxiliary/rtasm/librtasm.a \ + $(GALLIUM)/src/gallium/auxiliary/translate/libtranslate.a \ + $(GALLIUM)/src/gallium/auxiliary/cso_cache/libcso_cache.a \ + $(GALLIUM)/src/gallium/auxiliary/util/libutil.a \ + $(GALLIUM)/src/gallium/auxiliary/tgsi/libtgsi.a + +.SUFFIXES : .cpp + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + +.cpp.o: + $(CXX) -c $(INCLUDE_DIRS) $(CXXFLAGS) $< -o $@ + +.S.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + +default: depend subdirs $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME) + +# Make the OpenVG library +$(TOP)/$(LIB_DIR)/$(VG_LIB_NAME): $(VG_OBJECTS) $(GALLIUM_LIBS) + $(TOP)/bin/mklib -o $(VG_LIB) \ + -major $(VG_MAJOR) \ + -minor $(VG_MINOR) \ + -patch $(VG_TINY) \ + -install $(TOP)/$(LIB_DIR) \ + $(VG_OBJECTS) $(GALLIUM_LIBS) \ + -Wl,--whole-archive $(LIBS) -Wl,--no-whole-archive $(SYS_LIBS) + +###################################################################### +# Generic stuff + +depend: $(ALL_SOURCES) + @ echo "running $(MKDEP)" + @ rm -f depend # workaround oops on gutsy?!? + @ touch depend + @ $(MKDEP) $(MKDEP_OPTIONS) $(DEFINES) $(INCLUDE_DIRS) $(ALL_SOURCES) \ + > /dev/null 2>/dev/null + + +subdirs: + +install: default + $(INSTALL) -d $(INSTALL_DIR)/include/VG + $(INSTALL) -d $(INSTALL_DIR)/$(LIB_DIR) + $(INSTALL) -m 644 $(TOP)/include/VG/*.h $(INSTALL_DIR)/include/VG + @if [ -e $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME) ]; then \ + $(INSTALL) $(TOP)/$(LIB_DIR)/libOpenVG* $(INSTALL_DIR)/$(LIB_DIR); \ + fi + +# Emacs tags +tags: + etags `find . -name \*.[ch]` $(TOP)/include/VG/*.h + +clean: + -rm -f *.o + -rm -f */*.o + -rm -f */*/*.o + -rm -f depend depend.bak + +include depend diff --git a/src/gallium/state_trackers/vega/api_consts.h b/src/gallium/state_trackers/vega/api_consts.h new file mode 100644 index 0000000000..e1b48d4a46 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_consts.h @@ -0,0 +1,56 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef API_CONSTS_H +#define API_CONSTS_H + +/*must be at least 32*/ +#define VEGA_MAX_SCISSOR_RECTS 32 + +/*must be at least 16*/ +#define VEGA_MAX_DASH_COUNT 32 + +/*must be at least 7*/ +#define VEGA_MAX_KERNEL_SIZE 7 + +/*must be at least 15*/ +#define VEGA_MAX_SEPARABLE_KERNEL_SIZE 15 + +/*must be at least 32*/ +#define VEGA_MAX_COLOR_RAMP_STOPS 256 + +#define VEGA_MAX_IMAGE_WIDTH 2048 + +#define VEGA_MAX_IMAGE_HEIGHT 2048 + +#define VEGA_MAX_IMAGE_PIXELS (2048*2048) + +#define VEGA_MAX_IMAGE_BYTES (2048*2048 * 4) + +/*must be at least 128*/ +#define VEGA_MAX_GAUSSIAN_STD_DEVIATION 128 + +#endif diff --git a/src/gallium/state_trackers/vega/api_context.c b/src/gallium/state_trackers/vega/api_context.c new file mode 100644 index 0000000000..47db102dd2 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_context.c @@ -0,0 +1,75 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" + +VGErrorCode vgGetError(void) +{ + struct vg_context *ctx = vg_current_context(); + VGErrorCode error = VG_NO_CONTEXT_ERROR; + + if (!ctx) + return error; + + error = ctx->_error; + ctx->_error = VG_NO_ERROR; + + return error; +} + +void vgFlush(void) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe; + + if (!ctx) + return; + + pipe = ctx->pipe; + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); +} + +void vgFinish(void) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_fence_handle *fence = NULL; + struct pipe_context *pipe; + + if (!ctx) + return; + + pipe = ctx->pipe; + + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME, &fence); + + pipe->screen->fence_finish(pipe->screen, fence, 0); + pipe->screen->fence_reference(pipe->screen, &fence, NULL); +} diff --git a/src/gallium/state_trackers/vega/api_filters.c b/src/gallium/state_trackers/vega/api_filters.c new file mode 100644 index 0000000000..862cbb03c4 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_filters.c @@ -0,0 +1,805 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "image.h" +#include "renderer.h" +#include "shaders_cache.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "util/u_memory.h" + + +#include "asm_filters.h" + + +struct filter_info { + struct vg_image *dst; + struct vg_image *src; + struct vg_shader * (*setup_shader)(struct vg_context *, void *); + void *user_data; + const void *const_buffer; + VGint const_buffer_len; + VGTilingMode tiling_mode; + struct pipe_texture *extra_texture; +}; + +static INLINE struct pipe_texture *create_texture_1d(struct vg_context *ctx, + const VGuint *color_data, + const VGint color_data_len) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_texture *tex = 0; + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + templ.target = PIPE_TEXTURE_1D; + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + templ.last_level = 0; + templ.width[0] = color_data_len; + templ.height[0] = 1; + templ.depth[0] = 1; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block); + templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + tex = screen->texture_create(screen, &templ); + + { /* upload color_data */ + struct pipe_transfer *transfer = + screen->get_tex_transfer(screen, tex, + 0, 0, 0, + PIPE_TRANSFER_READ_WRITE , + 0, 0, tex->width[0], tex->height[0]); + void *map = screen->transfer_map(screen, transfer); + memcpy(map, color_data, sizeof(VGint)*color_data_len); + screen->transfer_unmap(screen, transfer); + screen->tex_transfer_destroy(transfer); + } + + return tex; +} + +static INLINE struct pipe_surface * setup_framebuffer(struct vg_image *dst) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_framebuffer_state fb; + struct pipe_surface *dst_surf = pipe->screen->get_tex_surface( + pipe->screen, dst->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* drawing dest */ + memset(&fb, 0, sizeof(fb)); + fb.width = dst->x + dst_surf->width; + fb.height = dst->y + dst_surf->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst_surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso_context, &fb); + + return dst_surf; +} + +static void setup_viewport(struct vg_image *dst) +{ + struct vg_context *ctx = vg_current_context(); + vg_set_viewport(ctx, VEGA_Y0_TOP); +} + +static void setup_blend() +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + if (ctx->state.vg.filter_channel_mask & VG_RED) + blend.colormask |= PIPE_MASK_R; + if (ctx->state.vg.filter_channel_mask & VG_GREEN) + blend.colormask |= PIPE_MASK_G; + if (ctx->state.vg.filter_channel_mask & VG_BLUE) + blend.colormask |= PIPE_MASK_B; + if (ctx->state.vg.filter_channel_mask & VG_ALPHA) + blend.colormask |= PIPE_MASK_A; + blend.blend_enable = 1; + cso_set_blend(ctx->cso_context, &blend); +} + +static void setup_constant_buffer(struct vg_context *ctx, const void *buffer, + VGint param_bytes) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_constant_buffer *cbuf = &ctx->filter.buffer; + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(pipe->screen, 16, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, buffer); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); +} + +static void setup_samplers(struct vg_context *ctx, struct filter_info *info) +{ + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct pipe_sampler_state sampler[3]; + int num_samplers = 0; + int num_textures = 0; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + samplers[3] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + textures[3] = NULL; + + memset(&sampler[0], 0, sizeof(struct pipe_sampler_state)); + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].min_img_filter = PIPE_TEX_MIPFILTER_LINEAR; + sampler[0].mag_img_filter = PIPE_TEX_MIPFILTER_LINEAR; + sampler[0].normalized_coords = 1; + + switch(info->tiling_mode) { + case VG_TILE_FILL: + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + memcpy(sampler[0].border_color, + ctx->state.vg.tile_fill_color, + sizeof(VGfloat) * 4); + break; + case VG_TILE_PAD: + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_TILE_REPEAT: + sampler[0].wrap_s = PIPE_TEX_WRAP_REPEAT; + sampler[0].wrap_t = PIPE_TEX_WRAP_REPEAT; + break; + case VG_TILE_REFLECT: + sampler[0].wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + sampler[0].wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + default: + debug_assert(!"Unknown tiling mode"); + } + + samplers[0] = &sampler[0]; + textures[0] = info->src->texture; + ++num_samplers; + ++num_textures; + + if (info->extra_texture) { + memcpy(&sampler[1], &sampler[0], sizeof(struct pipe_sampler_state)); + samplers[1] = &sampler[1]; + textures[1] = info->extra_texture; + ++num_samplers; + ++num_textures; + } + + + cso_set_samplers(ctx->cso_context, num_samplers, (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, num_textures, textures); +} + +static struct vg_shader * setup_color_matrix(struct vg_context *ctx, void *user_data) +{ + struct vg_shader *shader = + shader_create_from_text(ctx->pipe, color_matrix_asm, 200, + PIPE_SHADER_FRAGMENT); + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static struct vg_shader * setup_convolution(struct vg_context *ctx, void *user_data) +{ + char buffer[1024]; + VGint num_consts = (VGint)(long)(user_data); + struct vg_shader *shader; + + snprintf(buffer, 1023, convolution_asm, num_consts, num_consts / 2 + 1); + + shader = shader_create_from_text(ctx->pipe, buffer, 200, + PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static struct vg_shader * setup_lookup(struct vg_context *ctx, void *user_data) +{ + struct vg_shader *shader = + shader_create_from_text(ctx->pipe, lookup_asm, + 200, PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + + +static struct vg_shader * setup_lookup_single(struct vg_context *ctx, void *user_data) +{ + char buffer[1024]; + VGImageChannel channel = (VGImageChannel)(user_data); + struct vg_shader *shader; + + switch(channel) { + case VG_RED: + snprintf(buffer, 1023, lookup_single_asm, "xxxx"); + break; + case VG_GREEN: + snprintf(buffer, 1023, lookup_single_asm, "yyyy"); + break; + case VG_BLUE: + snprintf(buffer, 1023, lookup_single_asm, "zzzz"); + break; + case VG_ALPHA: + snprintf(buffer, 1023, lookup_single_asm, "wwww"); + break; + default: + debug_assert(!"Unknown color channel"); + } + + shader = shader_create_from_text(ctx->pipe, buffer, 200, + PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static void execute_filter(struct vg_context *ctx, + struct filter_info *info) +{ + struct pipe_surface *dst_surf; + struct vg_shader *shader; + + cso_save_framebuffer(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_samplers(ctx->cso_context); + cso_save_sampler_textures(ctx->cso_context); + + dst_surf = setup_framebuffer(info->dst); + setup_viewport(info->dst); + setup_blend(); + setup_constant_buffer(ctx, info->const_buffer, info->const_buffer_len); + shader = info->setup_shader(ctx, info->user_data); + setup_samplers(ctx, info); + + renderer_draw_texture(ctx->renderer, + info->src->texture, + info->dst->x, info->dst->y, + info->dst->x + info->dst->width, + info->dst->y + info->dst->height, + info->dst->x, info->dst->y, + info->dst->x + info->dst->width, + info->dst->y + info->dst->height); + + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + cso_restore_blend(ctx->cso_context); + cso_restore_samplers(ctx->cso_context); + cso_restore_sampler_textures(ctx->cso_context); + + vg_shader_destroy(ctx, shader); + + pipe_surface_reference(&dst_surf, NULL); +} + +void vgColorMatrix(VGImage dst, VGImage src, + const VGfloat * matrix) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!matrix || !is_aligned(matrix)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_color_matrix; + info.user_data = NULL; + info.const_buffer = matrix; + info.const_buffer_len = 20 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = 0; + execute_filter(ctx, &info); +} + +static VGfloat texture_offset(VGfloat width, VGint kernelSize, VGint current, VGint shift) +{ + VGfloat diff = current - shift; + + return diff / width; +} + +void vgConvolve(VGImage dst, VGImage src, + VGint kernelWidth, VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernel, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat *buffer; + VGint buffer_len; + VGint i, j; + VGint idx = 0; + struct vg_image *d, *s; + VGint kernel_size = kernelWidth * kernelHeight; + struct filter_info info; + const VGint max_kernel_size = vgGeti(VG_MAX_KERNEL_SIZE); + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (kernelWidth <= 0 || kernelHeight <= 0 || + kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!kernel || !is_aligned_to(kernel, 2)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); + + buffer_len = 8 + 2 * 4 * kernel_size; + buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat)); + + buffer[0] = 0.f; + buffer[1] = 1.f; + buffer[2] = 2.f; /*unused*/ + buffer[3] = 4.f; /*unused*/ + + buffer[4] = kernelWidth * kernelHeight; + buffer[5] = scale; + buffer[6] = bias; + buffer[7] = 0.f; + + idx = 8; + for (j = 0; j < kernelHeight; ++j) { + for (i = 0; i < kernelWidth; ++i) { + VGint index = j * kernelWidth + i; + VGfloat x, y; + + x = texture_offset(s->width, kernelWidth, i, shiftX); + y = texture_offset(s->height, kernelHeight, j, shiftY); + + buffer[idx + index*4 + 0] = x; + buffer[idx + index*4 + 1] = y; + buffer[idx + index*4 + 2] = 0.f; + buffer[idx + index*4 + 3] = 0.f; + } + } + idx += kernel_size * 4; + + for (j = 0; j < kernelHeight; ++j) { + for (i = 0; i < kernelWidth; ++i) { + /* transpose the kernel */ + VGint index = j * kernelWidth + i; + VGint kindex = (kernelWidth - i - 1) * kernelHeight + (kernelHeight - j - 1); + buffer[idx + index*4 + 0] = kernel[kindex]; + buffer[idx + index*4 + 1] = kernel[kindex]; + buffer[idx + index*4 + 2] = kernel[kindex]; + buffer[idx + index*4 + 3] = kernel[kindex]; + } + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_convolution; + info.user_data = (void*)(long)(buffer_len/4); + info.const_buffer = buffer; + info.const_buffer_len = buffer_len * sizeof(VGfloat); + info.tiling_mode = tilingMode; + info.extra_texture = 0; + execute_filter(ctx, &info); + + free(buffer); +} + +void vgSeparableConvolve(VGImage dst, VGImage src, + VGint kernelWidth, + VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernelX, + const VGshort * kernelY, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + VGshort *kernel; + VGint i, j, idx = 0; + const VGint max_kernel_size = vgGeti(VG_MAX_SEPARABLE_KERNEL_SIZE); + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (kernelWidth <= 0 || kernelHeight <= 0 || + kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!kernelX || !kernelY || + !is_aligned_to(kernelX, 2) || !is_aligned_to(kernelY, 2)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + kernel = malloc(sizeof(VGshort)*kernelWidth*kernelHeight); + for (i = 0; i < kernelWidth; ++i) { + for (j = 0; j < kernelHeight; ++j) { + kernel[idx] = kernelX[i] * kernelY[j]; + ++idx; + } + } + vgConvolve(dst, src, kernelWidth, kernelHeight, shiftX, shiftY, + kernel, scale, bias, tilingMode); + free(kernel); +} + +static INLINE VGfloat compute_gaussian_componenet(VGfloat x, VGfloat y, + VGfloat stdDeviationX, + VGfloat stdDeviationY) +{ + VGfloat mult = 1 / ( 2 * M_PI * stdDeviationX * stdDeviationY); + VGfloat e = exp( - ( pow(x, 2)/(2*pow(stdDeviationX, 2)) + + pow(y, 2)/(2*pow(stdDeviationY, 2)) ) ); + return mult * e; +} + +static INLINE VGint compute_kernel_size(VGfloat deviation) +{ + VGint size = ceil(2.146 * deviation); + if (size > 11) + return 11; + return size; +} + +static void compute_gaussian_kernel(VGfloat *kernel, + VGint width, VGint height, + VGfloat stdDeviationX, + VGfloat stdDeviationY) +{ + VGint i, j; + VGfloat scale = 0.0f; + + for (j = 0; j < height; ++j) { + for (i = 0; i < width; ++i) { + VGint idx = (height - j -1) * width + (width - i -1); + kernel[idx] = compute_gaussian_componenet(i-(ceil(width/2))-1, + j-ceil(height/2)-1, + stdDeviationX, stdDeviationY); + scale += kernel[idx]; + } + } + + for (j = 0; j < height; ++j) { + for (i = 0; i < width; ++i) { + VGint idx = j * width + i; + kernel[idx] /= scale; + } + } +} + +void vgGaussianBlur(VGImage dst, VGImage src, + VGfloat stdDeviationX, + VGfloat stdDeviationY, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + VGfloat *buffer, *kernel; + VGint kernel_width, kernel_height, kernel_size; + VGint buffer_len; + VGint idx, i, j; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (stdDeviationX <= 0 || stdDeviationY <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + kernel_width = compute_kernel_size(stdDeviationX); + kernel_height = compute_kernel_size(stdDeviationY); + kernel_size = kernel_width * kernel_height; + kernel = malloc(sizeof(VGfloat)*kernel_size); + compute_gaussian_kernel(kernel, kernel_width, kernel_height, + stdDeviationX, stdDeviationY); + + buffer_len = 8 + 2 * 4 * kernel_size; + buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat)); + + buffer[0] = 0.f; + buffer[1] = 1.f; + buffer[2] = 2.f; /*unused*/ + buffer[3] = 4.f; /*unused*/ + + buffer[4] = kernel_width * kernel_height; + buffer[5] = 1.f;/*scale*/ + buffer[6] = 0.f;/*bias*/ + buffer[7] = 0.f; + + idx = 8; + for (j = 0; j < kernel_height; ++j) { + for (i = 0; i < kernel_width; ++i) { + VGint index = j * kernel_width + i; + VGfloat x, y; + + x = texture_offset(s->width, kernel_width, i, kernel_width/2); + y = texture_offset(s->height, kernel_height, j, kernel_height/2); + + buffer[idx + index*4 + 0] = x; + buffer[idx + index*4 + 1] = y; + buffer[idx + index*4 + 2] = 0.f; + buffer[idx + index*4 + 3] = 0.f; + } + } + idx += kernel_size * 4; + + for (j = 0; j < kernel_height; ++j) { + for (i = 0; i < kernel_width; ++i) { + /* transpose the kernel */ + VGint index = j * kernel_width + i; + VGint kindex = (kernel_width - i - 1) * kernel_height + (kernel_height - j - 1); + buffer[idx + index*4 + 0] = kernel[kindex]; + buffer[idx + index*4 + 1] = kernel[kindex]; + buffer[idx + index*4 + 2] = kernel[kindex]; + buffer[idx + index*4 + 3] = kernel[kindex]; + } + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_convolution; + info.user_data = (void*)(long)(buffer_len/4); + info.const_buffer = buffer; + info.const_buffer_len = buffer_len * sizeof(VGfloat); + info.tiling_mode = tilingMode; + info.extra_texture = 0; + execute_filter(ctx, &info); + + free(buffer); + free(kernel); +} + +void vgLookup(VGImage dst, VGImage src, + const VGubyte * redLUT, + const VGubyte * greenLUT, + const VGubyte * blueLUT, + const VGubyte * alphaLUT, + VGboolean outputLinear, + VGboolean outputPremultiplied) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + VGuint color_data[256]; + VGint i; + struct pipe_texture *lut_texture; + VGfloat buffer[4]; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!redLUT || !greenLUT || !blueLUT || !alphaLUT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < 256; ++i) { + color_data[i] = blueLUT[i] << 24 | greenLUT[i] << 16 | + redLUT[i] << 8 | alphaLUT[i]; + } + lut_texture = create_texture_1d(ctx, color_data, 255); + + buffer[0] = 0.f; + buffer[1] = 0.f; + buffer[2] = 1.f; + buffer[3] = 1.f; + + info.dst = d; + info.src = s; + info.setup_shader = &setup_lookup; + info.user_data = NULL; + info.const_buffer = buffer; + info.const_buffer_len = 4 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = lut_texture; + + execute_filter(ctx, &info); + + pipe_texture_reference(&lut_texture, NULL); +} + +void vgLookupSingle(VGImage dst, VGImage src, + const VGuint * lookupTable, + VGImageChannel sourceChannel, + VGboolean outputLinear, + VGboolean outputPremultiplied) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + struct pipe_texture *lut_texture; + VGfloat buffer[4]; + struct filter_info info; + VGuint color_data[256]; + VGint i; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!lookupTable || !is_aligned(lookupTable)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (sourceChannel != VG_RED && sourceChannel != VG_GREEN && + sourceChannel != VG_BLUE && sourceChannel != VG_ALPHA) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < 256; ++i) { + VGuint rgba = lookupTable[i]; + VGubyte blue, green, red, alpha; + red = (rgba & 0xff000000)>>24; + green = (rgba & 0x00ff0000)>>16; + blue = (rgba & 0x0000ff00)>> 8; + alpha = (rgba & 0x000000ff)>> 0; + color_data[i] = blue << 24 | green << 16 | + red << 8 | alpha; + } + lut_texture = create_texture_1d(ctx, color_data, 256); + + buffer[0] = 0.f; + buffer[1] = 0.f; + buffer[2] = 1.f; + buffer[3] = 1.f; + + info.dst = d; + info.src = s; + info.setup_shader = &setup_lookup_single; + info.user_data = (void*)sourceChannel; + info.const_buffer = buffer; + info.const_buffer_len = 4 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = lut_texture; + + execute_filter(ctx, &info); + + pipe_texture_reference(&lut_texture, NULL); +} diff --git a/src/gallium/state_trackers/vega/api_images.c b/src/gallium/state_trackers/vega/api_images.c new file mode 100644 index 0000000000..c437553bc2 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_images.c @@ -0,0 +1,489 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "image.h" + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "vg_translate.h" +#include "api_consts.h" +#include "image.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_blit.h" +#include "util/u_tile.h" +#include "util/u_memory.h" + +static INLINE VGboolean supported_image_format(VGImageFormat format) +{ + switch(format) { + case VG_sRGBX_8888: + case VG_sRGBA_8888: + case VG_sRGBA_8888_PRE: + case VG_sRGB_565: + case VG_sRGBA_5551: + case VG_sRGBA_4444: + case VG_sL_8: + case VG_lRGBX_8888: + case VG_lRGBA_8888: + case VG_lRGBA_8888_PRE: + case VG_lL_8: + case VG_A_8: + case VG_BW_1: +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + case VG_A_4: +#endif + case VG_sXRGB_8888: + case VG_sARGB_8888: + case VG_sARGB_8888_PRE: + case VG_sARGB_1555: + case VG_sARGB_4444: + case VG_lXRGB_8888: + case VG_lARGB_8888: + case VG_lARGB_8888_PRE: + case VG_sBGRX_8888: + case VG_sBGRA_8888: + case VG_sBGRA_8888_PRE: + case VG_sBGR_565: + case VG_sBGRA_5551: + case VG_sBGRA_4444: + case VG_lBGRX_8888: + case VG_lBGRA_8888: + case VG_lBGRA_8888_PRE: + case VG_sXBGR_8888: + case VG_sABGR_8888: + case VG_sABGR_8888_PRE: + case VG_sABGR_1555: + case VG_sABGR_4444: + case VG_lXBGR_8888: + case VG_lABGR_8888: + case VG_lABGR_8888_PRE: + return VG_TRUE; + default: + return VG_FALSE; + } + return VG_FALSE; +} + +VGImage vgCreateImage(VGImageFormat format, + VGint width, VGint height, + VGbitfield allowedQuality) +{ + struct vg_context *ctx = vg_current_context(); + + if (!supported_image_format(format)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return VG_INVALID_HANDLE; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (width > vgGeti(VG_MAX_IMAGE_WIDTH) || + height > vgGeti(VG_MAX_IMAGE_HEIGHT)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (width * height > vgGeti(VG_MAX_IMAGE_PIXELS)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + if (!(allowedQuality & ((VG_IMAGE_QUALITY_NONANTIALIASED | + VG_IMAGE_QUALITY_FASTER | + VG_IMAGE_QUALITY_BETTER)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGImage)image_create(format, width, height); +} + +void vgDestroyImage(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img = (struct vg_image *)image; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!vg_object_is_valid((void*)image, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + image_destroy(img); +} + +void vgClearImage(VGImage image, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)image; + + if (x + width < 0 || y + height < 0) + return; + + image_clear(img, x, y, width, height); + +} + +void vgImageSubData(VGImage image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (width <= 0 || height <= 0 || !data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)(image); + image_sub_data(img, data, dataStride, dataFormat, + x, y, width, height); +} + +void vgGetImageSubData(VGImage image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (width <= 0 || height <= 0 || !data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + img = (struct vg_image*)image; + image_get_sub_data(img, data, dataStride, dataFormat, + x, y, width, height); +} + +VGImage vgChildImage(VGImage parent, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *p; + + if (parent == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void*)parent) || + !vg_object_is_valid((void*)parent, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_INVALID_HANDLE; + } + if (width <= 0 || height <= 0 || x < 0 || y < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + p = (struct vg_image *)parent; + if (x > p->width || y > p->height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (x + width > p->width || y + height > p->height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGImage)image_child_image(p, x, y, width, height); +} + +VGImage vgGetParent(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_INVALID_HANDLE; + } + + img = (struct vg_image*)image; + if (img->parent) + return (VGImage)img->parent; + else + return image; +} + +void vgCopyImage(VGImage dst, VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) +{ + struct vg_context *ctx = vg_current_context(); + + if (src == VG_INVALID_HANDLE || dst == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + vg_validate_state(ctx); + image_copy((struct vg_image*)dst, dx, dy, + (struct vg_image*)src, sx, sy, + width, height, dither); +} + +void vgDrawImage(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + + if (!ctx) + return; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + vg_validate_state(ctx); + image_draw((struct vg_image*)image); +} + +void vgSetPixels(VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + vg_validate_state(ctx); + + if (src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + image_set_pixels(dx, dy, (struct vg_image*)src, sx, sy, width, + height); +} + +void vgGetPixels(VGImage dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (dst == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)dst; + + image_get_pixels(img, dx, dy, + sx, sy, width, height); +} + +void vgWritePixels(const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (!data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); + { + struct vg_image *img = image_create(dataFormat, width, height); + image_sub_data(img, data, dataStride, dataFormat, 0, 0, + width, height); +#if 0 + struct matrix *matrix = &ctx->state.vg.image_user_to_surface_matrix; + matrix_translate(matrix, dx, dy); + image_draw(img); + matrix_translate(matrix, -dx, -dy); +#else + /* this looks like a better approach */ + image_set_pixels(dx, dy, img, 0, 0, width, height); +#endif + image_destroy(img); + } + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); +} + +void vgReadPixels(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = (fb->height - sy) - 1, yStep = -1; + VGint i; + VGubyte *dst = (VGubyte *)data; + VGint xoffset = 0, yoffset = 0; + + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (!data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + if (sx < 0) { + xoffset = -sx; + xoffset *= _vega_size_for_format(dataFormat); + width += sx; + sx = 0; + } + if (sy < 0) { + yoffset = -sy; + height += sy; + sy = 0; + y = (fb->height - sy) - 1; + yoffset *= dataStride; + } + + { + struct pipe_transfer *transfer; + + transfer = screen->get_tex_transfer(screen, strb->texture, 0, 0, 0, + PIPE_TRANSFER_READ, + 0, 0, width, height); + + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(transfer, sx, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, + dst + yoffset + xoffset); + dst += dataStride; + } + + screen->tex_transfer_destroy(transfer); + } +} + +void vgCopyPixels(VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + /* do nothing if we copy from outside the fb */ + if (dx >= (VGint)fb->width || dy >= (VGint)fb->height || + sx >= (VGint)fb->width || sy >= (VGint)fb->height) + return; + + vg_validate_state(ctx); + /* make sure rendering has completed */ + vgFinish(); + + vg_copy_surface(ctx, strb->surface, dx, dy, + strb->surface, sx, sy, width, height); +} diff --git a/src/gallium/state_trackers/vega/api_masks.c b/src/gallium/state_trackers/vega/api_masks.c new file mode 100644 index 0000000000..4f9f3dae17 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_masks.c @@ -0,0 +1,373 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "mask.h" +#include "renderer.h" + +#include "vg_context.h" +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/internal/p_winsys_screen.h" /* for winsys->update_buffer */ + +#include "util/u_pack_color.h" +#include "util/u_draw_quad.h" +#include "util/u_memory.h" + + +#define DISABLE_1_1_MASKING 1 + +/** + * Draw a screen-aligned quadrilateral. + * Coords are window coords with y=0=bottom. These coords will be transformed + * by the vertex shader and viewport transform. + */ +static void +draw_clear_quad(struct vg_context *st, + float x0, float y0, float x1, float y1, float z, + const VGfloat color[4]) +{ + struct pipe_context *pipe = st->pipe; + struct pipe_buffer *buf; + VGuint i; + + /* positions */ + st->clear.vertices[0][0][0] = x0; + st->clear.vertices[0][0][1] = y0; + + st->clear.vertices[1][0][0] = x1; + st->clear.vertices[1][0][1] = y0; + + st->clear.vertices[2][0][0] = x1; + st->clear.vertices[2][0][1] = y1; + + st->clear.vertices[3][0][0] = x0; + st->clear.vertices[3][0][1] = y1; + + /* same for all verts: */ + for (i = 0; i < 4; i++) { + st->clear.vertices[i][0][2] = z; + st->clear.vertices[i][0][3] = 1.0; + st->clear.vertices[i][1][0] = color[0]; + st->clear.vertices[i][1][1] = color[1]; + st->clear.vertices[i][1][2] = color[2]; + st->clear.vertices[i][1][3] = color[3]; + } + + + /* put vertex data into vbuf */ + buf = pipe_user_buffer_create(pipe->screen, + st->clear.vertices, + sizeof(st->clear.vertices)); + + + /* draw */ + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference(&buf, NULL); + } +} + +/** + * Do vgClear by drawing a quadrilateral. + */ +static void +clear_with_quad(struct vg_context *st, float x0, float y0, + float width, float height, const VGfloat clear_color[4]) +{ + VGfloat x1, y1; + + vg_validate_state(st); + + x1 = x0 + width; + y1 = y0 + height; + + /* + printf("%s %f,%f %f,%f\n", __FUNCTION__, + x0, y0, + x1, y1); + */ + + if (st->pipe->winsys && st->pipe->winsys->update_buffer) + st->pipe->winsys->update_buffer( st->pipe->winsys, + st->pipe->priv ); + + cso_save_blend(st->cso_context); + cso_save_rasterizer(st->cso_context); + cso_save_fragment_shader(st->cso_context); + cso_save_vertex_shader(st->cso_context); + + /* blend state: RGBA masking */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask |= PIPE_MASK_R; + blend.colormask |= PIPE_MASK_G; + blend.colormask |= PIPE_MASK_B; + blend.colormask |= PIPE_MASK_A; + cso_set_blend(st->cso_context, &blend); + } + + cso_set_rasterizer(st->cso_context, &st->clear.raster); + + cso_set_fragment_shader_handle(st->cso_context, st->clear.fs); + cso_set_vertex_shader_handle(st->cso_context, vg_clear_vs(st)); + + /* draw quad matching scissor rect (XXX verify coord round-off) */ + draw_clear_quad(st, x0, y0, x1, y1, 0, clear_color); + + /* Restore pipe state */ + cso_restore_blend(st->cso_context); + cso_restore_rasterizer(st->cso_context); + cso_restore_fragment_shader(st->cso_context); + cso_restore_vertex_shader(st->cso_context); +} + + +void vgMask(VGHandle mask, VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <=0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (operation < VG_CLEAR_MASK || operation > VG_SUBTRACT_MASK) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + + vg_validate_state(ctx); + + if (operation == VG_CLEAR_MASK) { + mask_fill(x, y, width, height, 0.f); + } else if (operation == VG_FILL_MASK) { + mask_fill(x, y, width, height, 1.f); + } else if (vg_object_is_valid((void*)mask, VG_OBJECT_IMAGE)) { + struct vg_image *image = (struct vg_image *)mask; + mask_using_image(image, operation, x, y, width, height); + } else if (vg_object_is_valid((void*)mask, VG_OBJECT_MASK)) { +#if DISABLE_1_1_MASKING + return; +#else + struct vg_mask_layer *layer = (struct vg_mask_layer *)mask; + mask_using_layer(layer, operation, x, y, width, height); +#endif + } else { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + } +} + +void vgClear(VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb; + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); +#if 0 + debug_printf("Clear [%d, %d, %d, %d] with [%f, %f, %f, %f]\n", + x, y, width, height, + ctx->state.vg.clear_color[0], + ctx->state.vg.clear_color[1], + ctx->state.vg.clear_color[2], + ctx->state.vg.clear_color[3]); +#endif + + fb = &ctx->state.g3d.fb; + /* check for a whole surface clear */ + if (!ctx->state.vg.scissoring && + (x == 0 && y == 0 && width == fb->width && height == fb->height)) { + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_COLOR | PIPE_CLEAR_DEPTHSTENCIL, + ctx->state.vg.clear_color, 1., 0); + } else { + clear_with_quad(ctx, x, y, width, height, ctx->state.vg.clear_color); + } +} + + +#ifdef OPENVG_VERSION_1_1 + + +void vgRenderToMask(VGPath path, + VGbitfield paintModes, + VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!paintModes || (paintModes&(~(VG_STROKE_PATH|VG_FILL_PATH)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (operation < VG_CLEAR_MASK || + operation > VG_SUBTRACT_MASK) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!vg_object_is_valid((void*)path, VG_OBJECT_PATH)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + + vg_validate_state(ctx); + + mask_render_to((struct path *)path, paintModes, operation); +} + +VGMaskLayer vgCreateMaskLayer(VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <= 0 || height <= 0 || + width > vgGeti(VG_MAX_IMAGE_WIDTH) || + height > vgGeti(VG_MAX_IMAGE_HEIGHT)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGMaskLayer)mask_layer_create(width, height); +} + +void vgDestroyMaskLayer(VGMaskLayer maskLayer) +{ + struct vg_mask_layer *mask = 0; + struct vg_context *ctx = vg_current_context(); + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + mask = (struct vg_mask_layer *)maskLayer; + mask_layer_destroy(mask); +} + +void vgFillMaskLayer(VGMaskLayer maskLayer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value) +{ + struct vg_mask_layer *mask = 0; + struct vg_context *ctx = vg_current_context(); + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (value < 0 || value > 1) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (x < 0 || y < 0 || (x + width) < 0 || (y + height) < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + mask = (struct vg_mask_layer*)maskLayer; + + if (x + width > mask_layer_width(mask) || + y + height > mask_layer_height(mask)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + mask_layer_fill(mask, x, y, width, height, value); +} + +void vgCopyMask(VGMaskLayer maskLayer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_mask_layer *mask = 0; + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + + mask = (struct vg_mask_layer*)maskLayer; + mask_copy(mask, sx, sy, dx, dy, width, height); +} + +#endif diff --git a/src/gallium/state_trackers/vega/api_misc.c b/src/gallium/state_trackers/vega/api_misc.c new file mode 100644 index 0000000000..78ba0bc110 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_misc.c @@ -0,0 +1,83 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +/* Hardware Queries */ +VGHardwareQueryResult vgHardwareQuery(VGHardwareQueryType key, + VGint setting) +{ + struct vg_context *ctx = vg_current_context(); + + if (key < VG_IMAGE_FORMAT_QUERY || + key > VG_PATH_DATATYPE_QUERY) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + + if (key == VG_IMAGE_FORMAT_QUERY) { + if (setting < VG_sRGBX_8888 || + setting > VG_lABGR_8888_PRE) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + } else if (key == VG_PATH_DATATYPE_QUERY) { + if (setting < VG_PATH_DATATYPE_S_8 || + setting > VG_PATH_DATATYPE_F) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + } + /* we're supposed to accelerate everything */ + return VG_HARDWARE_ACCELERATED; +} + +/* Renderer and Extension Information */ +const VGubyte *vgGetString(VGStringID name) +{ + struct vg_context *ctx = vg_current_context(); + static const VGubyte *vendor = (VGubyte *)"Tungsten Graphics, Inc"; + static const VGubyte *renderer = (VGubyte *)"Vega OpenVG 1.0"; + static const VGubyte *version = (VGubyte *)"1.0"; + + if (!ctx) + return NULL; + + switch(name) { + case VG_VENDOR: + return vendor; + case VG_RENDERER: + return renderer; + case VG_VERSION: + return version; + case VG_EXTENSIONS: + return NULL; + default: + return NULL; + } +} diff --git a/src/gallium/state_trackers/vega/api_paint.c b/src/gallium/state_trackers/vega/api_paint.c new file mode 100644 index 0000000000..dd3ac5bdb0 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_paint.c @@ -0,0 +1,166 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "paint.h" +#include "image.h" + +VGPaint vgCreatePaint(void) +{ + return (VGPaint) paint_create(vg_current_context()); +} + +void vgDestroyPaint(VGPaint p) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_paint *paint; + + if (p == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + paint = (struct vg_paint *)p; + paint_destroy(paint); +} + +void vgSetPaint(VGPaint paint, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE) { + /* restore the default */ + paint = (VGPaint)ctx->default_paint; + } else if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!(paintModes & ((VG_FILL_PATH|VG_STROKE_PATH)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (paintModes & VG_FILL_PATH) { + ctx->state.vg.fill_paint = (struct vg_paint *)paint; + } + if (paintModes & VG_STROKE_PATH) { + ctx->state.vg.stroke_paint = (struct vg_paint *)paint; + } +} + +VGPaint vgGetPaint(VGPaintMode paintMode) +{ + struct vg_context *ctx = vg_current_context(); + VGPaint paint = VG_INVALID_HANDLE; + + if (paintMode < VG_STROKE_PATH || paintMode > VG_FILL_PATH) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + if (paintMode == VG_FILL_PATH) + paint = (VGPaint)ctx->state.vg.fill_paint; + else if (paintMode == VG_STROKE_PATH) + paint = (VGPaint)ctx->state.vg.stroke_paint; + + if (paint == (VGPaint)ctx->default_paint) + paint = VG_INVALID_HANDLE; + + return paint; +} + +void vgSetColor(VGPaint paint, VGuint rgba) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + { + struct vg_paint *p = (struct vg_paint *)paint; + paint_set_colori(p, rgba); + } +} + +VGuint vgGetColor(VGPaint paint) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_paint *p; + VGuint rgba = 0; + + if (paint == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return rgba; + } + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return rgba; + } + p = (struct vg_paint *)paint; + + return paint_colori(p); +} + +void vgPaintPattern(VGPaint paint, VGImage pattern) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_PAINT, (void *)paint)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (pattern == VG_INVALID_HANDLE) { + paint_set_type((struct vg_paint*)paint, VG_PAINT_TYPE_COLOR); + return; + } + + if (!vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)pattern)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT) || + !vg_object_is_valid((void*)pattern, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + paint_set_pattern((struct vg_paint*)paint, + (struct vg_image*)pattern); +} + diff --git a/src/gallium/state_trackers/vega/api_params.c b/src/gallium/state_trackers/vega/api_params.c new file mode 100644 index 0000000000..db77fd9cb0 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_params.c @@ -0,0 +1,1673 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "paint.h" +#include "path.h" +#include "image.h" +#include "matrix.h" +#include "api_consts.h" + +#include "pipe/p_compiler.h" +#include "util/u_pointer.h" +#include "util/u_math.h" + +#include + +static INLINE struct vg_state *current_state() +{ + struct vg_context *ctx = vg_current_context(); + if (!ctx) + return 0; + else + return &ctx->state.vg; +} + +static INLINE VGboolean count_in_bounds(VGParamType type, VGint count) +{ + if (count < 0) + return VG_FALSE; + + if (type == VG_SCISSOR_RECTS) + return (!(count % 4) && (count >= 0 || count <= VEGA_MAX_SCISSOR_RECTS * 4)); + else if (type == VG_STROKE_DASH_PATTERN) { + return count <= VEGA_MAX_DASH_COUNT; + } else { + VGint real_count = vgGetVectorSize(type); + return count == real_count; + } +} + +void vgSetf (VGParamType type, VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + vgSeti(type, floor(value)); + return; + break; + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = value; + state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(&value))); + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = value; + state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(&value))); + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = value; + state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(&value))); + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSeti (VGParamType type, VGint value) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + switch(type) { + case VG_MATRIX_MODE: + if (value < VG_MATRIX_PATH_USER_TO_SURFACE || +#ifdef OPENVG_VERSION_1_1 + value > VG_MATRIX_GLYPH_USER_TO_SURFACE) +#else + value > VG_MATRIX_STROKE_PAINT_TO_USER) +#endif + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->matrix_mode = value; + break; + case VG_FILL_RULE: + if (value < VG_EVEN_ODD || + value > VG_NON_ZERO) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->fill_rule = value; + break; + case VG_IMAGE_QUALITY: + state->image_quality = value; + break; + case VG_RENDERING_QUALITY: + if (value < VG_RENDERING_QUALITY_NONANTIALIASED || + value > VG_RENDERING_QUALITY_BETTER) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->rendering_quality = value; + break; + case VG_BLEND_MODE: + if (value < VG_BLEND_SRC || + value > VG_BLEND_ADDITIVE) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else { + ctx->state.dirty |= BLEND_DIRTY; + state->blend_mode = value; + } + break; + case VG_IMAGE_MODE: + if (value < VG_DRAW_IMAGE_NORMAL || + value > VG_DRAW_IMAGE_STENCIL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->image_mode = value; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + state->color_transform = value; +#endif + break; + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = value; + state->stroke.line_width.i = value; + break; + case VG_STROKE_CAP_STYLE: + if (value < VG_CAP_BUTT || + value > VG_CAP_SQUARE) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->stroke.cap_style = value; + break; + case VG_STROKE_JOIN_STYLE: + if (value < VG_JOIN_MITER || + value > VG_JOIN_BEVEL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->stroke.join_style = value; + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = value; + state->stroke.miter_limit.i = value; + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = value; + state->stroke.dash_phase.i = value; + break; + case VG_STROKE_DASH_PHASE_RESET: + state->stroke.dash_phase_reset = value; + break; + case VG_MASKING: + state->masking = value; + break; + case VG_SCISSORING: + state->scissoring = value; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + break; + case VG_PIXEL_LAYOUT: + if (value < VG_PIXEL_LAYOUT_UNKNOWN || + value > VG_PIXEL_LAYOUT_BGR_HORIZONTAL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->pixel_layout = value; + break; + case VG_SCREEN_LAYOUT: + /* read only ignore */ + break; + case VG_FILTER_FORMAT_LINEAR: + state->filter_format_linear = value; + break; + case VG_FILTER_FORMAT_PREMULTIPLIED: + state->filter_format_premultiplied = value; + break; + case VG_FILTER_CHANNEL_MASK: + state->filter_channel_mask = value; + break; + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + /* read only ignore */ + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSetfv(VGParamType type, VGint count, + const VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + vgSeti(type, floor(values[0])); + return; + break; + case VG_SCISSOR_RECTS: { + VGint i; + VGuint *x = (VGuint*)values; + for (i = 0; i < count; ++i) { + state->scissor_rects[i].f = values[i]; + state->scissor_rects[i].i = float_to_int_floor(x[i]); + } + state->scissor_rects_num = count / 4; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + for (i = 0; i < count; ++i) { + state->color_transform_values[i] = values[i]; + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = values[0]; + state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = values[0]; + state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_STROKE_DASH_PATTERN: { + int i; + for (i = 0; i < count; ++i) { + state->stroke.dash_pattern[i].f = values[i]; + state->stroke.dash_pattern[i].i = + float_to_int_floor(*((VGuint*)(values + i))); + } + state->stroke.dash_pattern_num = count; + } + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = values[0]; + state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_TILE_FILL_COLOR: + state->tile_fill_color[0] = values[0]; + state->tile_fill_color[1] = values[1]; + state->tile_fill_color[2] = values[2]; + state->tile_fill_color[3] = values[3]; + + state->tile_fill_colori[0] = float_to_int_floor(*((VGuint*)(values + 0))); + state->tile_fill_colori[1] = float_to_int_floor(*((VGuint*)(values + 1))); + state->tile_fill_colori[2] = float_to_int_floor(*((VGuint*)(values + 2))); + state->tile_fill_colori[3] = float_to_int_floor(*((VGuint*)(values + 3))); + break; + case VG_CLEAR_COLOR: + state->clear_color[0] = values[0]; + state->clear_color[1] = values[1]; + state->clear_color[2] = values[2]; + state->clear_color[3] = values[3]; + + state->clear_colori[0] = float_to_int_floor(*((VGuint*)(values + 0))); + state->clear_colori[1] = float_to_int_floor(*((VGuint*)(values + 1))); + state->clear_colori[2] = float_to_int_floor(*((VGuint*)(values + 2))); + state->clear_colori[3] = float_to_int_floor(*((VGuint*)(values + 3))); + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + state->glyph_origin[0].f = values[0]; + state->glyph_origin[1].f = values[1]; + + state->glyph_origin[0].i = float_to_int_floor(*((VGuint*)(values + 0))); + state->glyph_origin[1].i = float_to_int_floor(*((VGuint*)(values + 1))); + break; +#endif + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSetiv(VGParamType type, VGint count, + const VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + + if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + vgSeti(type, values[0]); + return; + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + state->scissor_rects[i].i = values[i]; + state->scissor_rects[i].f = values[i]; + } + state->scissor_rects_num = count / 4; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + for (i = 0; i < count; ++i) { + state->color_transform_values[i] = values[i]; + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = values[0]; + state->stroke.line_width.i = values[0]; + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = values[0]; + state->stroke.miter_limit.i = values[0]; + break; + case VG_STROKE_DASH_PATTERN: { + int i; + for (i = 0; i < count; ++i) { + state->stroke.dash_pattern[i].f = values[i]; + state->stroke.dash_pattern[i].i = values[i]; + } + state->stroke.dash_pattern_num = count; + } + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = values[0]; + state->stroke.dash_phase.i = values[0]; + break; + case VG_TILE_FILL_COLOR: + state->tile_fill_color[0] = values[0]; + state->tile_fill_color[1] = values[1]; + state->tile_fill_color[2] = values[2]; + state->tile_fill_color[3] = values[3]; + + state->tile_fill_colori[0] = values[0]; + state->tile_fill_colori[1] = values[1]; + state->tile_fill_colori[2] = values[2]; + state->tile_fill_colori[3] = values[3]; + break; + case VG_CLEAR_COLOR: + state->clear_color[0] = values[0]; + state->clear_color[1] = values[1]; + state->clear_color[2] = values[2]; + state->clear_color[3] = values[3]; + + state->clear_colori[0] = values[0]; + state->clear_colori[1] = values[1]; + state->clear_colori[2] = values[2]; + state->clear_colori[3] = values[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + state->glyph_origin[0].f = values[0]; + state->glyph_origin[1].f = values[1]; + state->glyph_origin[0].i = values[0]; + state->glyph_origin[1].i = values[1]; + break; +#endif + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + break; + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +VGfloat vgGetf(VGParamType type) +{ + struct vg_context *ctx = vg_current_context(); + const struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + VGfloat value = 0.0f; + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + return vgGeti(type); + break; + case VG_STROKE_LINE_WIDTH: + value = state->stroke.line_width.f; + break; + case VG_STROKE_MITER_LIMIT: + value = state->stroke.miter_limit.f; + break; + case VG_STROKE_DASH_PHASE: + value = state->stroke.dash_phase.f; + break; + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + return vgGeti(type); + break; + case VG_MAX_FLOAT: + value = 1e+10;/*must be at least 1e+10*/ + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); + return value; +} + +VGint vgGeti(VGParamType type) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGErrorCode error = VG_NO_ERROR; + VGint value = 0; + + switch(type) { + case VG_MATRIX_MODE: + value = state->matrix_mode; + break; + case VG_FILL_RULE: + value = state->fill_rule; + break; + case VG_IMAGE_QUALITY: + value = state->image_quality; + break; + case VG_RENDERING_QUALITY: + value = state->rendering_quality; + break; + case VG_BLEND_MODE: + value = state->blend_mode; + break; + case VG_IMAGE_MODE: + value = state->image_mode; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + value = state->color_transform; + break; +#endif + case VG_STROKE_LINE_WIDTH: + value = state->stroke.line_width.i; + break; + case VG_STROKE_CAP_STYLE: + value = state->stroke.cap_style; + break; + case VG_STROKE_JOIN_STYLE: + value = state->stroke.join_style; + break; + case VG_STROKE_MITER_LIMIT: + value = state->stroke.miter_limit.i; + break; + case VG_STROKE_DASH_PHASE: + value = state->stroke.dash_phase.i; + break; + case VG_STROKE_DASH_PHASE_RESET: + value = state->stroke.dash_phase_reset; + break; + case VG_MASKING: + value = state->masking; + break; + case VG_SCISSORING: + value = state->scissoring; + break; + case VG_PIXEL_LAYOUT: + value = state->pixel_layout; + break; + case VG_SCREEN_LAYOUT: + value = state->screen_layout; + break; + case VG_FILTER_FORMAT_LINEAR: + value = state->filter_format_linear; + break; + case VG_FILTER_FORMAT_PREMULTIPLIED: + value = state->filter_format_premultiplied; + break; + case VG_FILTER_CHANNEL_MASK: + value = state->filter_channel_mask; + break; + + case VG_MAX_SCISSOR_RECTS: + value = 32; /*must be at least 32*/ + break; + case VG_MAX_DASH_COUNT: + value = 16; /*must be at least 16*/ + break; + case VG_MAX_KERNEL_SIZE: + value = 7; /*must be at least 7*/ + break; + case VG_MAX_SEPARABLE_KERNEL_SIZE: + value = 15; /*must be at least 15*/ + break; + case VG_MAX_COLOR_RAMP_STOPS: + value = 256; /*must be at least 32*/ + break; + case VG_MAX_IMAGE_WIDTH: + value = 2048; + break; + case VG_MAX_IMAGE_HEIGHT: + value = 2048; + break; + case VG_MAX_IMAGE_PIXELS: + value = 2048*2048; + break; + case VG_MAX_IMAGE_BYTES: + value = 2048*2048 * 4; + break; + case VG_MAX_GAUSSIAN_STD_DEVIATION: + value = 128; /*must be at least 128*/ + break; + + case VG_MAX_FLOAT: { + VGfloat val = vgGetf(type); + value = float_to_int_floor(*((VGuint*)&val)); + } + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); + return value; +} + +VGint vgGetVectorSize(VGParamType type) +{ + struct vg_context *ctx = vg_current_context(); + const struct vg_state *state = current_state(); + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: + return 1; + case VG_SCISSOR_RECTS: + return state->scissor_rects_num * 4; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + return 1; + case VG_COLOR_TRANSFORM_VALUES: + return 8; +#endif + case VG_STROKE_LINE_WIDTH: + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_MITER_LIMIT: + return 1; + case VG_STROKE_DASH_PATTERN: + return state->stroke.dash_pattern_num; + case VG_STROKE_DASH_PHASE: + return 1; + case VG_STROKE_DASH_PHASE_RESET: + return 1; + case VG_TILE_FILL_COLOR: + return 4; + case VG_CLEAR_COLOR: + return 4; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + return 2; +#endif + case VG_MASKING: + return 1; + case VG_SCISSORING: + return 1; + case VG_PIXEL_LAYOUT: + return 1; + case VG_SCREEN_LAYOUT: + return 1; + case VG_FILTER_FORMAT_LINEAR: + return 1; + case VG_FILTER_FORMAT_PREMULTIPLIED: + return 1; + case VG_FILTER_CHANNEL_MASK: + return 1; + + case VG_MAX_COLOR_RAMP_STOPS: + return 1; + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_FLOAT: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + return 1; + default: + if (ctx) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return 0; + } +} + +void vgGetfv(VGParamType type, VGint count, + VGfloat * values) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGint real_count = vgGetVectorSize(type); + + if (!values || count <= 0 || count > real_count || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + values[0] = vgGeti(type); + break; + case VG_MAX_FLOAT: + values[0] = vgGetf(type); + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->scissor_rects[i].f; + } + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + memcpy(values, state->color_transform_values, + sizeof(VGfloat) * count); + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + values[0] = state->stroke.line_width.f; + break; + case VG_STROKE_MITER_LIMIT: + values[0] = state->stroke.miter_limit.f; + break; + case VG_STROKE_DASH_PATTERN: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->stroke.dash_pattern[i].f; + } + } + break; + case VG_STROKE_DASH_PHASE: + values[0] = state->stroke.dash_phase.f; + break; + case VG_TILE_FILL_COLOR: + values[0] = state->tile_fill_color[0]; + values[1] = state->tile_fill_color[1]; + values[2] = state->tile_fill_color[2]; + values[3] = state->tile_fill_color[3]; + break; + case VG_CLEAR_COLOR: + values[0] = state->clear_color[0]; + values[1] = state->clear_color[1]; + values[2] = state->clear_color[2]; + values[3] = state->clear_color[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + values[0] = state->glyph_origin[0].f; + values[1] = state->glyph_origin[1].f; + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgGetiv(VGParamType type, VGint count, + VGint * values) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGint real_count = vgGetVectorSize(type); + + if (!values || count <= 0 || count > real_count || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + values[0] = vgGeti(type); + break; + case VG_MAX_FLOAT: { + VGfloat val = vgGetf(type); + values[0] = float_to_int_floor(*((VGuint*)&val)); + } + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->scissor_rects[i].i; + } + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + VGuint *x = (VGuint*)state->color_transform_values; + for (i = 0; i < count; ++i) { + values[i] = float_to_int_floor(x[i]); + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + values[0] = state->stroke.line_width.i; + break; + case VG_STROKE_MITER_LIMIT: + values[0] = state->stroke.miter_limit.i; + break; + case VG_STROKE_DASH_PATTERN: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->stroke.dash_pattern[i].i; + } + } + break; + case VG_STROKE_DASH_PHASE: + values[0] = state->stroke.dash_phase.i; + break; + case VG_TILE_FILL_COLOR: + values[0] = state->tile_fill_colori[0]; + values[1] = state->tile_fill_colori[1]; + values[2] = state->tile_fill_colori[2]; + values[3] = state->tile_fill_colori[3]; + break; + case VG_CLEAR_COLOR: + values[0] = state->clear_colori[0]; + values[1] = state->clear_colori[1]; + values[2] = state->clear_colori[2]; + values[3] = state->clear_colori[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + values[0] = state->glyph_origin[0].i; + values[1] = state->glyph_origin[1].i; + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgSetParameterf(VGHandle object, + VGint paramType, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_PATTERN_TILING_MODE: + vgSetParameteri(object, paramType, floor(value)); + return; + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + /* it's an error if paramType refers to a vector parameter */ + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + paint_set_color_ramp_premultiplied(p, value); + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgSetParameteri(VGHandle object, + VGint paramType, + VGint value) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + if (value < VG_PAINT_TYPE_COLOR || + value > VG_PAINT_TYPE_PATTERN) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_type(paint, value); + } + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + /* it's an error if paramType refers to a vector parameter */ + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + if (value < VG_COLOR_RAMP_SPREAD_PAD || + value > VG_COLOR_RAMP_SPREAD_REFLECT) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_spread_mode(paint, value); + } + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + paint_set_color_ramp_premultiplied(p, value); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: + if (value < VG_TILE_FILL || + value > VG_TILE_REFLECT) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_pattern_tiling(paint, value); + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgSetParameterfv(VGHandle object, + VGint paramType, + VGint count, + const VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (count < 0 || count < real_count || + (values == NULL && count != 0) || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + if (count != 1) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else + vgSetParameterf(object, paramType, values[0]); + return; + break; + case VG_PAINT_COLOR: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_color(paint, values); + } + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + if (count && count < 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + count = MIN2(count, VEGA_MAX_COLOR_RAMP_STOPS); + paint_set_ramp_stops(paint, values, count); + { + VGint stopsi[VEGA_MAX_COLOR_RAMP_STOPS]; + int i = 0; + for (i = 0; i < count; ++i) { + stopsi[i] = float_to_int_floor(*((VGuint*)(values + i))); + } + paint_set_ramp_stopsi(paint, stopsi, count); + } + } + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_linear_gradient(paint, values); + { + VGint vals[4]; + vals[0] = FLT_TO_INT(values[0]); + vals[1] = FLT_TO_INT(values[1]); + vals[2] = FLT_TO_INT(values[2]); + vals[3] = FLT_TO_INT(values[3]); + paint_set_linear_gradienti(paint, vals); + } + } + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + if (count != 5) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_radial_gradient(paint, values); + { + VGint vals[5]; + vals[0] = FLT_TO_INT(values[0]); + vals[1] = FLT_TO_INT(values[1]); + vals[2] = FLT_TO_INT(values[2]); + vals[3] = FLT_TO_INT(values[3]); + vals[4] = FLT_TO_INT(values[4]); + paint_set_radial_gradienti(paint, vals); + } + } + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgSetParameteriv(VGHandle object, + VGint paramType, + VGint count, + const VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (count < 0 || count < real_count || + (values == NULL && count != 0) || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + if (count != 1) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else + vgSetParameteri(object, paramType, values[0]); + return; + break; + case VG_PAINT_COLOR: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_coloriv(paint, values); + } + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + if ((count % 5)) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat *vals = 0; + int i; + struct vg_paint *paint = (struct vg_paint *)object; + if (count) { + vals = malloc(sizeof(VGfloat)*count); + for (i = 0; i < count; ++i) + vals[i] = values[i]; + } + + paint_set_ramp_stopsi(paint, values, count); + paint_set_ramp_stops(paint, vals, count); + free(vals); + } + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat vals[4]; + struct vg_paint *paint = (struct vg_paint *)object; + vals[0] = values[0]; + vals[1] = values[1]; + vals[2] = values[2]; + vals[3] = values[3]; + paint_set_linear_gradient(paint, vals); + paint_set_linear_gradienti(paint, values); + } + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + if (count != 5) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat vals[5]; + struct vg_paint *paint = (struct vg_paint *)object; + vals[0] = values[0]; + vals[1] = values[1]; + vals[2] = values[2]; + vals[3] = values[3]; + vals[4] = values[4]; + paint_set_radial_gradient(paint, vals); + paint_set_radial_gradienti(paint, values); + } + } + break; + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + /* read only don't produce an error */ + break; + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +VGint vgGetParameterVectorSize(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + return 1; + case VG_PAINT_COLOR: + return 4; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_num_ramp_stops(p); + } + break; + case VG_PAINT_LINEAR_GRADIENT: + return 4; + case VG_PAINT_RADIAL_GRADIENT: + return 5; + + + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + return 1; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + return 1; + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + return 1; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + + +VGfloat vgGetParameterf(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + return vgGetParameteri(object, paramType); + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + + case VG_PATH_FORMAT: + return VG_PATH_FORMAT_STANDARD; + case VG_PATH_SCALE: { + struct path *p = (struct path*)object; + return path_scale(p); + } + case VG_PATH_BIAS: { + struct path *p = (struct path*)object; + return path_bias(p); + } + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + return vgGetParameteri(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + return vgGetParameteri(object, paramType); + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + +VGint vgGetParameteri(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: { + struct vg_paint *paint = (struct vg_paint *)ptr; + return paint_type(paint); + } + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_spread_mode(p); + } + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_color_ramp_premultiplied(p); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_pattern_tiling(p); + } + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + + case VG_PATH_FORMAT: + return VG_PATH_FORMAT_STANDARD; + case VG_PATH_SCALE: + case VG_PATH_BIAS: + return vgGetParameterf(object, paramType); + case VG_PATH_DATATYPE: { + struct path *p = (struct path*)object; + return path_datatype(p); + } + case VG_PATH_NUM_SEGMENTS: { + struct path *p = (struct path*)object; + return path_num_segments(p); + } + case VG_PATH_NUM_COORDS: { + struct path *p = (struct path*)object; + return path_num_coords(p); + } + break; + + case VG_IMAGE_FORMAT: { + struct vg_image *img = (struct vg_image*)object; + return img->format; + } + break; + case VG_IMAGE_WIDTH: { + struct vg_image *img = (struct vg_image*)object; + return img->width; + } + break; + case VG_IMAGE_HEIGHT: { + struct vg_image *img = (struct vg_image*)object; + return img->height; + } + break; + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: { + return 1; + } + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + +void vgGetParameterfv(VGHandle object, + VGint paramType, + VGint count, + VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!values || count <= 0 || count > real_count || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_type(p); + } + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_spread_mode(p); + } + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_color_ramp_premultiplied(p); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: { + values[0] = vgGetParameterf(object, paramType); + } + break; + case VG_PAINT_COLOR: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_get_color(paint, values); + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_ramp_stops(paint, values, count); + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_linear_gradient(paint, values); + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_radial_gradient(paint, values); + } + break; + + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + values[0] = vgGetParameteri(object, paramType); + break; + case VG_PATH_SCALE: + case VG_PATH_BIAS: + values[0] = vgGetParameterf(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + values[0] = vgGetParameteri(object, paramType); + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgGetParameteriv(VGHandle object, + VGint paramType, + VGint count, + VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!values || count <= 0 || count > real_count || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + values[0] = vgGetParameteri(object, paramType); + break; +#endif + case VG_PAINT_COLOR: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_get_coloriv(paint, values); + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_ramp_stopsi(paint, values, count); + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_linear_gradienti(paint, values); + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_radial_gradienti(paint, values); + } + break; + + case VG_PATH_SCALE: + case VG_PATH_BIAS: + values[0] = vgGetParameterf(object, paramType); + break; + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + values[0] = vgGetParameteri(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + values[0] = vgGetParameteri(object, paramType); + break; + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} diff --git a/src/gallium/state_trackers/vega/api_path.c b/src/gallium/state_trackers/vega/api_path.c new file mode 100644 index 0000000000..a6b7a2bb93 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_path.c @@ -0,0 +1,488 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "path.h" +#include "polygon.h" +#include "paint.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "util/u_draw_quad.h" + +VGPath vgCreatePath(VGint pathFormat, + VGPathDatatype datatype, + VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + + if (pathFormat != VG_PATH_FORMAT_STANDARD) { + vg_set_error(ctx, VG_UNSUPPORTED_PATH_FORMAT_ERROR); + return VG_INVALID_HANDLE; + } + if (datatype < VG_PATH_DATATYPE_S_8 || + datatype > VG_PATH_DATATYPE_F) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (!scale) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGPath)path_create(datatype, scale, bias, + segmentCapacityHint, coordCapacityHint, + capabilities); +} + +void vgClearPath(VGPath path, VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + p = (struct path *)path; + path_clear(p, capabilities); +} + +void vgDestroyPath(VGPath p) +{ + struct path *path = 0; + struct vg_context *ctx = vg_current_context(); + + if (p == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + path = (struct path *)p; + path_destroy(path); +} + +void vgRemovePathCapabilities(VGPath path, + VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + VGbitfield current; + struct path *p; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + p = (struct path*)path; + current = path_capabilities(p); + path_set_capabilities(p, (current & + (~(capabilities & VG_PATH_CAPABILITY_ALL)))); +} + +VGbitfield vgGetPathCapabilities(VGPath path) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + p = (struct path*)path; + return path_capabilities(p); +} + +void vgAppendPath(VGPath dstPath, VGPath srcPath) +{ + struct vg_context *ctx = vg_current_context(); + struct path *src, *dst; + + if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + src = (struct path *)srcPath; + dst = (struct path *)dstPath; + + if (!(path_capabilities(src) & VG_PATH_CAPABILITY_APPEND_FROM) || + !(path_capabilities(dst) & VG_PATH_CAPABILITY_APPEND_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_append_path(dst, src); +} + +void vgAppendPathData(VGPath dstPath, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGint i; + + if (dstPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!pathSegments) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + for (i = 0; i < numSegments; ++i) { + if (pathSegments[i] < VG_CLOSE_PATH || + pathSegments[i] > VG_LCWARC_TO_REL) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + } + + p = (struct path*)dstPath; + + if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!(path_capabilities(p)&VG_PATH_CAPABILITY_APPEND_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + path_append_data(p, numSegments, pathSegments, pathData); +} + +void vgModifyPathCoords(VGPath dstPath, + VGint startIndex, + VGint numSegments, + const void * pathData) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (dstPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (startIndex < 0 || numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path *)dstPath; + + if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (startIndex + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!(path_capabilities(p)&VG_PATH_CAPABILITY_MODIFY)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_modify_coords(p, startIndex, numSegments, pathData); +} + +void vgTransformPath(VGPath dstPath, VGPath srcPath) +{ + struct vg_context *ctx = vg_current_context(); + struct path *src = 0, *dst = 0; + + if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + src = (struct path *)srcPath; + dst = (struct path *)dstPath; + + if (!(path_capabilities(src) & VG_PATH_CAPABILITY_TRANSFORM_FROM) || + !(path_capabilities(dst) & VG_PATH_CAPABILITY_TRANSFORM_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_transform(dst, src); +} + +VGboolean vgInterpolatePath(VGPath dstPath, + VGPath startPath, + VGPath endPath, + VGfloat amount) +{ + struct vg_context *ctx = vg_current_context(); + struct path *start = 0, *dst = 0, *end = 0; + + if (dstPath == VG_INVALID_HANDLE || + startPath == VG_INVALID_HANDLE || + endPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_FALSE; + } + dst = (struct path *)dstPath; + start = (struct path *)startPath; + end = (struct path *)endPath; + + if (!(path_capabilities(dst) & VG_PATH_CAPABILITY_INTERPOLATE_TO) || + !(path_capabilities(start) & VG_PATH_CAPABILITY_INTERPOLATE_FROM) || + !(path_capabilities(end) & VG_PATH_CAPABILITY_INTERPOLATE_FROM)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return VG_FALSE; + } + + return path_interpolate(dst, + start, end, amount); +} + +VGfloat vgPathLength(VGPath path, + VGint startSegment, + VGint numSegments) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return -1; + } + if (startSegment < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + p = (struct path*)path; + + if (!(path_capabilities(p) & VG_PATH_CAPABILITY_PATH_LENGTH)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return -1; + } + if (startSegment + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + + return path_length(p, startSegment, numSegments); +} + +void vgPointAlongPath(VGPath path, + VGint startSegment, + VGint numSegments, + VGfloat distance, + VGfloat * x, VGfloat * y, + VGfloat * tangentX, + VGfloat * tangentY) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (startSegment < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(x) || !is_aligned(y) || + !is_aligned(tangentX) || !is_aligned(tangentY)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_POINT_ALONG_PATH) || + !(caps & VG_PATH_CAPABILITY_TANGENT_ALONG_PATH)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + if (startSegment + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + { + VGfloat point[2], normal[2]; + path_point(p, startSegment, numSegments, distance, + point, normal); + if (x) + *x = point[0]; + if (y) + *y = point[1]; + if (tangentX) + *tangentX = -normal[1]; + if (tangentY) + *tangentY = normal[0]; + } +} + +void vgPathBounds(VGPath path, + VGfloat * minX, + VGfloat * minY, + VGfloat * width, + VGfloat * height) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!minX || !minY || !width || !height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(minX) || !is_aligned(minY) || + !is_aligned(width) || !is_aligned(height)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_PATH_BOUNDS)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + path_bounding_rect(p, minX, minY, width, height); +} + +void vgPathTransformedBounds(VGPath path, + VGfloat * minX, + VGfloat * minY, + VGfloat * width, + VGfloat * height) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!minX || !minY || !width || !height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(minX) || !is_aligned(minY) || + !is_aligned(width) || !is_aligned(height)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + +#if 0 + /* faster, but seems to have precision problems... */ + path_bounding_rect(p, minX, minY, width, height); + if (*width > 0 && *height > 0) { + VGfloat pts[] = {*minX, *minY, + *minX + *width, *minY, + *minX + *width, *minY + *height, + *minX, *minY + *height}; + struct matrix *matrix = &ctx->state.vg.path_user_to_surface_matrix; + VGfloat maxX, maxY; + matrix_map_point(matrix, pts[0], pts[1], pts + 0, pts + 1); + matrix_map_point(matrix, pts[2], pts[3], pts + 2, pts + 3); + matrix_map_point(matrix, pts[4], pts[5], pts + 4, pts + 5); + matrix_map_point(matrix, pts[6], pts[7], pts + 6, pts + 7); + *minX = MIN2(pts[0], MIN2(pts[2], MIN2(pts[4], pts[6]))); + *minY = MIN2(pts[1], MIN2(pts[3], MIN2(pts[5], pts[7]))); + maxX = MAX2(pts[0], MAX2(pts[2], MAX2(pts[4], pts[6]))); + maxY = MAX2(pts[1], MAX2(pts[3], MAX2(pts[5], pts[7]))); + *width = maxX - *minX; + *height = maxY - *minY; + } +#else + { + struct path *dst = path_create(VG_PATH_DATATYPE_F, 1.0, 0, + 0, 0, VG_PATH_CAPABILITY_ALL); + path_transform(dst, p); + path_bounding_rect(dst, minX, minY, width, height); + path_destroy(dst); + } +#endif +} + + +void vgDrawPath(VGPath path, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!(paintModes & (VG_STROKE_PATH | VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (path_is_empty((struct path*)path)) + return; + path_render((struct path*)path, paintModes); +} + diff --git a/src/gallium/state_trackers/vega/api_text.c b/src/gallium/state_trackers/vega/api_text.c new file mode 100644 index 0000000000..d8411cf3e8 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_text.c @@ -0,0 +1,258 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "util/u_memory.h" + +#ifdef OPENVG_VERSION_1_1 + +struct vg_font { + struct vg_object base; + + VGint glyph_indices[200]; + VGint num_glyphs; +}; + +VGFont vgCreateFont(VGint glyphCapacityHint) +{ + struct vg_font *font = 0; + struct vg_context *ctx = vg_current_context(); + + if (glyphCapacityHint < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + font = CALLOC_STRUCT(vg_font); + vg_init_object(&font->base, ctx, VG_OBJECT_FONT); + vg_context_add_object(ctx, VG_OBJECT_FONT, font); + return (VGFont)font; +} + +void vgDestroyFont(VGFont f) +{ + struct vg_font *font = (struct vg_font *)f; + struct vg_context *ctx = vg_current_context(); + + if (f == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + vg_context_remove_object(ctx, VG_OBJECT_FONT, font); + /*free(font);*/ +} + +void vgSetGlyphToPath(VGFont font, + VGuint glyphIndex, + VGPath path, + VGboolean isHinted, + VGfloat glyphOrigin [2], + VGfloat escapement[2]) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_object *pathObj; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!glyphOrigin || !escapement || + !is_aligned(glyphOrigin) || !is_aligned(escapement)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (path != VG_INVALID_HANDLE && + !vg_context_is_object_valid(ctx, VG_OBJECT_PATH, (void *)path)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + pathObj = (struct vg_object*)path; + if (pathObj && pathObj->type != VG_OBJECT_PATH) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + f = (struct vg_font*)font; + f->glyph_indices[f->num_glyphs] = glyphIndex; + ++f->num_glyphs; +} + +void vgSetGlyphToImage(VGFont font, + VGuint glyphIndex, + VGImage image, + VGfloat glyphOrigin [2], + VGfloat escapement[2]) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_object *img_obj; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!glyphOrigin || !escapement || + !is_aligned(glyphOrigin) || !is_aligned(escapement)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (image != VG_INVALID_HANDLE && + !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)image)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + img_obj = (struct vg_object*)image; + if (img_obj && img_obj->type != VG_OBJECT_IMAGE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + f = (struct vg_font*)font; + f->glyph_indices[f->num_glyphs] = glyphIndex; + ++f->num_glyphs; +} + +static INLINE VGboolean font_contains_glyph(struct vg_font *font, + VGuint glyph_index) +{ + VGint i; + for (i = 0; i < font->num_glyphs; ++i) { + if (font->glyph_indices[i] == glyph_index) { + return VG_TRUE; + } + } + return VG_FALSE; +} + +void vgClearGlyph(VGFont font, + VGuint glyphIndex) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_font *f; + VGint i; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphIndex <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + f = (struct vg_font*)font; + if (!font_contains_glyph(f, glyphIndex)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < f->num_glyphs; ++i) { + if (f->glyph_indices[i] == glyphIndex) { + /*FIXME*/ + f->glyph_indices[f->num_glyphs] = 0; + --f->num_glyphs; + return; + } + } +} + +void vgDrawGlyph(VGFont font, + VGuint glyphIndex, + VGbitfield paintModes, + VGboolean allowAutoHinting) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_font *f; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphIndex <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + f = (struct vg_font*)font; + if (!font_contains_glyph(f, glyphIndex)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgDrawGlyphs(VGFont font, + VGint glyphCount, + VGuint *glyphIndices, + VGfloat *adjustments_x, + VGfloat *adjustments_y, + VGbitfield paintModes, + VGboolean allowAutoHinting) +{ + struct vg_context *ctx = vg_current_context(); + VGint i; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphCount <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!glyphIndices || !is_aligned(glyphIndices)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!adjustments_x || !is_aligned(adjustments_x) || + !adjustments_y || !is_aligned(adjustments_y)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + f = (struct vg_font*)font; + for (i = 0; i < glyphCount; ++i) { + VGuint glyph_index = glyphIndices[i]; + if (!font_contains_glyph(f, glyph_index)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + } +} + +#endif diff --git a/src/gallium/state_trackers/vega/api_transform.c b/src/gallium/state_trackers/vega/api_transform.c new file mode 100644 index 0000000000..763a5ec415 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_transform.c @@ -0,0 +1,128 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "matrix.h" + +void vgLoadIdentity(void) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = vg_state_matrix(&ctx->state.vg); + matrix_load_identity(mat); +} + +void vgLoadMatrix(const VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + mat = vg_state_matrix(&ctx->state.vg); + matrix_init(mat, m); + if (!matrix_is_affine(mat)) { + if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) { + matrix_make_affine(mat); + } + } +} + +void vgGetMatrix(VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + mat = vg_state_matrix(&ctx->state.vg); + memcpy(m, mat->m, sizeof(VGfloat)*9); +} + +void vgMultMatrix(const VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst, src; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + matrix_init(&src, m); + dst = vg_state_matrix(&ctx->state.vg); + if (!matrix_is_affine(&src)) { + if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) { + matrix_make_affine(&src); + } + } + matrix_mult(dst, &src); + +} + +void vgTranslate(VGfloat tx, VGfloat ty) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_translate(dst, tx, ty); +} + +void vgScale(VGfloat sx, VGfloat sy) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_scale(dst, sx, sy); +} + +void vgShear(VGfloat shx, VGfloat shy) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_shear(dst, shx, shy); +} + +void vgRotate(VGfloat angle) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_rotate(dst, angle); +} diff --git a/src/gallium/state_trackers/vega/arc.c b/src/gallium/state_trackers/vega/arc.c new file mode 100644 index 0000000000..e74c7f0334 --- /dev/null +++ b/src/gallium/state_trackers/vega/arc.c @@ -0,0 +1,708 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "arc.h" + +#include "matrix.h" +#include "bezier.h" +#include "polygon.h" +#include "stroker.h" +#include "path.h" + +#include "util/u_debug.h" + +#include + +#ifndef M_PI +#define M_PI 3.14159265358979323846 +#endif + +#define DEBUG_ARCS 0 + +static const VGfloat two_pi = M_PI * 2; + + +static const double coeffs3Low[2][4][4] = { + { + { 3.85268, -21.229, -0.330434, 0.0127842 }, + { -1.61486, 0.706564, 0.225945, 0.263682 }, + { -0.910164, 0.388383, 0.00551445, 0.00671814 }, + { -0.630184, 0.192402, 0.0098871, 0.0102527 } + }, + { + { -0.162211, 9.94329, 0.13723, 0.0124084 }, + { -0.253135, 0.00187735, 0.0230286, 0.01264 }, + { -0.0695069, -0.0437594, 0.0120636, 0.0163087 }, + { -0.0328856, -0.00926032, -0.00173573, 0.00527385 } + } +}; + +/* coefficients for error estimation + while using cubic Bézier curves for approximation + 1/4 <= b/a <= 1 */ +static const double coeffs3High[2][4][4] = { + { + { 0.0899116, -19.2349, -4.11711, 0.183362 }, + { 0.138148, -1.45804, 1.32044, 1.38474 }, + { 0.230903, -0.450262, 0.219963, 0.414038 }, + { 0.0590565, -0.101062, 0.0430592, 0.0204699 } + }, + { + { 0.0164649, 9.89394, 0.0919496, 0.00760802 }, + { 0.0191603, -0.0322058, 0.0134667, -0.0825018 }, + { 0.0156192, -0.017535, 0.00326508, -0.228157 }, + { -0.0236752, 0.0405821, -0.0173086, 0.176187 } + } +}; + +/* safety factor to convert the "best" error approximation + into a "max bound" error */ +static const double safety3[] = { + 0.001, 4.98, 0.207, 0.0067 +}; + +/* The code below is from the OpenVG 1.1 Spec + * Section 18.4 */ + +/* Given: Points (x0, y0) and (x1, y1) + * Return: TRUE if a solution exists, FALSE otherwise + * Circle centers are written to (cx0, cy0) and (cx1, cy1) + */ +static VGboolean +find_unit_circles(double x0, double y0, double x1, double y1, + double *cx0, double *cy0, + double *cx1, double *cy1) +{ + /* Compute differences and averages */ + double dx = x0 - x1; + double dy = y0 - y1; + double xm = (x0 + x1)/2; + double ym = (y0 + y1)/2; + double dsq, disc, s, sdx, sdy; + + /* Solve for intersecting unit circles */ + dsq = dx*dx + dy*dy; + if (dsq == 0.0) return VG_FALSE; /* Points are coincident */ + disc = 1.0/dsq - 1.0/4.0; + + /* the precision we care about here is around float so if we're + * around the float defined zero then make it official to avoid + * precision problems later on */ + if (floatIsZero(disc)) + disc = 0.0; + + if (disc < 0.0) return VG_FALSE; /* Points are too far apart */ + s = sqrt(disc); + sdx = s*dx; + sdy = s*dy; + *cx0 = xm + sdy; + *cy0 = ym - sdx; + *cx1 = xm - sdy; + *cy1 = ym + sdx; + return VG_TRUE; +} + + +/* Given: Ellipse parameters rh, rv, rot (in degrees), + * endpoints (x0, y0) and (x1, y1) + * Return: TRUE if a solution exists, FALSE otherwise + * Ellipse centers are written to (cx0, cy0) and (cx1, cy1) + */ +static VGboolean +find_ellipses(double rh, double rv, double rot, + double x0, double y0, double x1, double y1, + double *cx0, double *cy0, double *cx1, double *cy1) +{ + double COS, SIN, x0p, y0p, x1p, y1p, pcx0, pcy0, pcx1, pcy1; + /* Convert rotation angle from degrees to radians */ + rot *= M_PI/180.0; + /* Pre-compute rotation matrix entries */ + COS = cos(rot); SIN = sin(rot); + /* Transform (x0, y0) and (x1, y1) into unit space */ + /* using (inverse) rotate, followed by (inverse) scale */ + x0p = (x0*COS + y0*SIN)/rh; + y0p = (-x0*SIN + y0*COS)/rv; + x1p = (x1*COS + y1*SIN)/rh; + y1p = (-x1*SIN + y1*COS)/rv; + if (!find_unit_circles(x0p, y0p, x1p, y1p, + &pcx0, &pcy0, &pcx1, &pcy1)) { + return VG_FALSE; + } + /* Transform back to original coordinate space */ + /* using (forward) scale followed by (forward) rotate */ + pcx0 *= rh; pcy0 *= rv; + pcx1 *= rh; pcy1 *= rv; + *cx0 = pcx0*COS - pcy0*SIN; + *cy0 = pcx0*SIN + pcy0*COS; + *cx1 = pcx1*COS - pcy1*SIN; + *cy1 = pcx1*SIN + pcy1*COS; + return VG_TRUE; +} + +static INLINE VGboolean +try_to_fix_radii(struct arc *arc) +{ + double COS, SIN, rot, x0p, y0p, x1p, y1p; + double dx, dy, dsq, scale; + + /* Convert rotation angle from degrees to radians */ + rot = DEGREES_TO_RADIANS(arc->theta); + + /* Pre-compute rotation matrix entries */ + COS = cos(rot); SIN = sin(rot); + + /* Transform (x0, y0) and (x1, y1) into unit space */ + /* using (inverse) rotate, followed by (inverse) scale */ + x0p = (arc->x1*COS + arc->y1*SIN)/arc->a; + y0p = (-arc->x1*SIN + arc->y1*COS)/arc->b; + x1p = (arc->x2*COS + arc->y2*SIN)/arc->a; + y1p = (-arc->x2*SIN + arc->y2*COS)/arc->b; + /* Compute differences and averages */ + dx = x0p - x1p; + dy = y0p - y1p; + + dsq = dx*dx + dy*dy; +#if 0 + if (dsq <= 0.001) { + debug_printf("AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAaaaaa\n"); + } +#endif + scale = 1/(2/sqrt(dsq)); + arc->a *= scale; + arc->b *= scale; + return VG_TRUE; +} + +static INLINE double vector_normalize(double *v) +{ + double sq = v[0] * v[0] + v[1] * v[1]; + return sqrt(sq); +} +static INLINE double vector_orientation(double *v) +{ + double norm = vector_normalize(v); + double cosa = v[0] / norm; + double sina = v[1] / norm; + return (sina>=0 ? acos(cosa) : 2*M_PI - acos(cosa)); +} +static INLINE double vector_dot(double *v0, + double *v1) +{ + return v0[0] * v1[0] + v0[1] * v1[1]; +} + +static INLINE double vector_angles(double *v0, + double *v1) +{ + double dot = vector_dot(v0, v1); + double norm0 = vector_normalize(v0); + double norm1 = vector_normalize(v1); + + return acos(dot / (norm0 * norm1)); +} + +static VGboolean find_angles(struct arc *arc) +{ + double vec0[2], vec1[2]; + double lambda1, lambda2; + double angle; + struct matrix matrix; + + if (floatIsZero(arc->a) || floatIsZero(arc->b)) { + return VG_FALSE; + } + /* map the points to an identity circle */ + matrix_load_identity(&matrix); + matrix_scale(&matrix, 1.f, arc->a/arc->b); + matrix_rotate(&matrix, -arc->theta); + matrix_map_point(&matrix, + arc->x1, arc->y1, + &arc->x1, &arc->y1); + matrix_map_point(&matrix, + arc->x2, arc->y2, + &arc->x2, &arc->y2); + matrix_map_point(&matrix, + arc->cx, arc->cy, + &arc->cx, &arc->cy); + +#if DEBUG_ARCS + debug_printf("Matrix 3 [%f, %f, %f| %f, %f, %f| %f, %f, %f]\n", + matrix.m[0], matrix.m[1], matrix.m[2], + matrix.m[3], matrix.m[4], matrix.m[5], + matrix.m[6], matrix.m[7], matrix.m[8]); + debug_printf("Endpoints [%f, %f], [%f, %f]\n", + arc->x1, arc->y1, arc->x2, arc->y2); +#endif + + vec0[0] = arc->x1 - arc->cx; + vec0[1] = arc->y1 - arc->cy; + vec1[0] = arc->x2 - arc->cx; + vec1[1] = arc->y2 - arc->cy; + +#if DEBUG_ARCS + debug_printf("Vec is [%f, %f], [%f, %f], [%f, %f]\n", + vec0[0], vec0[1], vec1[0], vec1[1], arc->cx, arc->cy); +#endif + + lambda1 = vector_orientation(vec0); + + if (isnan(lambda1)) + lambda1 = 0.f; + + if (arc->type == VG_SCWARC_TO || + arc->type == VG_SCCWARC_TO) + angle = vector_angles(vec0, vec1); + else if (arc->type == VG_LCWARC_TO || + arc->type == VG_LCCWARC_TO) { + angle = 2*M_PI - vector_angles(vec0, vec1); + } else + abort(); + + if (isnan(angle)) + angle = M_PI; + + + if (arc->type == VG_SCWARC_TO || + arc->type == VG_LCWARC_TO) + lambda2 = lambda1 - angle; + else + lambda2 = lambda1 + angle; + +#if DEBUG_ARCS + debug_printf("Angle is %f and (%f, %f)\n", angle, lambda1, lambda2); +#endif + +#if 0 + arc->eta1 = atan2(sin(lambda1) / arc->b, + cos(lambda1) / arc->a); + arc->eta2 = atan2(sin(lambda2) / arc->b, + cos(lambda2) / arc->a); + + /* make sure we have eta1 <= eta2 <= eta1 + 2 PI */ + arc->eta2 -= two_pi * floor((arc->eta2 - arc->eta1) / two_pi); + + /* the preceding correction fails if we have exactly et2 - eta1 = 2 PI + it reduces the interval to zero length */ + if ((lambda2 - lambda1 > M_PI) && (arc->eta2 - arc->eta1 < M_PI)) { + arc->eta2 += 2 * M_PI; + } +#else + arc->eta1 = lambda1; + arc->eta2 = lambda2; +#endif + + return VG_TRUE; +} + +#if DEBUG_ARCS +static void check_endpoints(struct arc *arc) +{ + double x1, y1, x2, y2; + + double a_cos_eta1 = arc->a * cos(arc->eta1); + double b_sin_eta1 = arc->b * sin(arc->eta1); + x1 = arc->cx + a_cos_eta1 * arc->cos_theta - + b_sin_eta1 * arc->sin_theta; + y1 = arc->cy + a_cos_eta1 * arc->sin_theta + + b_sin_eta1 * arc->cos_theta; + + double a_cos_eta2 = arc->a * cos(arc->eta2); + double b_sin_eta2 = arc->b * sin(arc->eta2); + x2 = arc->cx + a_cos_eta2 * arc->cos_theta - + b_sin_eta2 * arc->sin_theta; + y2 = arc->cy + a_cos_eta2 * arc->sin_theta + + b_sin_eta2 * arc->cos_theta; + + debug_printf("Computed (%f, %f), (%f, %f)\n", + x1, y1, x2, y2); + debug_printf("Real (%f, %f), (%f, %f)\n", + arc->x1, arc->y1, + arc->x2, arc->y2); +} +#endif + +void arc_init(struct arc *arc, + VGPathSegment type, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat rh, VGfloat rv, + VGfloat rot) +{ + assert(type == VG_SCCWARC_TO || + type == VG_SCWARC_TO || + type == VG_LCCWARC_TO || + type == VG_LCWARC_TO); + arc->type = type; + arc->x1 = x1; + arc->y1 = y1; + arc->x2 = x2; + arc->y2 = y2; + arc->a = rh; + arc->b = rv; + arc->theta = rot; + arc->cos_theta = cos(arc->theta); + arc->sin_theta = sin(arc->theta); + { + double cx0, cy0, cx1, cy1; + double cx, cy; + arc->is_valid = find_ellipses(rh, rv, rot, x1, y1, x2, y2, + &cx0, &cy0, &cx1, &cy1); + + if (!arc->is_valid && try_to_fix_radii(arc)) { + rh = arc->a; + rv = arc->b; + arc->is_valid = + find_ellipses(rh, rv, rot, x1, y1, x2, y2, + &cx0, &cy0, &cx1, &cy1); + } + + if (type == VG_SCWARC_TO || + type == VG_LCCWARC_TO) { + cx = cx1; + cy = cy1; + } else { + cx = cx0; + cy = cy0; + } +#if DEBUG_ARCS + debug_printf("Centers are : (%f, %f) , (%f, %f). Real (%f, %f)\n", + cx0, cy0, cx1, cy1, cx, cy); +#endif + arc->cx = cx; + arc->cy = cy; + if (arc->is_valid) { + arc->is_valid = find_angles(arc); +#if DEBUG_ARCS + check_endpoints(arc); +#endif + /* remap a few points. find_angles requires + * rot in angles, the rest of the code + * will need them in radians. and find_angles + * modifies the center to match an identity + * circle so lets reset it */ + arc->theta = DEGREES_TO_RADIANS(rot); + arc->cos_theta = cos(arc->theta); + arc->sin_theta = sin(arc->theta); + arc->cx = cx; + arc->cy = cy; + } + } +} + +static INLINE double rational_function(double x, const double *c) +{ + return (x * (x * c[0] + c[1]) + c[2]) / (x + c[3]); +} + +static double estimate_error(struct arc *arc, + double etaA, double etaB) +{ + double eta = 0.5 * (etaA + etaB); + + double x = arc->b / arc->a; + double dEta = etaB - etaA; + double cos2 = cos(2 * eta); + double cos4 = cos(4 * eta); + double cos6 = cos(6 * eta); + double c0, c1; + + /* select the right coeficients set according to degree and b/a */ + const double (*coeffs)[4][4]; + const double *safety; + coeffs = (x < 0.25) ? coeffs3Low : coeffs3High; + safety = safety3; + + c0 = rational_function(x, coeffs[0][0]) + + cos2 * rational_function(x, coeffs[0][1]) + + cos4 * rational_function(x, coeffs[0][2]) + + cos6 * rational_function(x, coeffs[0][3]); + + c1 = rational_function(x, coeffs[1][0]) + + cos2 * rational_function(x, coeffs[1][1]) + + cos4 * rational_function(x, coeffs[1][2]) + + cos6 * rational_function(x, coeffs[1][3]); + + return rational_function(x, safety) * arc->a * exp(c0 + c1 * dEta); +} + +struct arc_cb { + void (*move)(struct arc_cb *cb, VGfloat x, VGfloat y); + void (*point)(struct arc_cb *cb, VGfloat x, VGfloat y); + void (*bezier)(struct arc_cb *cb, struct bezier *bezier); + + void *user_data; +}; + +static void cb_null_move(struct arc_cb *cb, VGfloat x, VGfloat y) +{ +} + +static void polygon_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct polygon *poly = (struct polygon*)cb->user_data; + polygon_vertex_append(poly, x, y); +} + +static void polygon_bezier(struct arc_cb *cb, struct bezier *bezier) +{ + struct polygon *poly = (struct polygon*)cb->user_data; + bezier_add_to_polygon(bezier, poly); +} + +static void stroke_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_line_to(stroker, x, y); +} + +static void stroke_curve(struct arc_cb *cb, struct bezier *bezier) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_curve_to(stroker, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static void stroke_emit_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_emit_line_to(stroker, x, y); +} + +static void stroke_emit_curve(struct arc_cb *cb, struct bezier *bezier) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_emit_curve_to(stroker, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static void arc_path_move(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct path *path = (struct path*)cb->user_data; + path_move_to(path, x, y); +} + +static void arc_path_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct path *path = (struct path*)cb->user_data; + path_line_to(path, x, y); +} + +static void arc_path_bezier(struct arc_cb *cb, struct bezier *bezier) +{ + struct path *path = (struct path*)cb->user_data; + path_cubic_to(path, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static INLINE int num_beziers_needed(struct arc *arc) +{ + double threshold = 0.05; + VGboolean found = VG_FALSE; + int n = 1; + double min_eta, max_eta; + + min_eta = MIN2(arc->eta1, arc->eta2); + max_eta = MAX2(arc->eta1, arc->eta2); + + while ((! found) && (n < 1024)) { + double d_eta = (max_eta - min_eta) / n; + if (d_eta <= 0.5 * M_PI) { + double eta_b = min_eta; + found = VG_TRUE; + for (int i = 0; found && (i < n); ++i) { + double etaA = eta_b; + eta_b += d_eta; + found = (estimate_error(arc, etaA, eta_b) <= threshold); + } + } + n = n << 1; + } + + return n; +} + +static void arc_to_beziers(struct arc *arc, + struct arc_cb cb, + struct matrix *matrix) +{ + int n = 1; + double d_eta, eta_b, cos_eta_b, + sin_eta_b, a_cos_eta_b, b_sin_eta_b, a_sin_eta_b, + b_cos_eta_b, x_b, y_b, x_b_dot, y_b_dot, lx, ly; + double t, alpha; + + { /* always move to the start of the arc */ + VGfloat x = arc->x1; + VGfloat y = arc->y1; + matrix_map_point(matrix, x, y, &x, &y); + cb.move(&cb, x, y); + } + + if (!arc->is_valid) { + VGfloat x = arc->x2; + VGfloat y = arc->y2; + matrix_map_point(matrix, x, y, &x, &y); + cb.point(&cb, x, y); + return; + } + + /* find the number of Bézier curves needed */ + n = num_beziers_needed(arc); + + d_eta = (arc->eta2 - arc->eta1) / n; + eta_b = arc->eta1; + + cos_eta_b = cos(eta_b); + sin_eta_b = sin(eta_b); + a_cos_eta_b = arc->a * cos_eta_b; + b_sin_eta_b = arc->b * sin_eta_b; + a_sin_eta_b = arc->a * sin_eta_b; + b_cos_eta_b = arc->b * cos_eta_b; + x_b = arc->cx + a_cos_eta_b * arc->cos_theta - + b_sin_eta_b * arc->sin_theta; + y_b = arc->cy + a_cos_eta_b * arc->sin_theta + + b_sin_eta_b * arc->cos_theta; + x_b_dot = -a_sin_eta_b * arc->cos_theta - + b_cos_eta_b * arc->sin_theta; + y_b_dot = -a_sin_eta_b * arc->sin_theta + + b_cos_eta_b * arc->cos_theta; + + { + VGfloat x = x_b, y = y_b; + matrix_map_point(matrix, x, y, &x, &y); + cb.point(&cb, x, y); + } + lx = x_b; + ly = y_b; + + t = tan(0.5 * d_eta); + alpha = sin(d_eta) * (sqrt(4 + 3 * t * t) - 1) / 3; + + for (int i = 0; i < n; ++i) { + struct bezier bezier; + double xA = x_b; + double yA = y_b; + double xADot = x_b_dot; + double yADot = y_b_dot; + + eta_b += d_eta; + cos_eta_b = cos(eta_b); + sin_eta_b = sin(eta_b); + a_cos_eta_b = arc->a * cos_eta_b; + b_sin_eta_b = arc->b * sin_eta_b; + a_sin_eta_b = arc->a * sin_eta_b; + b_cos_eta_b = arc->b * cos_eta_b; + x_b = arc->cx + a_cos_eta_b * arc->cos_theta - + b_sin_eta_b * arc->sin_theta; + y_b = arc->cy + a_cos_eta_b * arc->sin_theta + + b_sin_eta_b * arc->cos_theta; + x_b_dot = -a_sin_eta_b * arc->cos_theta - + b_cos_eta_b * arc->sin_theta; + y_b_dot = -a_sin_eta_b * arc->sin_theta + + b_cos_eta_b * arc->cos_theta; + + bezier_init(&bezier, + lx, ly, + (float) (xA + alpha * xADot), (float) (yA + alpha * yADot), + (float) (x_b - alpha * x_b_dot), (float) (y_b - alpha * y_b_dot), + (float) x_b, (float) y_b); +#if 0 + debug_printf("%d) Bezier (%f, %f), (%f, %f), (%f, %f), (%f, %f)\n", + i, + bezier.x1, bezier.y1, + bezier.x2, bezier.y2, + bezier.x3, bezier.y3, + bezier.x4, bezier.y4); +#endif + bezier_transform(&bezier, matrix); + cb.bezier(&cb, &bezier); + lx = x_b; + ly = y_b; + } +} + + +void arc_add_to_polygon(struct arc *arc, + struct polygon *poly, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = polygon_point; + cb.bezier = polygon_bezier; + cb.user_data = poly; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_stroke_cb(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = stroke_point; + cb.bezier = stroke_curve; + cb.user_data = stroke; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_stroker_emit(struct arc *arc, + struct stroker *stroker, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = stroke_emit_point; + cb.bezier = stroke_emit_curve; + cb.user_data = stroker; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_to_path(struct arc *arc, + struct path *path, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = arc_path_move; + cb.point = arc_path_point; + cb.bezier = arc_path_bezier; + cb.user_data = path; + + arc_to_beziers(arc, cb, matrix); +} diff --git a/src/gallium/state_trackers/vega/arc.h b/src/gallium/state_trackers/vega/arc.h new file mode 100644 index 0000000000..3205cd5021 --- /dev/null +++ b/src/gallium/state_trackers/vega/arc.h @@ -0,0 +1,80 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ARC_H +#define ARC_H + +#include "VG/openvg.h" + +struct polygon; +struct matrix; +struct stroker; +struct path; + +struct arc { + VGPathSegment type; + + VGfloat cx, cy; + + VGfloat a, b; + + VGfloat theta; + VGfloat cos_theta, sin_theta; + + VGfloat eta1; + VGfloat eta2; + + VGfloat x1, y1, x2, y2; + + VGboolean is_valid; +}; + +void arc_init(struct arc *arc, + VGPathSegment type, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat rh, VGfloat rv, + VGfloat rot); + +void arc_add_to_polygon(struct arc *arc, + struct polygon *poly, + struct matrix *matrix); + + +void arc_to_path(struct arc *arc, + struct path *p, + struct matrix *matrix); + +void arc_stroke_cb(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix); + +void arc_stroker_emit(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix); + + +#endif diff --git a/src/gallium/state_trackers/vega/asm_fill.h b/src/gallium/state_trackers/vega/asm_fill.h new file mode 100644 index 0000000000..2f394ad6c5 --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_fill.h @@ -0,0 +1,246 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_FILL_H +#define ASM_FILL_H + +static const char solid_fill_asm[] = + "MOV %s, CONST[0]\n"; + + +static const char linear_grad_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[4].x, TEMP[1]\n" + "MOV TEMP[4].y, TEMP[2]\n" + "MUL TEMP[0], CONST[0].yyyy, TEMP[4].yyyy\n" + "MAD TEMP[1], CONST[0].xxxx, TEMP[4].xxxx, TEMP[0]\n" + "MUL TEMP[2], TEMP[1], CONST[0].zzzz\n" + "TEX %s, TEMP[2], SAMP[0], 1D\n"; + +static const char radial_grad_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[5].x, TEMP[1]\n" + "MOV TEMP[5].y, TEMP[2]\n" + "MUL TEMP[0], CONST[0].yyyy, TEMP[5].yyyy\n" + "MAD TEMP[1], CONST[0].xxxx, TEMP[5].xxxx, TEMP[0]\n" + "ADD TEMP[1], TEMP[1], TEMP[1]\n" + "MUL TEMP[3], TEMP[5].yyyy, TEMP[5].yyyy\n" + "MAD TEMP[4], TEMP[5].xxxx, TEMP[5].xxxx, TEMP[3]\n" + "MOV TEMP[4], -TEMP[4]\n" + "MUL TEMP[2], CONST[0].zzzz, TEMP[4]\n" + "MUL TEMP[0], CONST[1].wwww, TEMP[2]\n" + "MUL TEMP[3], TEMP[1], TEMP[1]\n" + "SUB TEMP[2], TEMP[3], TEMP[0]\n" + "RSQ TEMP[2], |TEMP[2]|\n" + "RCP TEMP[2], TEMP[2]\n" + "SUB TEMP[1], TEMP[2], TEMP[1]\n" + "ADD TEMP[0], CONST[0].zzzz, CONST[0].zzzz\n" + "RCP TEMP[0], TEMP[0]\n" + "MUL TEMP[2], TEMP[1], TEMP[0]\n" + "TEX %s, TEMP[2], SAMP[0], 1D\n"; + +static const char pattern_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[4].x, TEMP[1]\n" + "MOV TEMP[4].y, TEMP[2]\n" + "RCP TEMP[0], CONST[1].zwzw\n" + "MOV TEMP[1], TEMP[4]\n" + "MUL TEMP[1].x, TEMP[1], TEMP[0]\n" + "MUL TEMP[1].y, TEMP[1], TEMP[0]\n" + "TEX %s, TEMP[1], SAMP[0], 2D\n"; + + +static const char mask_asm[] = + "TEX TEMP[1], IN[0], SAMP[1], 2D\n" + "MUL TEMP[0].w, TEMP[0].wwww, TEMP[1].wwww\n" + "MOV %s, TEMP[0]\n"; + + +static const char image_normal_asm[] = + "TEX %s, IN[1], SAMP[3], 2D\n"; + +static const char image_multiply_asm[] = + "TEX TEMP[1], IN[1], SAMP[3], 2D\n" + "MUL %s, TEMP[0], TEMP[1]\n"; + +static const char image_stencil_asm[] = + "TEX TEMP[1], IN[1], SAMP[3], 2D\n" + "MUL %s, TEMP[0], TEMP[1]\n"; + + +#define EXTENDED_BLEND_OVER \ + "SUB TEMP[3], CONST[1].yyyy, TEMP[1].wwww\n" \ + "SUB TEMP[4], CONST[1].yyyy, TEMP[0].wwww\n" \ + "MUL TEMP[3], TEMP[0], TEMP[3]\n" \ + "MUL TEMP[4], TEMP[1], TEMP[4]\n" \ + "ADD TEMP[3], TEMP[3], TEMP[4]\n" + +static const char blend_multiply_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1]\n" + "ADD TEMP[1], TEMP[4], TEMP[3]\n"/*result.rgb*/ + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; +#if 1 +static const char blend_screen_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + "ADD TEMP[3], TEMP[0], TEMP[1]\n" + "MUL TEMP[2], TEMP[0], TEMP[1]\n" + "SUB %s, TEMP[3], TEMP[2]\n"; +#else +static const char blend_screen_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + "MOV %s, TEMP[1]\n"; +#endif + +static const char blend_darken_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n" + "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n" + "MIN TEMP[4], TEMP[4], TEMP[5]\n" + "ADD TEMP[1], TEMP[3], TEMP[4]\n" + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; + +static const char blend_lighten_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n" + "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n" + "MAX TEMP[4], TEMP[4], TEMP[5]\n" + "ADD TEMP[1], TEMP[3], TEMP[4]\n" + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; + + +static const char premultiply_asm[] = + "MUL TEMP[0].xyz, TEMP[0], TEMP[0].wwww\n"; + +static const char unpremultiply_asm[] = + "TEX TEMP[0], IN[0], SAMP[1], 2D\n"; + + +static const char color_bw_asm[] = + "ADD TEMP[1], CONST[1].yyyy, CONST[1].yyyy\n" + "RCP TEMP[2], TEMP[1]\n" + "ADD TEMP[1], CONST[1].yyyy, TEMP[2]\n" + "ADD TEMP[2].x, TEMP[0].xxxx, TEMP[0].yyyy\n" + "ADD TEMP[2].x, TEMP[0].zzzz, TEMP[0].xxxx\n" + "SGE TEMP[0].xyz, TEMP[2].xxxx, TEMP[1]\n" + "SGE TEMP[0].w, TEMP[0].wwww, TEMP[2].yyyy\n" + "MOV %s, TEMP[0]\n"; + + +struct shader_asm_info { + VGint id; + VGint num_tokens; + const char * txt; + + VGboolean needs_position; + + VGint start_const; + VGint num_consts; + + VGint start_sampler; + VGint num_samplers; + + VGint start_temp; + VGint num_temps; +}; + + +static const struct shader_asm_info shaders_asm[] = { + /* fills */ + {VEGA_SOLID_FILL_SHADER, 40, solid_fill_asm, + VG_FALSE, 0, 1, 0, 0, 0, 0}, + {VEGA_LINEAR_GRADIENT_SHADER, 200, linear_grad_asm, + VG_TRUE, 0, 5, 0, 1, 0, 5}, + {VEGA_RADIAL_GRADIENT_SHADER, 200, radial_grad_asm, + VG_TRUE, 0, 5, 0, 1, 0, 6}, + {VEGA_PATTERN_SHADER, 100, pattern_asm, + VG_TRUE, 1, 4, 0, 1, 0, 5}, + + /* image draw modes */ + {VEGA_IMAGE_NORMAL_SHADER, 200, image_normal_asm, + VG_TRUE, 0, 0, 3, 1, 0, 0}, + {VEGA_IMAGE_MULTIPLY_SHADER, 200, image_multiply_asm, + VG_TRUE, 0, 0, 3, 1, 0, 2}, + {VEGA_IMAGE_STENCIL_SHADER, 200, image_stencil_asm, + VG_TRUE, 0, 0, 3, 1, 0, 2}, + + {VEGA_MASK_SHADER, 100, mask_asm, + VG_TRUE, 0, 0, 1, 1, 0, 2}, + + /* extra blend modes */ + {VEGA_BLEND_MULTIPLY_SHADER, 200, blend_multiply_asm, + VG_TRUE, 1, 1, 2, 1, 0, 5}, + {VEGA_BLEND_SCREEN_SHADER, 200, blend_screen_asm, + VG_TRUE, 0, 0, 2, 1, 0, 4}, + {VEGA_BLEND_DARKEN_SHADER, 200, blend_darken_asm, + VG_TRUE, 1, 1, 2, 1, 0, 6}, + {VEGA_BLEND_LIGHTEN_SHADER, 200, blend_lighten_asm, + VG_TRUE, 1, 1, 2, 1, 0, 6}, + + /* premultiply */ + {VEGA_PREMULTIPLY_SHADER, 100, premultiply_asm, + VG_FALSE, 0, 0, 0, 0, 0, 1}, + {VEGA_UNPREMULTIPLY_SHADER, 100, unpremultiply_asm, + VG_FALSE, 0, 0, 0, 0, 0, 1}, + + /* color transform to black and white */ + {VEGA_BW_SHADER, 150, color_bw_asm, + VG_FALSE, 1, 1, 0, 0, 0, 3}, +}; +#endif diff --git a/src/gallium/state_trackers/vega/asm_filters.h b/src/gallium/state_trackers/vega/asm_filters.h new file mode 100644 index 0000000000..49807b9ab4 --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_filters.h @@ -0,0 +1,117 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_FILTERS_H +#define ASM_FILTERS_H + +static const char color_matrix_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL CONST[0..4], CONSTANT\n" + "DCL TEMP[0..4], CONSTANT\n" + "DCL SAMP[0], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "MOV TEMP[1], TEMP[0].xxxx\n" + "MOV TEMP[2], TEMP[0].yyyy\n" + "MOV TEMP[3], TEMP[0].zzzz\n" + "MOV TEMP[4], TEMP[0].wwww\n" + "MUL TEMP[1], TEMP[1], CONST[0]\n" + "MUL TEMP[2], TEMP[2], CONST[1]\n" + "MUL TEMP[3], TEMP[3], CONST[2]\n" + "MUL TEMP[4], TEMP[4], CONST[3]\n" + "ADD TEMP[0], TEMP[1], CONST[4]\n" + "ADD TEMP[0], TEMP[0], TEMP[2]\n" + "ADD TEMP[0], TEMP[0], TEMP[3]\n" + "ADD TEMP[0], TEMP[0], TEMP[4]\n" + "MOV OUT[0], TEMP[0]\n" + "END\n"; + +static const char convolution_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..4], CONSTANT\n" + "DCL ADDR[0], CONSTANT\n" + "DCL CONST[0..%d], CONSTANT\n" + "DCL SAMP[0], CONSTANT\n" + "0: MOV TEMP[0], CONST[0].xxxx\n" + "1: MOV TEMP[1], CONST[0].xxxx\n" + "2: BGNLOOP2 :14\n" + "3: SGE TEMP[0].z, TEMP[0].yyyy, CONST[1].xxxx\n" + "4: IF TEMP[0].zzzz :7\n" + "5: BRK\n" + "6: ENDIF\n" + "7: ARL ADDR[0].x, TEMP[0].yyyy\n" + "8: MOV TEMP[3], CONST[ADDR[0]+2]\n" + "9: ADD TEMP[4].xy, IN[0], TEMP[3]\n" + "10: TEX TEMP[2], TEMP[4], SAMP[0], 2D\n" + "11: MOV TEMP[3], CONST[ADDR[0]+%d]\n" + "12: MAD TEMP[1], TEMP[2], TEMP[3], TEMP[1]\n" + "13: ADD TEMP[0].y, TEMP[0].yyyy, CONST[0].yyyy\n" + "14: ENDLOOP2 :2\n" + "15: MAD OUT[0], TEMP[1], CONST[1].yyyy, CONST[1].zzzz\n" + "16: END\n"; + + +static const char lookup_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "MOV TEMP[1], TEMP[0]\n" + /* do red */ + "TEX TEMP[2], TEMP[1].xxxx, SAMP[1], 1D\n" + "MOV TEMP[0].x, TEMP[2].xxxx\n" + /* do blue */ + "TEX TEMP[2], TEMP[1].yyyy, SAMP[1], 1D\n" + "MOV TEMP[0].y, TEMP[2].yyyy\n" + /* do green */ + "TEX TEMP[2], TEMP[1].zzzz, SAMP[1], 1D\n" + "MOV TEMP[0].z, TEMP[2].zzzz\n" + /* do alpha */ + "TEX TEMP[2], TEMP[1].wwww, SAMP[1], 1D\n" + "MOV TEMP[0].w, TEMP[2].wwww\n" + "MOV OUT[0], TEMP[0]\n" + "END\n"; + + +static const char lookup_single_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "TEX TEMP[1], TEMP[0].%s, SAMP[1], 1D\n" + "MOV OUT[0], TEMP[1]\n" + "END\n"; + +#endif diff --git a/src/gallium/state_trackers/vega/asm_util.h b/src/gallium/state_trackers/vega/asm_util.h new file mode 100644 index 0000000000..218e1d166d --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_util.h @@ -0,0 +1,136 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_UTIL_H +#define ASM_UTIL_H + + +static const char pass_through_depth_asm[] = + "FRAG1.1\n" + "DCL IN[0], POSITION, LINEAR\n" + "DCL OUT[0].z, POSITION, CONSTANT\n" + "0: MOV OUT[0].z, IN[0].zzzz\n" + "1: END\n"; + + + +/* μnew = μmask */ +static const char set_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL SAMP[0], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX OUT[0], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: END\n"; + +/* μnew = 1 – (1 – μmask)*(1 – μprev) */ +static const char union_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..3], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "2: SUB TEMP[2], CONST[0], TEMP[0]\n" + "3: SUB TEMP[3], CONST[0], TEMP[1]\n" + "4: MUL TEMP[0].w, TEMP[2].wwww, TEMP[3].wwww\n" + "5: SUB OUT[0], CONST[0], TEMP[0]\n" + "6: END\n"; + +/* μnew = μmask *μprev */ +static const char intersect_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..1], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "1: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "2: MUL OUT[0], TEMP[0].wwww, TEMP[1].wwww\n" + "3: END\n"; + +/* μnew = μprev*(1 – μmask) */ +static const char subtract_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "2: SUB TEMP[2], CONST[0], TEMP[1]\n" + "3: MUL OUT[0], TEMP[2].wwww, TEMP[0].wwww\n" + "4: END\n"; + + +static const char vs_plain_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL OUT[0], POSITION\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: END\n"; + +static const char vs_clear_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL IN[1]\n" + "DCL OUT[0], POSITION\n" + "DCL OUT[1], COLOR\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: MOV OUT[1], IN[1]\n" + "4: END\n"; + + +static const char vs_texture_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL IN[1]\n" + "DCL OUT[0], POSITION\n" + "DCL OUT[1], GENERIC\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: MOV OUT[1], IN[1]\n" + "4: END\n"; + +#endif diff --git a/src/gallium/state_trackers/vega/bezier.c b/src/gallium/state_trackers/vega/bezier.c new file mode 100644 index 0000000000..39a7ade016 --- /dev/null +++ b/src/gallium/state_trackers/vega/bezier.c @@ -0,0 +1,704 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "bezier.h" + +#include "matrix.h" +#include "polygon.h" + +#include "pipe/p_compiler.h" +#include "util/u_debug.h" + +#include +#include +#include +#include + +static const float flatness = 0.5; + + +static INLINE void split_left(struct bezier *bez, VGfloat t, struct bezier* left) +{ + left->x1 = bez->x1; + left->y1 = bez->y1; + + left->x2 = bez->x1 + t * (bez->x2 - bez->x1); + left->y2 = bez->y1 + t * (bez->y2 - bez->y1); + + left->x3 = bez->x2 + t * (bez->x3 - bez->x2); + left->y3 = bez->y2 + t * (bez->y3 - bez->y2); + + bez->x3 = bez->x3 + t * (bez->x4 - bez->x3); + bez->y3 = bez->y3 + t * (bez->y4 - bez->y3); + + bez->x2 = left->x3 + t * (bez->x3 - left->x3); + bez->y2 = left->y3 + t * (bez->y3 - left->y3); + + left->x3 = left->x2 + t * (left->x3 - left->x2); + left->y3 = left->y2 + t * (left->y3 - left->y2); + + left->x4 = bez->x1 = left->x3 + t * (bez->x2 - left->x3); + left->y4 = bez->y1 = left->y3 + t * (bez->y2 - left->y3); +} + +static INLINE void split(struct bezier *bez, + struct bezier *first_half, + struct bezier *second_half) +{ + double c = (bez->x2 + bez->x3) * 0.5; + first_half->x2 = (bez->x1 + bez->x2) * 0.5; + second_half->x3 = (bez->x3 + bez->x4) * 0.5; + first_half->x1 = bez->x1; + second_half->x4 = bez->x4; + first_half->x3 = (first_half->x2 + c) * 0.5; + second_half->x2 = (second_half->x3 + c) * 0.5; + first_half->x4 = second_half->x1 = + (first_half->x3 + second_half->x2) * 0.5; + + c = (bez->y2 + bez->y3) / 2; + first_half->y2 = (bez->y1 + bez->y2) * 0.5; + second_half->y3 = (bez->y3 + bez->y4) * 0.5; + first_half->y1 = bez->y1; + second_half->y4 = bez->y4; + first_half->y3 = (first_half->y2 + c) * 0.5; + second_half->y2 = (second_half->y3 + c) * 0.5; + first_half->y4 = second_half->y1 = + (first_half->y3 + second_half->y2) * 0.5; +} + +struct polygon * bezier_to_polygon(struct bezier *bez) +{ + struct polygon *poly = polygon_create(64); + polygon_vertex_append(poly, bez->x1, bez->y1); + bezier_add_to_polygon(bez, poly); + return poly; +} + +void bezier_add_to_polygon(const struct bezier *bez, + struct polygon *poly) +{ + struct bezier beziers[32]; + struct bezier *b; + + beziers[0] = *bez; + b = beziers; + + while (b >= beziers) { + double y4y1 = b->y4 - b->y1; + double x4x1 = b->x4 - b->x1; + double l = ABS(x4x1) + ABS(y4y1); + double d; + if (l > 1.f) { + d = ABS((x4x1)*(b->y1 - b->y2) - (y4y1)*(b->x1 - b->x2)) + + ABS((x4x1)*(b->y1 - b->y3) - (y4y1)*(b->x1 - b->x3)); + } else { + d = ABS(b->x1 - b->x2) + ABS(b->y1 - b->y2) + + ABS(b->x1 - b->x3) + ABS(b->y1 - b->y3); + l = 1.; + } + if (d < flatness*l || b == beziers + 31) { + /* good enough, we pop it off and add the endpoint */ + polygon_vertex_append(poly, b->x4, b->y4); + --b; + } else { + /* split, second half of the bezier goes lower into the stack */ + split(b, b+1, b); + ++b; + } + } +} + +static void add_if_close(struct bezier *bez, VGfloat *length, VGfloat error) +{ + struct bezier left, right; /* bez poly splits */ + VGfloat len = 0.0; /* arc length */ + VGfloat chord; /* chord length */ + + len = len + line_length(bez->x1, bez->y1, bez->x2, bez->y2); + len = len + line_length(bez->x2, bez->y2, bez->x3, bez->y3); + len = len + line_length(bez->x3, bez->y3, bez->x4, bez->y4); + + chord = line_length(bez->x1, bez->y1, bez->x4, bez->y4); + + if ((len-chord) > error) { + split(bez, &left, &right); /* split in two */ + add_if_close(&left, length, error); /* try left side */ + add_if_close(&right, length, error); /* try right side */ + return; + } + + *length = *length + len; + + return; +} + +float bezier_length(struct bezier *bez, float error) +{ + VGfloat length = 0.f; + + add_if_close(bez, &length, error); + return length; +} + +void bezier_init(struct bezier *bez, + float x1, float y1, + float x2, float y2, + float x3, float y3, + float x4, float y4) +{ + bez->x1 = x1; + bez->y1 = y1; + bez->x2 = x2; + bez->y2 = y2; + bez->x3 = x3; + bez->y3 = y3; + bez->x4 = x4; + bez->y4 = y4; +#if 0 + debug_printf("bezier in [%f, %f, %f, %f, %f, %f]\n", + x1, y1, x2, y2, x3, y3, x4, y4); +#endif +} + + +static INLINE void bezier_init2v(struct bezier *bez, + float *pt1, + float *pt2, + float *pt3, + float *pt4) +{ + bez->x1 = pt1[0]; + bez->y1 = pt1[1]; + + bez->x2 = pt2[0]; + bez->y2 = pt2[1]; + + bez->x3 = pt3[0]; + bez->y3 = pt3[1]; + + bez->x4 = pt4[0]; + bez->y4 = pt4[1]; +} + + +void bezier_transform(struct bezier *bez, + struct matrix *matrix) +{ + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, bez->x1, bez->y1, &bez->x1, &bez->y1); + matrix_map_point(matrix, bez->x2, bez->y2, &bez->x2, &bez->y2); + matrix_map_point(matrix, bez->x3, bez->y3, &bez->x3, &bez->y3); + matrix_map_point(matrix, bez->x4, bez->y4, &bez->x4, &bez->y4); +} + +static INLINE void bezier_point_at(const struct bezier *bez, float t, float *pt) +{ + float a, b, c, d; + float m_t; + m_t = 1. - t; + b = m_t * m_t; + c = t * t; + d = c * t; + a = b * m_t; + b *= 3. * t; + c *= 3. * m_t; + pt[0] = a*bez->x1 + b*bez->x2 + c*bez->x3 + d*bez->x4; + pt[1] = a*bez->y1 + b*bez->y2 + c*bez->y3 + d*bez->y4; +} + +static INLINE void bezier_normal_at(const struct bezier *bez, float t, float *norm) +{ + float m_t = 1. - t; + float a = m_t * m_t; + float b = t * m_t; + float c = t * t; + + norm[0] = (bez->y2-bez->y1) * a + (bez->y3-bez->y2) * b + (bez->y4-bez->y3) * c; + norm[1] = -(bez->x2-bez->x1) * a - (bez->x3-bez->x2) * b - (bez->x4-bez->x3) * c; +} + +enum shift_result { + Ok, + Discard, + Split, + Circle +}; + +static enum shift_result good_offset(const struct bezier *b1, + const struct bezier *b2, + float offset, float threshold) +{ + const float o2 = offset*offset; + const float max_dist_line = threshold*offset*offset; + const float max_dist_normal = threshold*offset; + const float spacing = 0.25; + for (float i = spacing; i < 0.99; i += spacing) { + float p1[2],p2[2], d, l; + float normal[2]; + bezier_point_at(b1, i, p1); + bezier_point_at(b2, i, p2); + d = (p1[0] - p2[0])*(p1[0] - p2[0]) + (p1[1] - p2[1])*(p1[1] - p2[1]); + if (ABS(d - o2) > max_dist_line) + return Split; + + bezier_normal_at(b1, i, normal); + l = ABS(normal[0]) + ABS(normal[1]); + if (l != 0.) { + d = ABS(normal[0]*(p1[1] - p2[1]) - normal[1]*(p1[0] - p2[0]) ) / l; + if (d > max_dist_normal) + return Split; + } + } + return Ok; +} + +static INLINE void shift_line_by_normal(float *l, float offset) +{ + float norm[4]; + float tx, ty; + + line_normal(l, norm); + line_normalize(norm); + + tx = (norm[2] - norm[0]) * offset; + ty = (norm[3] - norm[1]) * offset; + l[0] += tx; l[1] += ty; + l[2] += tx; l[3] += ty; +} + +static INLINE VGboolean is_bezier_line(float (*points)[2], int count) +{ + float dx13 = points[2][0] - points[0][0]; + float dy13 = points[2][1] - points[0][1]; + + float dx12 = points[1][0] - points[0][0]; + float dy12 = points[1][1] - points[0][1]; + + debug_assert(count > 2); + + if (count == 3) { + return floatsEqual(dx12 * dy13, dx13 * dy12); + } else if (count == 4) { + float dx14 = points[3][0] - points[0][0]; + float dy14 = points[3][1] - points[0][1]; + + return (floatsEqual(dx12 * dy13, dx13 * dy12) && + floatsEqual(dx12 * dy14, dx14 * dy12)); + } + + return VG_FALSE; +} + +static INLINE void compute_pt_normal(float *pt1, float *pt2, float *res) +{ + float line[4]; + float normal[4]; + line[0] = 0.f; line[1] = 0.f; + line[2] = pt2[0] - pt1[0]; + line[3] = pt2[1] - pt1[1]; + line_normal(line, normal); + line_normalize(normal); + + res[0] = normal[2]; + res[1] = normal[3]; +} + +static enum shift_result shift(const struct bezier *orig, + struct bezier *shifted, + float offset, float threshold) +{ + int map[4]; + VGboolean p1_p2_equal = (orig->x1 == orig->x2 && orig->y1 == orig->y2); + VGboolean p2_p3_equal = (orig->x2 == orig->x3 && orig->y2 == orig->y3); + VGboolean p3_p4_equal = (orig->x3 == orig->x4 && orig->y3 == orig->y4); + + float points[4][2]; + int np = 0; + float bounds[4]; + float points_shifted[4][2]; + float prev_normal[2]; + + points[np][0] = orig->x1; + points[np][1] = orig->y1; + map[0] = 0; + ++np; + if (!p1_p2_equal) { + points[np][0] = orig->x2; + points[np][1] = orig->y2; + ++np; + } + map[1] = np - 1; + if (!p2_p3_equal) { + points[np][0] = orig->x3; + points[np][1] = orig->y3; + ++np; + } + map[2] = np - 1; + if (!p3_p4_equal) { + points[np][0] = orig->x4; + points[np][1] = orig->y4; + ++np; + } + map[3] = np - 1; + if (np == 1) + return Discard; + + /* We need to specialcase lines of 3 or 4 points due to numerical + instability in intersection code below */ + if (np > 2 && is_bezier_line(points, np)) { + float l[4] = { points[0][0], points[0][1], + points[np-1][0], points[np-1][1] }; + float ctrl1[2], ctrl2[2]; + if (floatsEqual(points[0][0], points[np-1][0]) && + floatsEqual(points[0][1], points[np-1][1])) + return Discard; + + shift_line_by_normal(l, offset); + line_point_at(l, 0.33, ctrl1); + line_point_at(l, 0.66, ctrl2); + bezier_init(shifted, l[0], l[1], + ctrl1[0], ctrl1[1], ctrl2[0], ctrl2[1], + l[2], l[3]); + return Ok; + } + + bezier_bounds(orig, bounds); + if (np == 4 && bounds[2] < .1*offset && bounds[3] < .1*offset) { + float l = (orig->x1 - orig->x2)*(orig->x1 - orig->x2) + + (orig->y1 - orig->y2)*(orig->y1 - orig->y1) * + (orig->x3 - orig->x4)*(orig->x3 - orig->x4) + + (orig->y3 - orig->y4)*(orig->y3 - orig->y4); + float dot = (orig->x1 - orig->x2)*(orig->x3 - orig->x4) + + (orig->y1 - orig->y2)*(orig->y3 - orig->y4); + if (dot < 0 && dot*dot < 0.8*l) + /* the points are close and reverse dirction. Approximate the whole + thing by a semi circle */ + return Circle; + } + + compute_pt_normal(points[0], points[1], prev_normal); + + points_shifted[0][0] = points[0][0] + offset * prev_normal[0]; + points_shifted[0][1] = points[0][1] + offset * prev_normal[1]; + + for (int i = 1; i < np - 1; ++i) { + float normal_sum[2], r; + float next_normal[2]; + compute_pt_normal(points[i], points[i + 1], next_normal); + + normal_sum[0] = prev_normal[0] + next_normal[0]; + normal_sum[1] = prev_normal[1] + next_normal[1]; + + r = 1.0 + prev_normal[0] * next_normal[0] + + prev_normal[1] * next_normal[1]; + + if (floatsEqual(r + 1, 1)) { + points_shifted[i][0] = points[i][0] + offset * prev_normal[0]; + points_shifted[i][1] = points[i][1] + offset * prev_normal[1]; + } else { + float k = offset / r; + points_shifted[i][0] = points[i][0] + k * normal_sum[0]; + points_shifted[i][1] = points[i][1] + k * normal_sum[1]; + } + + prev_normal[0] = next_normal[0]; + prev_normal[1] = next_normal[1]; + } + + points_shifted[np - 1][0] = points[np - 1][0] + offset * prev_normal[0]; + points_shifted[np - 1][1] = points[np - 1][1] + offset * prev_normal[1]; + + bezier_init2v(shifted, + points_shifted[map[0]], points_shifted[map[1]], + points_shifted[map[2]], points_shifted[map[3]]); + + return good_offset(orig, shifted, offset, threshold); +} + +static VGboolean make_circle(const struct bezier *b, float offset, struct bezier *o) +{ + float normals[3][2]; + float dist; + float angles[2]; + float sign = 1.f; + int i; + float circle[3][2]; + + normals[0][0] = b->y2 - b->y1; + normals[0][1] = b->x1 - b->x2; + dist = sqrt(normals[0][0]*normals[0][0] + normals[0][1]*normals[0][1]); + if (floatsEqual(dist + 1, 1.f)) + return VG_FALSE; + normals[0][0] /= dist; + normals[0][1] /= dist; + + normals[2][0] = b->y4 - b->y3; + normals[2][1] = b->x3 - b->x4; + dist = sqrt(normals[2][0]*normals[2][0] + normals[2][1]*normals[2][1]); + if (floatsEqual(dist + 1, 1.f)) + return VG_FALSE; + normals[2][0] /= dist; + normals[2][1] /= dist; + + normals[1][0] = b->x1 - b->x2 - b->x3 + b->x4; + normals[1][1] = b->y1 - b->y2 - b->y3 + b->y4; + dist = -1*sqrt(normals[1][0]*normals[1][0] + normals[1][1]*normals[1][1]); + normals[1][0] /= dist; + normals[1][1] /= dist; + + for (i = 0; i < 2; ++i) { + float cos_a = normals[i][0]*normals[i+1][0] + normals[i][1]*normals[i+1][1]; + if (cos_a > 1.) + cos_a = 1.; + if (cos_a < -1.) + cos_a = -1; + angles[i] = acos(cos_a)/M_PI; + } + + if (angles[0] + angles[1] > 1.) { + /* more than 180 degrees */ + normals[1][0] = -normals[1][0]; + normals[1][1] = -normals[1][1]; + angles[0] = 1. - angles[0]; + angles[1] = 1. - angles[1]; + sign = -1.; + } + + circle[0][0] = b->x1 + normals[0][0]*offset; + circle[0][1] = b->y1 + normals[0][1]*offset; + + circle[1][0] = 0.5*(b->x1 + b->x4) + normals[1][0]*offset; + circle[1][1] = 0.5*(b->y1 + b->y4) + normals[1][1]*offset; + + circle[2][0] = b->x4 + normals[2][0]*offset; + circle[2][1] = b->y4 + normals[2][1]*offset; + + for (i = 0; i < 2; ++i) { + float kappa = 2.*KAPPA * sign * offset * angles[i]; + + o->x1 = circle[i][0]; + o->y1 = circle[i][1]; + o->x2 = circle[i][0] - normals[i][1]*kappa; + o->y2 = circle[i][1] + normals[i][0]*kappa; + o->x3 = circle[i+1][0] + normals[i+1][1]*kappa; + o->y3 = circle[i+1][1] - normals[i+1][0]*kappa; + o->x4 = circle[i+1][0]; + o->y4 = circle[i+1][1]; + + ++o; + } + return VG_TRUE; +} + +int bezier_translate_by_normal(struct bezier *bez, + struct bezier *curves, + int max_curves, + float normal_len, + float threshold) +{ + struct bezier beziers[10]; + struct bezier *b, *o; + + /* fixme: this should really be floatsEqual */ + if (bez->x1 == bez->x2 && bez->x1 == bez->x3 && bez->x1 == bez->x4 && + bez->y1 == bez->y2 && bez->y1 == bez->y3 && bez->y1 == bez->y4) + return 0; + + --max_curves; +redo: + beziers[0] = *bez; + b = beziers; + o = curves; + + while (b >= beziers) { + int stack_segments = b - beziers + 1; + enum shift_result res; + if ((stack_segments == 10) || (o - curves == max_curves - stack_segments)) { + threshold *= 1.5; + if (threshold > 2.) + goto give_up; + goto redo; + } + res = shift(b, o, normal_len, threshold); + if (res == Discard) { + --b; + } else if (res == Ok) { + ++o; + --b; + continue; + } else if (res == Circle && max_curves - (o - curves) >= 2) { + /* add semi circle */ + if (make_circle(b, normal_len, o)) + o += 2; + --b; + } else { + split(b, b+1, b); + ++b; + } + } + +give_up: + while (b >= beziers) { + enum shift_result res = shift(b, o, normal_len, threshold); + + /* if res isn't Ok or Split then *o is undefined */ + if (res == Ok || res == Split) + ++o; + + --b; + } + + debug_assert(o - curves <= max_curves); + return o - curves; +} + +void bezier_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/) +{ + float xmin = bez->x1; + float xmax = bez->x1; + float ymin = bez->y1; + float ymax = bez->y1; + + if (bez->x2 < xmin) + xmin = bez->x2; + else if (bez->x2 > xmax) + xmax = bez->x2; + if (bez->x3 < xmin) + xmin = bez->x3; + else if (bez->x3 > xmax) + xmax = bez->x3; + if (bez->x4 < xmin) + xmin = bez->x4; + else if (bez->x4 > xmax) + xmax = bez->x4; + + if (bez->y2 < ymin) + ymin = bez->y2; + else if (bez->y2 > ymax) + ymax = bez->y2; + if (bez->y3 < ymin) + ymin = bez->y3; + else if (bez->y3 > ymax) + ymax = bez->y3; + if (bez->y4 < ymin) + ymin = bez->y4; + else if (bez->y4 > ymax) + ymax = bez->y4; + + bounds[0] = xmin; /* x */ + bounds[1] = ymin; /* y */ + bounds[2] = xmax - xmin; /* width */ + bounds[3] = ymax - ymin; /* height */ +} + +void bezier_start_tangent(const struct bezier *bez, + float *tangent) +{ + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x2; + tangent[3] = bez->y2; + + if (null_line(tangent)) { + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x3; + tangent[3] = bez->y3; + } + if (null_line(tangent)) { + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x4; + tangent[3] = bez->y4; + } +} + + +static INLINE VGfloat bezier_t_at_length(struct bezier *bez, + VGfloat at_length, + VGfloat error) +{ + VGfloat len = bezier_length(bez, error); + VGfloat t = 1.0; + VGfloat last_bigger = 1.; + + if (at_length > len || floatsEqual(at_length, len)) + return t; + + if (floatIsZero(at_length)) + return 0.f; + + t *= 0.5; + while (1) { + struct bezier right = *bez; + struct bezier left; + VGfloat tmp_len; + split_left(&right, t, &left); + tmp_len = bezier_length(&left, error); + if (ABS(tmp_len - at_length) < error) + break; + + if (tmp_len < at_length) { + t += (last_bigger - t)*.5; + } else { + last_bigger = t; + t -= t*.5; + } + } + return t; +} + +void bezier_point_at_length(struct bezier *bez, + float length, + float *point, + float *normal) +{ + /* ~0.000001 seems to be required to pass G2080x tests */ + VGfloat t = bezier_t_at_length(bez, length, 0.000001); + bezier_point_at(bez, t, point); + bezier_normal_at(bez, t, normal); + vector_unit(normal); +} + +void bezier_point_at_t(struct bezier *bez, float t, + float *point, float *normal) +{ + bezier_point_at(bez, t, point); + bezier_normal_at(bez, t, normal); + vector_unit(normal); +} + +void bezier_exact_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/) +{ + struct polygon *poly = polygon_create(64); + polygon_vertex_append(poly, bez->x1, bez->y1); + bezier_add_to_polygon(bez, poly); + polygon_bounding_rect(poly, bounds); + polygon_destroy(poly); +} + diff --git a/src/gallium/state_trackers/vega/bezier.h b/src/gallium/state_trackers/vega/bezier.h new file mode 100644 index 0000000000..e06666051c --- /dev/null +++ b/src/gallium/state_trackers/vega/bezier.h @@ -0,0 +1,81 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef BEZIER_H +#define BEZIER_H + +struct polygon; +struct matrix; + +struct bezier { + float x1, y1; + float x2, y2; + float x3, y3; + float x4, y4; +}; + + +#define BEZIER_DEFAULT_ERROR 0.01 + +/* kappa as being l of a circle with r = 1, we can emulate any + * circle of radius r by using the formula + * l = r . kappa + * More at: + * http://www.whizkidtech.redprince.net/bezier/circle/ */ +#define KAPPA 0.5522847498 + +void bezier_init(struct bezier *bez, + float x1, float y1, + float x2, float y2, + float x3, float y3, + float x4, float y4); + +struct polygon *bezier_to_polygon(struct bezier *bez); +void bezier_add_to_polygon(const struct bezier *bez, + struct polygon *poly); +float bezier_length(struct bezier *bez, float error); +void bezier_transform(struct bezier *bez, + struct matrix *mat); + +int bezier_translate_by_normal(struct bezier *b, + struct bezier *curves, + int max_curves, + float normal_len, + float threshold); +void bezier_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/); +void bezier_exact_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/); + +void bezier_start_tangent(const struct bezier *bez, + float *tangent); + +void bezier_point_at_length(struct bezier *bez, float length, + float *point, float *normal); +void bezier_point_at_t(struct bezier *bez, float t, + float *point, float *normal); + +#endif diff --git a/src/gallium/state_trackers/vega/image.c b/src/gallium/state_trackers/vega/image.c new file mode 100644 index 0000000000..9a722980d5 --- /dev/null +++ b/src/gallium/state_trackers/vega/image.c @@ -0,0 +1,654 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "image.h" + +#include "vg_translate.h" +#include "vg_context.h" +#include "matrix.h" +#include "renderer.h" +#include "util_array.h" +#include "api_consts.h" +#include "shaders_cache.h" +#include "shader.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_blit.h" +#include "util/u_tile.h" +#include "util/u_memory.h" +#include "util/u_math.h" + +static enum pipe_format vg_format_to_pipe(VGImageFormat format) +{ + switch(format) { + case VG_sRGB_565: + return PIPE_FORMAT_R5G6B5_UNORM; + case VG_sRGBA_5551: + return PIPE_FORMAT_A1R5G5B5_UNORM; + case VG_sRGBA_4444: + return PIPE_FORMAT_A4R4G4B4_UNORM; + case VG_sL_8: + case VG_lL_8: + return PIPE_FORMAT_L8_UNORM; + case VG_BW_1: + return PIPE_FORMAT_A8R8G8B8_UNORM; + case VG_A_8: + return PIPE_FORMAT_A8_UNORM; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + case VG_A_4: + return PIPE_FORMAT_A8_UNORM; +#endif + default: + return PIPE_FORMAT_A8R8G8B8_UNORM; + } +} + +static INLINE void vg_sync_size(VGfloat *src_loc, VGfloat *dst_loc) +{ + src_loc[2] = MIN2(src_loc[2], dst_loc[2]); + src_loc[3] = MIN2(src_loc[3], dst_loc[3]); + dst_loc[2] = src_loc[2]; + dst_loc[3] = src_loc[3]; +} + + +static void vg_copy_texture(struct vg_context *ctx, + struct pipe_texture *dst, VGint dx, VGint dy, + struct pipe_texture *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + VGfloat dst_loc[4], src_loc[4]; + VGfloat dst_bounds[4], src_bounds[4]; + VGfloat src_shift[4], dst_shift[4], shift[4]; + + dst_loc[0] = dx; + dst_loc[1] = dy; + dst_loc[2] = width; + dst_loc[3] = height; + dst_bounds[0] = 0.f; + dst_bounds[1] = 0.f; + dst_bounds[2] = dst->width[0]; + dst_bounds[3] = dst->height[0]; + + src_loc[0] = sx; + src_loc[1] = sy; + src_loc[2] = width; + src_loc[3] = height; + src_bounds[0] = 0.f; + src_bounds[1] = 0.f; + src_bounds[2] = src->width[0]; + src_bounds[3] = src->height[0]; + + vg_bound_rect(src_loc, src_bounds, src_shift); + vg_bound_rect(dst_loc, dst_bounds, dst_shift); + shift[0] = src_shift[0] - dst_shift[0]; + shift[1] = src_shift[1] - dst_shift[1]; + + if (shift[0] < 0) + vg_shift_rectx(src_loc, src_bounds, -shift[0]); + else + vg_shift_rectx(dst_loc, dst_bounds, shift[0]); + + if (shift[1] < 0) + vg_shift_recty(src_loc, src_bounds, -shift[1]); + else + vg_shift_recty(dst_loc, dst_bounds, shift[1]); + + vg_sync_size(src_loc, dst_loc); + + if (src_loc[2] >= 0 && src_loc[3] >= 0 && + dst_loc[2] >= 0 && dst_loc[3] >= 0) { + renderer_copy_texture(ctx->renderer, + src, + src_loc[0], + src_loc[1] + src_loc[3], + src_loc[0] + src_loc[2], + src_loc[1], + dst, + dst_loc[0], + dst_loc[1] + dst_loc[3], + dst_loc[0] + dst_loc[2], + dst_loc[1]); + } + +} + +void vg_copy_surface(struct vg_context *ctx, + struct pipe_surface *dst, VGint dx, VGint dy, + struct pipe_surface *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + VGfloat dst_loc[4], src_loc[4]; + VGfloat dst_bounds[4], src_bounds[4]; + VGfloat src_shift[4], dst_shift[4], shift[4]; + + dst_loc[0] = dx; + dst_loc[1] = dy; + dst_loc[2] = width; + dst_loc[3] = height; + dst_bounds[0] = 0.f; + dst_bounds[1] = 0.f; + dst_bounds[2] = dst->width; + dst_bounds[3] = dst->height; + + src_loc[0] = sx; + src_loc[1] = sy; + src_loc[2] = width; + src_loc[3] = height; + src_bounds[0] = 0.f; + src_bounds[1] = 0.f; + src_bounds[2] = src->width; + src_bounds[3] = src->height; + + vg_bound_rect(src_loc, src_bounds, src_shift); + vg_bound_rect(dst_loc, dst_bounds, dst_shift); + shift[0] = src_shift[0] - dst_shift[0]; + shift[1] = src_shift[1] - dst_shift[1]; + + if (shift[0] < 0) + vg_shift_rectx(src_loc, src_bounds, -shift[0]); + else + vg_shift_rectx(dst_loc, dst_bounds, shift[0]); + + if (shift[1] < 0) + vg_shift_recty(src_loc, src_bounds, -shift[1]); + else + vg_shift_recty(dst_loc, dst_bounds, shift[1]); + + vg_sync_size(src_loc, dst_loc); + + if (src_loc[2] > 0 && src_loc[3] > 0 && + dst_loc[2] > 0 && dst_loc[3] > 0) { + if (src == dst) + renderer_copy_surface(ctx->renderer, + src, + src_loc[0], + src->height - (src_loc[1] + src_loc[3]), + src_loc[0] + src_loc[2], + src->height - src_loc[1], + dst, + dst_loc[0], + dst->height - (dst_loc[1] + dst_loc[3]), + dst_loc[0] + dst_loc[2], + dst->height - dst_loc[1], + 0, 0); + else + renderer_copy_surface(ctx->renderer, + src, + src_loc[0], + src->height - src_loc[1], + src_loc[0] + src_loc[2], + src->height - (src_loc[1] + src_loc[3]), + dst, + dst_loc[0], + dst->height - (dst_loc[1] + dst_loc[3]), + dst_loc[0] + dst_loc[2], + dst->height - dst_loc[1], + 0, 0); + } + +} + +static struct pipe_texture *image_texture(struct vg_image *img) +{ + struct pipe_texture *tex = img->texture; + return tex; +} + + +static void image_cleari(struct vg_image *img, VGint clear_colori, + VGint x, VGint y, VGint width, VGint height) +{ + VGint *clearbuf; + VGint i; + VGfloat dwidth, dheight; + + clearbuf = malloc(sizeof(VGint)*width*height); + for (i = 0; i < width*height; ++i) + clearbuf[i] = clear_colori; + + dwidth = MIN2(width, img->width); + dheight = MIN2(height, img->height); + + image_sub_data(img, clearbuf, width * sizeof(VGint), + VG_sRGBA_8888, + x, y, dwidth, dheight); + free(clearbuf); +} + +struct vg_image * image_create(VGImageFormat format, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *image = CALLOC_STRUCT(vg_image); + enum pipe_format pformat = vg_format_to_pipe(format); + struct pipe_texture pt, *newtex; + struct pipe_screen *screen = ctx->pipe->screen; + + vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE); + + image->format = format; + image->width = width; + image->height = height; + + image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.normalized_coords = 1; + + assert(screen->is_format_supported(screen, pformat, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + + memset(&pt, 0, sizeof(pt)); + pt.target = PIPE_TEXTURE_2D; + pt.format = pformat; + pf_get_block(pformat, &pt.block); + pt.last_level = 0; + pt.width[0] = width; + pt.height[0] = height; + pt.depth[0] = 1; + pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + newtex = screen->texture_create(screen, &pt); + + debug_assert(newtex); + + image->texture = newtex; + + vg_context_add_object(ctx, VG_OBJECT_IMAGE, image); + + image_cleari(image, 0, 0, 0, image->width, image->height); + return image; +} + +void image_destroy(struct vg_image *img) +{ + struct vg_context *ctx = vg_current_context(); + vg_context_remove_object(ctx, VG_OBJECT_IMAGE, img); + + + if (img->parent) { + /* remove img from the parent child array */ + int idx; + struct vg_image **array = + (struct vg_image **)img->parent->children_array->data; + + for (idx = 0; idx < img->parent->children_array->num_elements; ++idx) { + struct vg_image *child = array[idx]; + if (child == img) { + break; + } + } + debug_assert(idx < img->parent->children_array->num_elements); + array_remove_element(img->parent->children_array, idx); + } + + if (img->children_array && img->children_array->num_elements) { + /* reparent the children */ + VGint i; + struct vg_image *parent = img->parent; + struct vg_image **children = + (struct vg_image **)img->children_array->data; + if (!parent) { + VGint min_x = children[0]->x; + parent = children[0]; + + for (i = 1; i < img->children_array->num_elements; ++i) { + struct vg_image *child = children[i]; + if (child->x < min_x) { + parent = child; + } + } + } + + for (i = 0; i < img->children_array->num_elements; ++i) { + struct vg_image *child = children[i]; + if (child != parent) { + child->parent = parent; + if (!parent->children_array) { + parent->children_array = array_create( + sizeof(struct vg_image*)); + } + array_append_data(parent->children_array, + &child, 1); + } else + child->parent = NULL; + } + array_destroy(img->children_array); + } + + pipe_texture_reference(&img->texture, NULL); + free(img); +} + +void image_clear(struct vg_image *img, + VGint x, VGint y, VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat *clear_colorf = ctx->state.vg.clear_color; + VGubyte r, g, b ,a; + VGint clear_colori; + /* FIXME: this is very nasty */ + r = float_to_ubyte(clear_colorf[0]); + g = float_to_ubyte(clear_colorf[1]); + b = float_to_ubyte(clear_colorf[2]); + a = float_to_ubyte(clear_colorf[3]); + clear_colori = r << 24 | g << 16 | b << 8 | a; + image_cleari(img, clear_colori, x, y, width, height); +} + +void image_sub_data(struct vg_image *image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + const VGint yStep = 1; + VGubyte *src = (VGubyte *)data; + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint i; + struct vg_context *ctx = vg_current_context(); + struct pipe_screen *screen = ctx->pipe->screen; + struct pipe_texture *texture = image_texture(image); + VGint xoffset = 0, yoffset = 0; + + if (x < 0) { + xoffset -= x; + width += x; + x = 0; + } + if (y < 0) { + yoffset -= y; + height += y; + y = 0; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (x > image->width || y > image->width) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (x + width > image->width) { + width = image->width - x; + } + + if (y + height > image->height) { + height = image->height - y; + } + + { /* upload color_data */ + struct pipe_transfer *transfer = screen->get_tex_transfer( + screen, texture, 0, 0, 0, + PIPE_TRANSFER_WRITE, 0, 0, texture->width[0], texture->height[0]); + src += (dataStride * yoffset); + for (i = 0; i < height; i++) { + _vega_unpack_float_span_rgba(ctx, width, xoffset, src, dataFormat, temp); + pipe_put_tile_rgba(transfer, x+image->x, y+image->y, width, 1, df); + y += yStep; + src += dataStride; + } + screen->tex_transfer_destroy(transfer); + } +} + +void image_get_sub_data(struct vg_image * image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = 0, yStep = 1; + VGint i; + VGubyte *dst = (VGubyte *)data; + + { + struct pipe_transfer *transfer = + screen->get_tex_transfer(screen, + image->texture, 0, 0, 0, + PIPE_TRANSFER_READ, + 0, 0, + image->x + image->width, + image->y + image->height); + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(transfer, sx+image->x, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, dst); + dst += dataStride; + } + + screen->tex_transfer_destroy(transfer); + } +} + +struct vg_image * image_child_image(struct vg_image *parent, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *image = CALLOC_STRUCT(vg_image); + + vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE); + + image->x = parent->x + x; + image->y = parent->y + y; + image->width = width; + image->height = height; + image->parent = parent; + image->texture = 0; + pipe_texture_reference(&image->texture, + parent->texture); + + image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.normalized_coords = 1; + + if (!parent->children_array) + parent->children_array = array_create( + sizeof(struct vg_image*)); + + array_append_data(parent->children_array, + &image, 1); + + vg_context_add_object(ctx, VG_OBJECT_IMAGE, image); + + return image; +} + +void image_copy(struct vg_image *dst, VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + vg_copy_texture(ctx, dst->texture, dst->x + dx, dst->y + dy, + src->texture, src->x + sx, src->y + sy, width, height); +} + +void image_draw(struct vg_image *img) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat x1, y1; + VGfloat x2, y2; + VGfloat x3, y3; + VGfloat x4, y4; + struct matrix *matrix; + + x1 = 0; + y1 = 0; + x2 = img->width; + y2 = 0; + x3 = img->width; + y3 = img->height; + x4 = 0; + y4 = img->height; + + matrix = &ctx->state.vg.image_user_to_surface_matrix; + + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + matrix_map_point(matrix, x4, y4, &x4, &y4); + + shader_set_drawing_image(ctx->shader, VG_TRUE); + shader_set_paint(ctx->shader, ctx->state.vg.fill_paint); + shader_set_image(ctx->shader, img); + shader_bind(ctx->shader); + + renderer_texture_quad(ctx->renderer, image_texture(img), + img->x, img->y, img->x + img->width, img->y + img->height, + x1, y1, x2, y2, x3, y3, x4, y4); +} + +void image_set_pixels(VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_surface *surf; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + surf = screen->get_tex_surface(screen, image_texture(src), 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_READ); + + vg_copy_surface(ctx, strb->surface, dx, dy, + surf, sx+src->x, sy+src->y, width, height); + + screen->tex_surface_destroy(surf); +} + +void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_surface *surf; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + /* flip the y coordinates */ + /*dy = dst->height - dy - height;*/ + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + surf = screen->get_tex_surface(screen, image_texture(dst), 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE | + PIPE_BUFFER_USAGE_GPU_READ); + vg_copy_surface(ctx, surf, dst->x + dx, dst->y + dy, + strb->surface, sx, sy, width, height); + + pipe_surface_reference(&surf, NULL); +} + + +VGboolean vg_image_overlaps(struct vg_image *dst, + struct vg_image *src) +{ + if (dst == src || dst->parent == src || + dst == src->parent) + return VG_TRUE; + if (dst->parent && dst->parent == src->parent) { + VGfloat left1 = dst->x; + VGfloat left2 = src->x; + VGfloat right1 = dst->x + dst->width; + VGfloat right2 = src->x + src->width; + VGfloat bottom1 = dst->y; + VGfloat bottom2 = src->y; + VGfloat top1 = dst->y + dst->height; + VGfloat top2 = src->y + src->height; + + return !(left2 > right1 || right2 < left1 || + top2 > bottom1 || bottom2 < top1); + } + return VG_FALSE; +} + +VGint image_bind_samplers(struct vg_image *img, struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + img->sampler.min_img_filter = image_sampler_filter(img->base.ctx); + img->sampler.mag_img_filter = image_sampler_filter(img->base.ctx); + samplers[3] = &img->sampler; + textures[3] = img->texture; + return 1; +} + +VGint image_sampler_filter(struct vg_context *ctx) +{ + switch(ctx->state.vg.image_quality) { + case VG_IMAGE_QUALITY_NONANTIALIASED: + return PIPE_TEX_FILTER_NEAREST; + break; + case VG_IMAGE_QUALITY_FASTER: + return PIPE_TEX_FILTER_NEAREST; + break; + case VG_IMAGE_QUALITY_BETTER: + /*return PIPE_TEX_FILTER_ANISO;*/ + return PIPE_TEX_FILTER_LINEAR; + break; + default: + debug_printf("Unknown image quality"); + } + return PIPE_TEX_FILTER_NEAREST; +} diff --git a/src/gallium/state_trackers/vega/image.h b/src/gallium/state_trackers/vega/image.h new file mode 100644 index 0000000000..78e17cffa6 --- /dev/null +++ b/src/gallium/state_trackers/vega/image.h @@ -0,0 +1,104 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef IMAGES_H +#define IMAGES_H + +#include "vg_context.h" +#include "pipe/p_state.h" + +struct pipe_texture; +struct array; +struct vg_context; +struct pipe_surface; + +struct vg_image { + struct vg_object base; + VGImageFormat format; + VGint x, y; + VGint width, height; + + struct vg_image *parent; + + struct pipe_texture *texture; + struct pipe_sampler_state sampler; + + struct array *children_array; +}; + +struct vg_image *image_create(VGImageFormat format, + VGint width, VGint height); +void image_destroy(struct vg_image *img); + +void image_clear(struct vg_image *img, + VGint x, VGint y, VGint width, VGint height); + +void image_sub_data(struct vg_image *image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height); + +void image_get_sub_data(struct vg_image * image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height); + +struct vg_image *image_child_image(struct vg_image *parent, + VGint x, VGint y, + VGint width, VGint height); + +void image_copy(struct vg_image *dst, VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither); + +void image_draw(struct vg_image *img); + +void image_set_pixels(VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height); +void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height); + +VGint image_bind_samplers(struct vg_image *dst, struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +VGboolean vg_image_overlaps(struct vg_image *dst, + struct vg_image *src); + +VGint image_sampler_filter(struct vg_context *ctx); + +void vg_copy_surface(struct vg_context *ctx, + struct pipe_surface *dst, VGint dx, VGint dy, + struct pipe_surface *src, VGint sx, VGint sy, + VGint width, VGint height); + +#endif diff --git a/src/gallium/state_trackers/vega/mask.c b/src/gallium/state_trackers/vega/mask.c new file mode 100644 index 0000000000..24650a37d5 --- /dev/null +++ b/src/gallium/state_trackers/vega/mask.c @@ -0,0 +1,690 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "mask.h" + +#include "path.h" +#include "image.h" +#include "shaders_cache.h" +#include "renderer.h" +#include "asm_util.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_memory.h" + +struct vg_mask_layer { + struct vg_object base; + + VGint width; + VGint height; + + struct pipe_texture *texture; +}; + +static INLINE struct pipe_surface * +alpha_mask_surface(struct vg_context *ctx, int usage) +{ + struct pipe_screen *screen = ctx->pipe->screen; + struct st_framebuffer *stfb = ctx->draw_buffer; + return screen->get_tex_surface(screen, + stfb->alpha_mask, + 0, 0, 0, + usage); +} + +static INLINE VGboolean +intersect_rectangles(VGint dwidth, VGint dheight, + VGint swidth, VGint sheight, + VGint tx, VGint ty, + VGint twidth, VGint theight, + VGint *offsets, + VGint *location) +{ + if (tx + twidth <= 0 || tx >= dwidth) + return VG_FALSE; + if (ty + theight <= 0 || ty >= dheight) + return VG_FALSE; + + offsets[0] = 0; + offsets[1] = 0; + location[0] = tx; + location[1] = ty; + + if (tx < 0) { + offsets[0] -= tx; + location[0] = 0; + + location[2] = MIN2(tx + swidth, MIN2(dwidth, tx + twidth)); + offsets[2] = location[2]; + } else { + offsets[2] = MIN2(twidth, MIN2(dwidth - tx, swidth )); + location[2] = offsets[2]; + } + + if (ty < 0) { + offsets[1] -= ty; + location[1] = 0; + + location[3] = MIN2(ty + sheight, MIN2(dheight, ty + theight)); + offsets[3] = location[3]; + } else { + offsets[3] = MIN2(theight, MIN2(dheight - ty, sheight)); + location[3] = offsets[3]; + } + + return VG_TRUE; +} + +#if DEBUG_MASKS +static void read_alpha_mask(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->alpha_mask; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = (fb->height - sy) - 1, yStep = -1; + VGint i; + VGubyte *dst = (VGubyte *)data; + VGint xoffset = 0, yoffset = 0; + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + if (sx < 0) { + xoffset = -sx; + xoffset *= _vega_size_for_format(dataFormat); + width += sx; + sx = 0; + } + if (sy < 0) { + yoffset = -sy; + height += sy; + sy = 0; + y = (fb->height - sy) - 1; + yoffset *= dataStride; + } + + { + struct pipe_surface *surf; + + surf = screen->get_tex_surface(screen, strb->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_CPU_READ); + + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(surf, sx, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, + dst + yoffset + xoffset); + dst += dataStride; + } + + pipe_surface_reference(&surf, NULL); + } +} + +void save_alpha_to_file(const char *filename) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + VGint *data; + int i, j; + + data = malloc(sizeof(int) * fb->width * fb->height); + read_alpha_mask(data, fb->width * sizeof(int), + VG_sRGBA_8888, + 0, 0, fb->width, fb->height); + fprintf(stderr, "/*---------- start */\n"); + fprintf(stderr, "const int image_width = %d;\n", + fb->width); + fprintf(stderr, "const int image_height = %d;\n", + fb->height); + fprintf(stderr, "const int image_data = {\n"); + for (i = 0; i < fb->height; ++i) { + for (j = 0; j < fb->width; ++j) { + int rgba = data[i * fb->height + j]; + int argb = 0; + argb = (rgba >> 8); + argb |= ((rgba & 0xff) << 24); + fprintf(stderr, "0x%x, ", argb); + } + fprintf(stderr, "\n"); + } + fprintf(stderr, "};\n"); + fprintf(stderr, "/*---------- end */\n"); +} +#endif + +static void setup_mask_framebuffer(struct pipe_surface *surf, + VGint surf_width, VGint surf_height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state fb; + + memset(&fb, 0, sizeof(fb)); + fb.width = surf_width; + fb.height = surf_height; + fb.nr_cbufs = 1; + fb.cbufs[0] = surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso_context, &fb); +} + + +/* setup shader constants */ +static void setup_mask_operation(VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + const VGint param_bytes = 4 * sizeof(VGfloat); + const VGfloat ones[4] = {1.f, 1.f, 1.f, 1.f}; + void *shader = 0; + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. + */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, ones); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); + switch (operation) { + case VG_UNION_MASK: { + if (!ctx->mask.union_fs) { + ctx->mask.union_fs = shader_create_from_text(ctx->pipe, + union_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.union_fs->driver; + } + break; + case VG_INTERSECT_MASK: { + if (!ctx->mask.intersect_fs) { + ctx->mask.intersect_fs = shader_create_from_text(ctx->pipe, + intersect_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.intersect_fs->driver; + } + break; + case VG_SUBTRACT_MASK: { + if (!ctx->mask.subtract_fs) { + ctx->mask.subtract_fs = shader_create_from_text(ctx->pipe, + subtract_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.subtract_fs->driver; + } + break; + case VG_SET_MASK: { + if (!ctx->mask.set_fs) { + ctx->mask.set_fs = shader_create_from_text(ctx->pipe, + set_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.set_fs->driver; + } + break; + default: + assert(0); + break; + } + cso_set_fragment_shader_handle(ctx->cso_context, shader); +} + +static void setup_mask_samplers(struct pipe_texture *umask) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + struct pipe_texture *uprev = NULL; + struct pipe_sampler_state sampler; + + uprev = fb_buffers->blend_texture; + sampler = ctx->mask.sampler; + sampler.normalized_coords = 1; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + + samplers[0] = &sampler; + samplers[1] = &ctx->mask.sampler; + + textures[0] = umask; + textures[1] = uprev; + + cso_set_samplers(ctx->cso_context, 2, + (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, 2, textures); +} + + +/* setup shader constants */ +static void setup_mask_fill(const VGfloat color[4]) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + const VGint param_bytes = 4 * sizeof(VGfloat); + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. + */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, 0, param_bytes, color); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); + cso_set_fragment_shader_handle(ctx->cso_context, + shaders_cache_fill(ctx->sc, + VEGA_SOLID_FILL_SHADER)); +} + +static void setup_mask_viewport() +{ + struct vg_context *ctx = vg_current_context(); + vg_set_viewport(ctx, VEGA_Y0_TOP); +} + +static void setup_mask_blend() +{ + struct vg_context *ctx = vg_current_context(); + + struct pipe_blend_state blend; + + memset(&blend, 0, sizeof(struct pipe_blend_state)); + blend.blend_enable = 1; + blend.colormask |= PIPE_MASK_R; + blend.colormask |= PIPE_MASK_G; + blend.colormask |= PIPE_MASK_B; + blend.colormask |= PIPE_MASK_A; + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + + cso_set_blend(ctx->cso_context, &blend); +} + + +static void surface_fill(struct pipe_surface *surf, + int surf_width, int surf_height, + int x, int y, int width, int height, + const VGfloat color[4]) +{ + struct vg_context *ctx = vg_current_context(); + + if (x < 0) { + width += x; + x = 0; + } + if (y < 0) { + height += y; + y = 0; + } + + cso_save_framebuffer(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_blend(); + setup_mask_fill(color); + setup_mask_framebuffer(surf, surf_width, surf_height); + setup_mask_viewport(); + + renderer_draw_quad(ctx->renderer, x, y, + x + width, y + height, 0.0f/*depth should be disabled*/); + + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, + PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME, + NULL); + +#if DEBUG_MASKS + save_alpha_to_file(0); +#endif + + cso_restore_blend(ctx->cso_context); + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); +} + + +static void mask_using_texture(struct pipe_texture *texture, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_surface *surface = + alpha_mask_surface(ctx, PIPE_BUFFER_USAGE_GPU_WRITE); + VGint offsets[4], loc[4]; + + if (!surface) + return; + if (!intersect_rectangles(surface->width, surface->height, + texture->width[0], texture->height[0], + x, y, width, height, + offsets, loc)) + return; +#if 0 + debug_printf("Offset = [%d, %d, %d, %d]\n", offsets[0], + offsets[1], offsets[2], offsets[3]); + debug_printf("Locati = [%d, %d, %d, %d]\n", loc[0], + loc[1], loc[2], loc[3]); +#endif + + /* prepare our blend surface */ + vg_prepare_blend_surface_from_mask(ctx); + + cso_save_samplers(ctx->cso_context); + cso_save_sampler_textures(ctx->cso_context); + cso_save_framebuffer(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_samplers(texture); + setup_mask_blend(); + setup_mask_operation(operation); + setup_mask_framebuffer(surface, surface->width, surface->height); + setup_mask_viewport(); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_texture(ctx->renderer, texture, + offsets[0], offsets[1], + offsets[0] + offsets[2], offsets[1] + offsets[3], + loc[0], loc[1], loc[0] + loc[2], loc[1] + loc[3]); + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + cso_restore_blend(ctx->cso_context); + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_samplers(ctx->cso_context); + cso_restore_sampler_textures(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + + pipe_surface_reference(&surface, NULL); +} + + +#ifdef OPENVG_VERSION_1_1 + +struct vg_mask_layer * mask_layer_create(VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_mask_layer *mask = 0; + + mask = CALLOC_STRUCT(vg_mask_layer); + vg_init_object(&mask->base, ctx, VG_OBJECT_MASK); + mask->width = width; + mask->height = height; + + { + struct pipe_texture pt; + struct pipe_screen *screen = ctx->pipe->screen; + + memset(&pt, 0, sizeof(pt)); + pt.target = PIPE_TEXTURE_2D; + pt.format = PIPE_FORMAT_A8R8G8B8_UNORM; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &pt.block); + pt.last_level = 0; + pt.width[0] = width; + pt.height[0] = height; + pt.depth[0] = 1; + pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + pt.compressed = 0; + + mask->texture = screen->texture_create(screen, &pt); + } + + vg_context_add_object(ctx, VG_OBJECT_MASK, mask); + + return mask; +} + +void mask_layer_destroy(struct vg_mask_layer *layer) +{ + struct vg_context *ctx = vg_current_context(); + + vg_context_remove_object(ctx, VG_OBJECT_MASK, layer); + pipe_texture_release(&layer->texture); + free(layer); +} + +void mask_layer_fill(struct vg_mask_layer *layer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat alpha_color[4] = {0, 0, 0, 0}; + struct pipe_surface *surface; + + alpha_color[3] = value; + + surface = ctx->pipe->screen->get_tex_surface( + ctx->pipe->screen, layer->texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + surface_fill(surface, + layer->width, layer->height, + x, y, width, height, alpha_color); + + ctx->pipe->screen->tex_surface_release(ctx->pipe->screen, &surface); +} + +void mask_copy(struct vg_mask_layer *layer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + + renderer_copy_texture(ctx->renderer, + layer->texture, + sx, sy, + sx + width, sy + height, + fb_buffers->alpha_mask, + dx, dy, + dx + width, dy + height); +} + +static void mask_layer_render_to(struct vg_mask_layer *layer, + struct path *path, + VGbitfield paint_modes) +{ + struct vg_context *ctx = vg_current_context(); + const VGfloat fill_color[4] = {1.f, 1.f, 1.f, 1.f}; + struct pipe_screen *screen = ctx->pipe->screen; + struct pipe_surface *surface; + + surface = screen->get_tex_surface(screen, layer->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + cso_save_framebuffer(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_blend(); + setup_mask_fill(fill_color); + setup_mask_framebuffer(surface, layer->width, layer->height); + setup_mask_viewport(); + + if (paint_modes & VG_FILL_PATH) { + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + path_fill(path, mat); + } + + if (paint_modes & VG_STROKE_PATH){ + path_stroke(path); + } + + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + ctx->state.dirty |= BLEND_DIRTY; + + screen->tex_surface_release(ctx->pipe->screen, &surface); +} + +void mask_render_to(struct path *path, + VGbitfield paint_modes, + VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + struct vg_mask_layer *temp_layer; + VGint width, height; + + width = fb_buffers->alpha_mask->width[0]; + height = fb_buffers->alpha_mask->width[0]; + + temp_layer = mask_layer_create(width, height); + + mask_layer_render_to(temp_layer, path, paint_modes); + + mask_using_layer(temp_layer, 0, 0, width, height, + operation); + + mask_layer_destroy(temp_layer); +} + +void mask_using_layer(struct vg_mask_layer *layer, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + mask_using_texture(layer->texture, operation, + x, y, width, height); +} + +VGint mask_layer_width(struct vg_mask_layer *layer) +{ + return layer->width; +} + +VGint mask_layer_height(struct vg_mask_layer *layer) +{ + return layer->height; +} + + +#endif + +void mask_using_image(struct vg_image *image, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + mask_using_texture(image->texture, operation, + x, y, width, height); +} + +void mask_fill(VGint x, VGint y, VGint width, VGint height, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat alpha_color[4] = {.0f, .0f, .0f, value}; + struct pipe_surface *surf = alpha_mask_surface( + ctx, PIPE_BUFFER_USAGE_GPU_WRITE); + +#if DEBUG_MASKS + debug_printf("mask_fill(%d, %d, %d, %d) with rgba(%f, %f, %f, %f)\n", + x, y, width, height, + alpha_color[0], alpha_color[1], + alpha_color[2], alpha_color[3]); + debug_printf("XXX %f === %f \n", + alpha_color[3], value); +#endif + + surface_fill(surf, surf->width, surf->height, + x, y, width, height, alpha_color); + + pipe_surface_reference(&surf, NULL); +} + +VGint mask_bind_samplers(struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + struct vg_context *ctx = vg_current_context(); + + if (ctx->state.vg.masking) { + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + + samplers[1] = &ctx->mask.sampler; + textures[1] = fb_buffers->alpha_mask; + return 1; + } else + return 0; +} diff --git a/src/gallium/state_trackers/vega/mask.h b/src/gallium/state_trackers/vega/mask.h new file mode 100644 index 0000000000..5eaaede0e3 --- /dev/null +++ b/src/gallium/state_trackers/vega/mask.h @@ -0,0 +1,68 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef MASK_H +#define MASK_H + +#include "vg_context.h" + +struct path; +struct vg_image; +struct pipe_texture; + +struct vg_mask_layer *mask_layer_create(VGint width, VGint height); +void mask_layer_destroy(struct vg_mask_layer *layer); +void mask_layer_fill(struct vg_mask_layer *layer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value); +VGint mask_layer_width(struct vg_mask_layer *layer); +VGint mask_layer_height(struct vg_mask_layer *layer); +void mask_copy(struct vg_mask_layer *layer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height); + +void mask_render_to(struct path *path, + VGbitfield paint_modes, + VGMaskOperation operation); + +void mask_using_layer(struct vg_mask_layer *layer, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height); +void mask_using_image(struct vg_image *image, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height); +void mask_fill(VGint x, VGint y, + VGint width, VGint height, + VGfloat value); + +VGint mask_bind_samplers(struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +#endif diff --git a/src/gallium/state_trackers/vega/matrix.h b/src/gallium/state_trackers/vega/matrix.h new file mode 100644 index 0000000000..4c207f912a --- /dev/null +++ b/src/gallium/state_trackers/vega/matrix.h @@ -0,0 +1,462 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef MATRIX_H +#define MATRIX_H + +#include "VG/openvg.h" + +#include "pipe/p_compiler.h" +#include "util/u_math.h" + +#include +#include + +#define floatsEqual(x, y) (fabs(x - y) <= 0.00001f * MIN2(fabs(x), fabs(y))) +#define floatIsZero(x) (floatsEqual((x) + 1, 1)) +#define ABS(x) (fabsf(x)) + +#define DEGREES_TO_RADIANS(d) (0.0174532925199 * (d)) +#define FLT_TO_INT(flt) float_to_int_floor(((VGuint*)&(flt))[0]) + +static INLINE VGint float_to_int_floor(VGuint bits) +{ + int sign = (bits >> 31) ? -1 : 1; + int exp = ((bits >> 23) & 255) - 127; + int mant = bits & 0x007fffff; + int sh = 23 - exp; + + /* abs(value) >= 2^31 -> clamp. */ + + if (exp >= 31) + return (VGint)((sign < 0) ? 0x80000000u : 0x7fffffffu); + + /* abs(value) < 1 -> return -1 or 0. */ + + if (exp < 0) + return (sign < 0 && (exp > -127 || mant != 0)) ? -1 : 0; + + /* abs(value) >= 2^23 -> shift left. */ + + mant |= 0x00800000; + if (sh <= 0) + return sign * (mant << -sh); + + /* Negative -> add a rounding term. */ + + if (sign < 0) + mant += (1 << sh) - 1; + + /* Shift right to obtain the result. */ + + return sign * (mant >> sh); +} + + +struct matrix { + VGfloat m[9]; +}; + +static INLINE void matrix_init(struct matrix *mat, + const VGfloat *val) +{ + memcpy(mat->m, val, sizeof(VGfloat) * 9); +} + +static INLINE void matrix_inits(struct matrix *mat, + VGfloat m11, VGfloat m12, VGfloat m13, + VGfloat m21, VGfloat m22, VGfloat m23, + VGfloat m31, VGfloat m32, VGfloat m33) +{ + mat->m[0] = m11; mat->m[1] = m12; mat->m[2] = m13; + mat->m[3] = m21; mat->m[4] = m22; mat->m[5] = m23; + mat->m[6] = m31; mat->m[7] = m32; mat->m[8] = m33; +} + +static INLINE void matrix_load_identity(struct matrix *matrix) +{ + static const VGfloat identity[9] = {1.f, 0.f, 0.f, + 0.f, 1.f, 0.f, + 0.f, 0.f, 1.f}; + memcpy(matrix->m, identity, sizeof(identity)); +} + +static INLINE VGboolean matrix_is_identity(struct matrix *matrix) +{ + return floatsEqual(matrix->m[0], 1) && floatIsZero(matrix->m[1]) && + floatIsZero(matrix->m[2]) && + floatIsZero(matrix->m[3]) && floatsEqual(matrix->m[4], 1) && + floatIsZero(matrix->m[5]) && + floatIsZero(matrix->m[6]) && floatIsZero(matrix->m[7]) && + floatIsZero(matrix->m[8]); +} + +static INLINE VGboolean matrix_is_affine(struct matrix *matrix) +{ + return floatIsZero(matrix->m[2]) && floatIsZero(matrix->m[5]) + && floatsEqual(matrix->m[8], 1); +} + + +static INLINE void matrix_make_affine(struct matrix *matrix) +{ + matrix->m[2] = 0.f; + matrix->m[5] = 0.f; + matrix->m[8] = 1.f; +} + +static INLINE void matrix_mult(struct matrix *dst, + struct matrix *src) +{ + VGfloat m11 = dst->m[0]*src->m[0] + dst->m[3]*src->m[1] + dst->m[6]*src->m[2]; + VGfloat m12 = dst->m[0]*src->m[3] + dst->m[3]*src->m[4] + dst->m[6]*src->m[5]; + VGfloat m13 = dst->m[0]*src->m[6] + dst->m[3]*src->m[7] + dst->m[6]*src->m[8]; + + VGfloat m21 = dst->m[1]*src->m[0] + dst->m[4]*src->m[1] + dst->m[7]*src->m[2]; + VGfloat m22 = dst->m[1]*src->m[3] + dst->m[4]*src->m[4] + dst->m[7]*src->m[5]; + VGfloat m23 = dst->m[1]*src->m[6] + dst->m[4]*src->m[7] + dst->m[7]*src->m[8]; + + VGfloat m31 = dst->m[2]*src->m[0] + dst->m[5]*src->m[1] + dst->m[8]*src->m[2]; + VGfloat m32 = dst->m[2]*src->m[3] + dst->m[5]*src->m[4] + dst->m[8]*src->m[5]; + VGfloat m33 = dst->m[2]*src->m[6] + dst->m[5]*src->m[7] + dst->m[8]*src->m[8]; + + dst->m[0] = m11; dst->m[1] = m21; dst->m[2] = m31; + dst->m[3] = m12; dst->m[4] = m22; dst->m[5] = m32; + dst->m[6] = m13; dst->m[7] = m23; dst->m[8] = m33; +} + + +static INLINE void matrix_map_point(struct matrix *mat, + VGfloat x, VGfloat y, + VGfloat *out_x, VGfloat *out_y) +{ + /* to be able to do matrix_map_point(m, x, y, &x, &y) use + * temporaries */ + VGfloat tmp_x = x, tmp_y = y; + + *out_x = mat->m[0]*tmp_x + mat->m[3]*tmp_y + mat->m[6]; + *out_y = mat->m[1]*tmp_x + mat->m[4]*tmp_y + mat->m[7]; + if (!matrix_is_affine(mat)) { + VGfloat w = 1/(mat->m[2]*tmp_x + mat->m[5]*tmp_y + mat->m[8]); + *out_x *= w; + *out_y *= w; + } +} + +static INLINE void matrix_translate(struct matrix *dst, + VGfloat tx, VGfloat ty) +{ + if (!matrix_is_affine(dst)) { + struct matrix trans_matrix; + matrix_load_identity(&trans_matrix); + trans_matrix.m[6] = tx; + trans_matrix.m[7] = ty; + matrix_mult(dst, &trans_matrix); + } else { + dst->m[6] += tx*dst->m[0] + ty*dst->m[3]; + dst->m[7] += ty*dst->m[4] + tx*dst->m[1]; + } +} + +static INLINE void matrix_scale(struct matrix *dst, + VGfloat sx, VGfloat sy) +{ + if (!matrix_is_affine(dst)) { + struct matrix scale_matrix; + matrix_load_identity(&scale_matrix); + scale_matrix.m[0] = sx; + scale_matrix.m[4] = sy; + matrix_mult(dst, &scale_matrix); + } else { + dst->m[0] *= sx; dst->m[1] *= sx; + dst->m[3] *= sy; dst->m[4] *= sy; + } +} + +static INLINE void matrix_shear(struct matrix *dst, + VGfloat shx, VGfloat shy) +{ + struct matrix shear_matrix; + matrix_load_identity(&shear_matrix); + shear_matrix.m[1] = shy; + shear_matrix.m[3] = shx; + matrix_mult(dst, &shear_matrix); +} + +static INLINE void matrix_rotate(struct matrix *dst, + VGfloat angle) +{ + struct matrix mat; + float sin_val = 0; + float cos_val = 0; + + + if (floatsEqual(angle, 90) || floatsEqual(angle, -270)) + sin_val = 1.f; + else if (floatsEqual(angle, 270) || floatsEqual(angle, -90)) + sin_val = -1.f; + else if (floatsEqual(angle, 180)) + cos_val = -1.f; + else { + float radians = DEGREES_TO_RADIANS(angle); + sin_val = sin(radians); + cos_val = cos(radians); + } + + if (!matrix_is_affine(dst)) { + matrix_load_identity(&mat); + mat.m[0] = cos_val; mat.m[1] = sin_val; + mat.m[3] = -sin_val; mat.m[4] = cos_val; + + matrix_mult(dst, &mat); + } else { + VGfloat m11 = cos_val*dst->m[0] + sin_val*dst->m[3]; + VGfloat m12 = cos_val*dst->m[1] + sin_val*dst->m[4]; + VGfloat m21 = -sin_val*dst->m[0] + cos_val*dst->m[3]; + VGfloat m22 = -sin_val*dst->m[1] + cos_val*dst->m[4]; + dst->m[0] = m11; dst->m[1] = m12; + dst->m[3] = m21; dst->m[4] = m22; + } +} + + +static INLINE VGfloat matrix_determinant(struct matrix *mat) +{ + return mat->m[0]*(mat->m[8]*mat->m[4]-mat->m[7]*mat->m[5]) - + mat->m[3]*(mat->m[8]*mat->m[1]-mat->m[7]*mat->m[2])+ + mat->m[6]*(mat->m[5]*mat->m[1]-mat->m[4]*mat->m[2]); +} + + +static INLINE void matrix_adjoint(struct matrix *mat) +{ + VGfloat h[9]; + h[0] = mat->m[4]*mat->m[8] - mat->m[5]*mat->m[7]; + h[3] = mat->m[5]*mat->m[6] - mat->m[3]*mat->m[8]; + h[6] = mat->m[3]*mat->m[7] - mat->m[4]*mat->m[6]; + h[1] = mat->m[2]*mat->m[7] - mat->m[1]*mat->m[8]; + h[4] = mat->m[0]*mat->m[8] - mat->m[2]*mat->m[6]; + h[7] = mat->m[1]*mat->m[6] - mat->m[0]*mat->m[7]; + h[2] = mat->m[1]*mat->m[5] - mat->m[2]*mat->m[4]; + h[5] = mat->m[2]*mat->m[3] - mat->m[0]*mat->m[5]; + h[8] = mat->m[0]*mat->m[4] - mat->m[1]*mat->m[3]; + + + memcpy(mat->m, h, sizeof(VGfloat) * 9); +} + +static INLINE void matrix_divs(struct matrix *mat, + VGfloat s) +{ + mat->m[0] /= s; + mat->m[1] /= s; + mat->m[2] /= s; + mat->m[3] /= s; + mat->m[4] /= s; + mat->m[5] /= s; + mat->m[6] /= s; + mat->m[7] /= s; + mat->m[8] /= s; +} + +static INLINE VGboolean matrix_invert(struct matrix *mat) +{ + VGfloat det = matrix_determinant(mat); + + if (floatIsZero(det)) + return VG_FALSE; + + matrix_adjoint(mat); + matrix_divs(mat, det); + return VG_TRUE; +} + +static INLINE VGboolean matrix_is_invertible(struct matrix *mat) +{ + return !floatIsZero(matrix_determinant(mat)); +} + + +static INLINE VGboolean matrix_square_to_quad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx3, VGfloat dy3, + VGfloat dx2, VGfloat dy2, + struct matrix *mat) +{ + VGfloat ax = dx0 - dx1 + dx2 - dx3; + VGfloat ay = dy0 - dy1 + dy2 - dy3; + + if (floatIsZero(ax) && floatIsZero(ay)) { + /* affine case */ + matrix_inits(mat, + dx1 - dx0, dy1 - dy0, 0, + dx2 - dx1, dy2 - dy1, 0, + dx0, dy0, 1); + } else { + VGfloat a, b, c, d, e, f, g, h; + VGfloat ax1 = dx1 - dx2; + VGfloat ax2 = dx3 - dx2; + VGfloat ay1 = dy1 - dy2; + VGfloat ay2 = dy3 - dy2; + + /* determinants */ + VGfloat gtop = ax * ay2 - ax2 * ay; + VGfloat htop = ax1 * ay - ax * ay1; + VGfloat bottom = ax1 * ay2 - ax2 * ay1; + + if (!bottom) + return VG_FALSE; + + g = gtop / bottom; + h = htop / bottom; + + a = dx1 - dx0 + g * dx1; + b = dx3 - dx0 + h * dx3; + c = dx0; + d = dy1 - dy0 + g * dy1; + e = dy3 - dy0 + h * dy3; + f = dy0; + + matrix_inits(mat, + a, d, g, + b, e, h, + c, f, 1.f); + } + + return VG_TRUE; +} + +static INLINE VGboolean matrix_quad_to_square(VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + struct matrix *mat) +{ + if (!matrix_square_to_quad(sx0, sy0, sx1, sy1, + sx2, sy2, sx3, sy3, + mat)) + return VG_FALSE; + + return matrix_invert(mat); +} + + +static INLINE VGboolean matrix_quad_to_quad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + struct matrix *mat) +{ + struct matrix sqr_to_qd; + + if (!matrix_square_to_quad(dx0, dy0, dx1, dy1, + dx2, dy2, dx3, dy3, + mat)) + return VG_FALSE; + + if (!matrix_quad_to_square(sx0, sy0, sx1, sy1, + sx2, sy2, sx3, sy3, + &sqr_to_qd)) + return VG_FALSE; + + matrix_mult(mat, &sqr_to_qd); + + return VG_TRUE; +} + + +static INLINE VGboolean null_line(const VGfloat *l) +{ + return floatsEqual(l[0], l[2]) && floatsEqual(l[1], l[3]); +} + +static INLINE void line_normal(float *l, float *norm) +{ + norm[0] = l[0]; + norm[1] = l[1]; + + norm[2] = l[0] + (l[3] - l[1]); + norm[3] = l[1] - (l[2] - l[0]); +} + +static INLINE void line_normalize(float *l) +{ + float x = l[2] - l[0]; + float y = l[3] - l[1]; + float len = sqrt(x*x + y*y); + l[2] = l[0] + x/len; + l[3] = l[1] + y/len; +} + +static INLINE VGfloat line_length(VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2) +{ + VGfloat x = x2 - x1; + VGfloat y = y2 - y1; + return sqrt(x*x + y*y); +} + +static INLINE VGfloat line_lengthv(const VGfloat *l) +{ + VGfloat x = l[2] - l[0]; + VGfloat y = l[3] - l[1]; + return sqrt(x*x + y*y); +} + + +static INLINE void line_point_at(float *l, float t, float *pt) +{ + float dx = l[2] - l[0]; + float dy = l[3] - l[1]; + + pt[0] = l[0] + dx * t; + pt[1] = l[1] + dy * t; +} + +static INLINE void vector_unit(float *vec) +{ + float len = sqrt(vec[0] * vec[0] + vec[1] * vec[1]); + vec[0] /= len; + vec[1] /= len; +} + +static INLINE void line_normal_vector(float *line, float *vec) +{ + VGfloat normal[4]; + + line_normal(line, normal); + + vec[0] = normal[2] - normal[0]; + vec[1] = normal[3] - normal[1]; + + vector_unit(vec); +} + +#endif diff --git a/src/gallium/state_trackers/vega/paint.c b/src/gallium/state_trackers/vega/paint.c new file mode 100644 index 0000000000..04a6ba9cdc --- /dev/null +++ b/src/gallium/state_trackers/vega/paint.c @@ -0,0 +1,699 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "paint.h" + +#include "shaders_cache.h" +#include "matrix.h" +#include "image.h" +#include "st_inlines.h" + +#include "pipe/p_compiler.h" +#include "pipe/p_inlines.h" + +#include "util/u_memory.h" +#include "util/u_math.h" + +#include "cso_cache/cso_context.h" + +struct vg_paint { + struct vg_object base; + + VGPaintType type; + + struct { + VGfloat color[4]; + VGint colori[4]; + } solid; + + struct { + VGColorRampSpreadMode spread; + VGuint color_data[1024]; + struct { + VGfloat coords[4]; + VGint coordsi[4]; + } linear; + struct { + VGfloat vals[5]; + VGint valsi[5]; + } radial; + struct pipe_texture *texture; + struct pipe_sampler_state sampler; + + VGfloat *ramp_stops; + VGint *ramp_stopsi; + VGint num_stops; + + VGboolean color_ramps_premultiplied; + } gradient; + + struct { + struct pipe_texture *texture; + VGTilingMode tiling_mode; + struct pipe_sampler_state sampler; + } pattern; + + struct pipe_constant_buffer cbuf; + struct pipe_shader_state fs_state; + void *fs; +}; + +static INLINE VGuint mix_pixels(VGuint p1, VGuint a, VGuint p2, VGuint b) +{ + VGuint t = (p1 & 0xff00ff) * a + (p2 & 0xff00ff) * b; + t >>= 8; t &= 0xff00ff; + + p1 = ((p1 >> 8) & 0xff00ff) * a + ((p2 >> 8) & 0xff00ff) * b; + p1 &= 0xff00ff00; p1 |= t; + + return p1; +} + +static INLINE VGuint float4_to_argb(const VGfloat *clr) +{ + return float_to_ubyte(clr[3]) << 24 | + float_to_ubyte(clr[0]) << 16 | + float_to_ubyte(clr[1]) << 8 | + float_to_ubyte(clr[2]) << 0; +} + +static INLINE void create_gradient_data(const VGfloat *ramp_stops, + VGint num, + VGuint *data, + VGint size) +{ + VGint i; + VGint pos = 0; + VGfloat fpos = 0, incr = 1.f / size; + VGuint last_color; + + while (fpos < ramp_stops[0]) { + data[pos] = float4_to_argb(ramp_stops + 1); + fpos += incr; + ++pos; + } + + for (i = 0; i < num - 1; ++i) { + VGint rcur = 5 * i; + VGint rnext = 5 * (i + 1); + VGfloat delta = 1.f/(ramp_stops[rnext] - ramp_stops[rcur]); + while (fpos < ramp_stops[rnext] && pos < size) { + VGint dist = 256 * ((fpos - ramp_stops[rcur]) * delta); + VGint idist = 256 - dist; + VGuint current_color = float4_to_argb(ramp_stops + rcur + 1); + VGuint next_color = float4_to_argb(ramp_stops + rnext + 1); + data[pos] = mix_pixels(current_color, idist, + next_color, dist); + fpos += incr; + ++pos; + } + } + + last_color = float4_to_argb(ramp_stops + ((num - 1) * 5 + 1)); + while (pos < size) { + data[pos] = last_color; + ++pos; + } + data[size-1] = last_color; +} + +static INLINE struct pipe_texture *create_gradient_texture(struct vg_paint *p) +{ + struct pipe_context *pipe = p->base.ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_texture *tex = 0; + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + templ.target = PIPE_TEXTURE_1D; + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + templ.last_level = 0; + templ.width[0] = 1024; + templ.height[0] = 1; + templ.depth[0] = 1; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block); + templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + tex = screen->texture_create(screen, &templ); + + { /* upload color_data */ + struct pipe_transfer *transfer = + st_no_flush_get_tex_transfer(p->base.ctx, tex, 0, 0, 0, + PIPE_TRANSFER_WRITE, 0, 0, 1024, 1); + void *map = screen->transfer_map(screen, transfer); + memcpy(map, p->gradient.color_data, sizeof(VGint)*1024); + screen->transfer_unmap(screen, transfer); + screen->tex_transfer_destroy(transfer); + } + + return tex; +} + +struct vg_paint * paint_create(struct vg_context *ctx) +{ + struct vg_paint *paint = CALLOC_STRUCT(vg_paint); + const VGfloat default_color[] = {0.0f, 0.0f, 0.0f, 1.0f}; + const VGfloat def_ling[] = {0.0f, 0.0f, 1.0f, 0.0f}; + const VGfloat def_radg[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f}; + vg_init_object(&paint->base, ctx, VG_OBJECT_PAINT); + vg_context_add_object(ctx, VG_OBJECT_PAINT, paint); + + paint->type = VG_PAINT_TYPE_COLOR; + memcpy(paint->solid.color, default_color, + 4 * sizeof(VGfloat)); + paint->gradient.spread = VG_COLOR_RAMP_SPREAD_PAD; + memcpy(paint->gradient.linear.coords, def_ling, + 4 * sizeof(VGfloat)); + memcpy(paint->gradient.radial.vals, def_radg, + 5 * sizeof(VGfloat)); + + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->gradient.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->gradient.sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + paint->gradient.sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + paint->gradient.sampler.normalized_coords = 1; + + memcpy(&paint->pattern.sampler, + &paint->gradient.sampler, + sizeof(struct pipe_sampler_state)); + + return paint; +} + +void paint_destroy(struct vg_paint *paint) +{ + struct vg_context *ctx = paint->base.ctx; + if (paint->pattern.texture) + pipe_texture_reference(&paint->pattern.texture, NULL); + if (ctx) + vg_context_remove_object(ctx, VG_OBJECT_PAINT, paint); + + free(paint->gradient.ramp_stopsi); + free(paint->gradient.ramp_stops); + free(paint); +} + +void paint_set_color(struct vg_paint *paint, + const VGfloat *color) +{ + paint->solid.color[0] = color[0]; + paint->solid.color[1] = color[1]; + paint->solid.color[2] = color[2]; + paint->solid.color[3] = color[3]; + + paint->solid.colori[0] = FLT_TO_INT(color[0]); + paint->solid.colori[1] = FLT_TO_INT(color[1]); + paint->solid.colori[2] = FLT_TO_INT(color[2]); + paint->solid.colori[3] = FLT_TO_INT(color[3]); +} + +static INLINE void paint_color_buffer(struct vg_paint *paint, void *buffer) +{ + VGfloat *map = (VGfloat*)buffer; + memcpy(buffer, paint->solid.color, 4 * sizeof(VGfloat)); + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; +} + +static INLINE void paint_linear_gradient_buffer(struct vg_paint *paint, void *buffer) +{ + struct vg_context *ctx = paint->base.ctx; + VGfloat *map = (VGfloat*)buffer; + + map[0] = paint->gradient.linear.coords[2] - paint->gradient.linear.coords[0]; + map[1] = paint->gradient.linear.coords[3] - paint->gradient.linear.coords[1]; + map[2] = 1.f / (map[0] * map[0] + map[1] * map[1]); + map[3] = 1.f; + + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; + { + struct matrix mat; + struct matrix inv; + matrix_load_identity(&mat); + matrix_translate(&mat, -paint->gradient.linear.coords[0], -paint->gradient.linear.coords[1]); + memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&inv); + matrix_mult(&inv, &mat); + memcpy(&mat, &inv, + sizeof(struct matrix)); + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } +#if 0 + debug_printf("Coords (%f, %f, %f, %f)\n", + map[0], map[1], map[2], map[3]); +#endif +} + + +static INLINE void paint_radial_gradient_buffer(struct vg_paint *paint, void *buffer) +{ + VGfloat *radialCoords = paint->gradient.radial.vals; + struct vg_context *ctx = paint->base.ctx; + + VGfloat *map = (VGfloat*)buffer; + + map[0] = radialCoords[0] - radialCoords[2]; + map[1] = radialCoords[1] - radialCoords[3]; + map[2] = -map[0] * map[0] - map[1] * map[1] + + radialCoords[4] * radialCoords[4]; + map[3] = 1.f; + + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; + + { + struct matrix mat; + struct matrix inv; + matrix_load_identity(&mat); + matrix_translate(&mat, -radialCoords[2], -radialCoords[3]); + memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&inv); + matrix_mult(&inv, &mat); + memcpy(&mat, &inv, + sizeof(struct matrix)); + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } + +#if 0 + debug_printf("Coords (%f, %f, %f, %f)\n", + map[0], map[1], map[2], map[3]); +#endif +} + + +static INLINE void paint_pattern_buffer(struct vg_paint *paint, void *buffer) +{ + struct vg_context *ctx = paint->base.ctx; + + VGfloat *map = (VGfloat *)buffer; + memcpy(map, paint->solid.color, 4 * sizeof(VGfloat)); + + map[4] = 0.f; + map[5] = 1.f; + map[6] = paint->pattern.texture->width[0]; + map[7] = paint->pattern.texture->height[0]; + { + struct matrix mat; + memcpy(&mat, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&mat); + { + struct matrix pm; + memcpy(&pm, &ctx->state.vg.path_user_to_surface_matrix, + sizeof(struct matrix)); + matrix_invert(&pm); + matrix_mult(&pm, &mat); + memcpy(&mat, &pm, sizeof(struct matrix)); + } + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } +} + +void paint_set_type(struct vg_paint *paint, VGPaintType type) +{ + paint->type = type; +} + +void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops, + int num) +{ + const VGfloat default_stops[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f, + 1.0f, 1.0f, 1.0f, 1.0f, 1.0f}; + VGint i; + const VGint num_stops = num / 5; + VGfloat last_coord; + + paint->gradient.num_stops = num; + if (num) { + free(paint->gradient.ramp_stops); + paint->gradient.ramp_stops = malloc(sizeof(VGfloat)*num); + memcpy(paint->gradient.ramp_stops, stops, sizeof(VGfloat)*num); + } else + return; + + /* stops must be in increasing order. the last stop is 1.0. if the + * first one is bigger than 1 then the whole sequence is invalid*/ + if (stops[0] > 1) { + stops = default_stops; + num = 10; + } + last_coord = stops[0]; + for (i = 1; i < num_stops; ++i) { + VGint idx = 5 * i; + VGfloat coord = stops[idx]; + if (!floatsEqual(last_coord, coord) && coord < last_coord) { + stops = default_stops; + num = 10; + break; + } + last_coord = coord; + } + + create_gradient_data(stops, num / 5, paint->gradient.color_data, + 1024); + + if (paint->gradient.texture) { + pipe_texture_reference(&paint->gradient.texture, NULL); + paint->gradient.texture = 0; + } + + paint->gradient.texture = create_gradient_texture(paint); +} + +void paint_set_colori(struct vg_paint *p, + VGuint rgba) +{ + p->solid.color[0] = ((rgba >> 24) & 0xff) / 255.f; + p->solid.color[1] = ((rgba >> 16) & 0xff) / 255.f; + p->solid.color[2] = ((rgba >> 8) & 0xff) / 255.f; + p->solid.color[3] = ((rgba >> 0) & 0xff) / 255.f; +} + +VGuint paint_colori(struct vg_paint *p) +{ +#define F2B(f) (float_to_ubyte(f)) + + return ((F2B(p->solid.color[0]) << 24) | + (F2B(p->solid.color[1]) << 16) | + (F2B(p->solid.color[2]) << 8) | + (F2B(p->solid.color[3]) << 0)); +#undef F2B +} + +void paint_set_linear_gradient(struct vg_paint *paint, + const VGfloat *coords) +{ + memcpy(paint->gradient.linear.coords, coords, sizeof(VGfloat) * 4); +} + +void paint_set_spread_mode(struct vg_paint *paint, + VGint mode) +{ + paint->gradient.spread = mode; + switch(mode) { + case VG_COLOR_RAMP_SPREAD_PAD: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT; + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + } +} + +VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint) +{ + return paint->gradient.spread; +} + +void paint_set_radial_gradient(struct vg_paint *paint, + const VGfloat *values) +{ + memcpy(paint->gradient.radial.vals, values, sizeof(VGfloat) * 5); +} + +void paint_set_pattern(struct vg_paint *paint, + struct vg_image *img) +{ + if (paint->pattern.texture) + pipe_texture_reference(&paint->pattern.texture, NULL); + + paint->pattern.texture = 0; + pipe_texture_reference(&paint->pattern.texture, + img->texture); +} + +void paint_set_pattern_tiling(struct vg_paint *paint, + VGTilingMode mode) +{ + paint->pattern.tiling_mode = mode; + + switch(mode) { + case VG_TILE_FILL: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + break; + case VG_TILE_PAD: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_TILE_REPEAT: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_REPEAT; + break; + case VG_TILE_REFLECT: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + default: + debug_assert("!Unknown tiling mode"); + } +} + +void paint_get_color(struct vg_paint *paint, + VGfloat *color) +{ + color[0] = paint->solid.color[0]; + color[1] = paint->solid.color[1]; + color[2] = paint->solid.color[2]; + color[3] = paint->solid.color[3]; +} + +void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops, + int num) +{ + memcpy(stops, paint->gradient.ramp_stops, sizeof(VGfloat)*num); +} + +void paint_linear_gradient(struct vg_paint *paint, + VGfloat *coords) +{ + memcpy(coords, paint->gradient.linear.coords, sizeof(VGfloat)*4); +} + +void paint_radial_gradient(struct vg_paint *paint, + VGfloat *coords) +{ + memcpy(coords, paint->gradient.radial.vals, sizeof(VGfloat)*5); +} + +int paint_num_ramp_stops(struct vg_paint *paint) +{ + return paint->gradient.num_stops; +} + +VGPaintType paint_type(struct vg_paint *paint) +{ + return paint->type; +} + +void paint_set_coloriv(struct vg_paint *paint, + const VGint *color) +{ + paint->solid.color[0] = color[0]; + paint->solid.color[1] = color[1]; + paint->solid.color[2] = color[2]; + paint->solid.color[3] = color[3]; + + paint->solid.colori[0] = color[0]; + paint->solid.colori[1] = color[1]; + paint->solid.colori[2] = color[2]; + paint->solid.colori[3] = color[3]; +} + +void paint_get_coloriv(struct vg_paint *paint, + VGint *color) +{ + color[0] = paint->solid.colori[0]; + color[1] = paint->solid.colori[1]; + color[2] = paint->solid.colori[2]; + color[3] = paint->solid.colori[3]; +} + +void paint_set_color_ramp_premultiplied(struct vg_paint *paint, + VGboolean set) +{ + paint->gradient.color_ramps_premultiplied = set; +} + +VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint) +{ + return paint->gradient.color_ramps_premultiplied; +} + +void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops, + int num) +{ + if (num) { + free(paint->gradient.ramp_stopsi); + paint->gradient.ramp_stopsi = malloc(sizeof(VGint)*num); + memcpy(paint->gradient.ramp_stopsi, stops, sizeof(VGint)*num); + } +} + +void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops, + int num) +{ + memcpy(stops, paint->gradient.ramp_stopsi, sizeof(VGint)*num); +} + +void paint_set_linear_gradienti(struct vg_paint *paint, + const VGint *coords) +{ + memcpy(paint->gradient.linear.coordsi, coords, sizeof(VGint) * 4); +} + +void paint_linear_gradienti(struct vg_paint *paint, + VGint *coords) +{ + memcpy(coords, paint->gradient.linear.coordsi, sizeof(VGint)*4); +} + +void paint_set_radial_gradienti(struct vg_paint *paint, + const VGint *values) +{ + memcpy(paint->gradient.radial.valsi, values, sizeof(VGint) * 5); +} + +void paint_radial_gradienti(struct vg_paint *paint, + VGint *coords) +{ + memcpy(coords, paint->gradient.radial.valsi, sizeof(VGint)*5); +} + +VGTilingMode paint_pattern_tiling(struct vg_paint *paint) +{ + return paint->pattern.tiling_mode; +} + +VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + struct vg_context *ctx = vg_current_context(); + + switch(paint->type) { + case VG_PAINT_TYPE_LINEAR_GRADIENT: + case VG_PAINT_TYPE_RADIAL_GRADIENT: { + if (paint->gradient.texture) { + paint->gradient.sampler.min_img_filter = image_sampler_filter(ctx); + paint->gradient.sampler.mag_img_filter = image_sampler_filter(ctx); + samplers[0] = &paint->gradient.sampler; + textures[0] = paint->gradient.texture; + return 1; + } + } + break; + case VG_PAINT_TYPE_PATTERN: { + memcpy(paint->pattern.sampler.border_color, + ctx->state.vg.tile_fill_color, + sizeof(VGfloat) * 4); + paint->pattern.sampler.min_img_filter = image_sampler_filter(ctx); + paint->pattern.sampler.mag_img_filter = image_sampler_filter(ctx); + samplers[0] = &paint->pattern.sampler; + textures[0] = paint->pattern.texture; + return 1; + } + break; + default: + samplers[0] = &paint->pattern.sampler; /* dummy */ + textures[0] = 0; + return 0; + break; + } + return 0; +} + +void paint_resolve_type(struct vg_paint *paint) +{ + if (paint->type == VG_PAINT_TYPE_PATTERN && + !paint->pattern.texture) { + paint->type = VG_PAINT_TYPE_COLOR; + } +} + +VGint paint_constant_buffer_size(struct vg_paint *paint) +{ + switch(paint->type) { + case VG_PAINT_TYPE_COLOR: + return 8 * sizeof(VGfloat);/*4 color + 4 constants (0.f,1.f,2.f,4.f)*/ + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + return 20 * sizeof(VGfloat); + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + return 20 * sizeof(VGfloat); + break; + case VG_PAINT_TYPE_PATTERN: + return 20 * sizeof(VGfloat); + break; + default: + debug_printf("Uknown paint type: %d\n", paint->type); + } + + return 0; +} + +void paint_fill_constant_buffer(struct vg_paint *paint, + void *buffer) +{ + switch(paint->type) { + case VG_PAINT_TYPE_COLOR: + paint_color_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + paint_linear_gradient_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + paint_radial_gradient_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_PATTERN: + paint_pattern_buffer(paint, buffer); + break; + + default: + abort(); + } +} diff --git a/src/gallium/state_trackers/vega/paint.h b/src/gallium/state_trackers/vega/paint.h new file mode 100644 index 0000000000..999b5c167c --- /dev/null +++ b/src/gallium/state_trackers/vega/paint.h @@ -0,0 +1,118 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef PAINT_H +#define PAINT_H + +#include "vg_context.h" + +#include "VG/openvg.h" +#include "pipe/p_state.h" + +struct vg_paint; +struct vg_image; +struct pipe_sampler_state; +struct pipe_texture; + +struct vg_paint *paint_create(struct vg_context *ctx); +void paint_destroy(struct vg_paint *paint); + +void paint_set_color(struct vg_paint *paint, + const VGfloat *color); +void paint_get_color(struct vg_paint *paint, + VGfloat *color); + +void paint_set_coloriv(struct vg_paint *paint, + const VGint *color); +void paint_get_coloriv(struct vg_paint *paint, + VGint *color); + +void paint_set_colori(struct vg_paint *paint, + VGuint rgba); + +VGuint paint_colori(struct vg_paint *paint); + +void paint_set_type(struct vg_paint *paint, VGPaintType type); +VGPaintType paint_type(struct vg_paint *paint); +void paint_resolve_type(struct vg_paint *paint); + +void paint_set_linear_gradient(struct vg_paint *paint, + const VGfloat *coords); +void paint_linear_gradient(struct vg_paint *paint, + VGfloat *coords); +void paint_set_linear_gradienti(struct vg_paint *paint, + const VGint *coords); +void paint_linear_gradienti(struct vg_paint *paint, + VGint *coords); + + +void paint_set_radial_gradient(struct vg_paint *paint, + const VGfloat *values); +void paint_radial_gradient(struct vg_paint *paint, + VGfloat *coords); +void paint_set_radial_gradienti(struct vg_paint *paint, + const VGint *values); +void paint_radial_gradienti(struct vg_paint *paint, + VGint *coords); + + +void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops, + int num); +void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops, + int num); + +void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops, + int num); +void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops, + int num); + +int paint_num_ramp_stops(struct vg_paint *paint); + +void paint_set_spread_mode(struct vg_paint *paint, + VGint mode); +VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint); + + +void paint_set_pattern(struct vg_paint *paint, + struct vg_image *img); +void paint_set_pattern_tiling(struct vg_paint *paint, + VGTilingMode mode); +VGTilingMode paint_pattern_tiling(struct vg_paint *paint); + +void paint_set_color_ramp_premultiplied(struct vg_paint *paint, + VGboolean set); +VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint); + + +VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +VGint paint_constant_buffer_size(struct vg_paint *paint); +void paint_fill_constant_buffer(struct vg_paint *paint, + void *buffer); + + +#endif diff --git a/src/gallium/state_trackers/vega/path.c b/src/gallium/state_trackers/vega/path.c new file mode 100644 index 0000000000..d04f9d9ae6 --- /dev/null +++ b/src/gallium/state_trackers/vega/path.c @@ -0,0 +1,2034 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "path.h" + +#include "stroker.h" +#include "polygon.h" +#include "bezier.h" +#include "matrix.h" +#include "vg_context.h" +#include "util_array.h" +#include "arc.h" +#include "path_utils.h" +#include "paint.h" +#include "shader.h" + +#include "util/u_memory.h" + +#include + +#define DEBUG_PATH 0 + +struct path { + struct vg_object base; + VGbitfield caps; + VGboolean dirty; + VGboolean dirty_stroke; + + VGPathDatatype datatype; + + VGfloat scale; + VGfloat bias; + + VGint num_segments; + + struct array * segments; + struct array * control_points; + + struct { + struct polygon_array polygon_array; + struct matrix matrix; + } fill_polys; + + struct { + struct path *path; + struct matrix matrix; + VGfloat stroke_width; + VGfloat miter_limit; + VGCapStyle cap_style; + VGJoinStyle join_style; + } stroked; +}; + + +static INLINE void data_at(void **data, + struct path *p, + VGint start, VGint count, + VGfloat *out) +{ + VGPathDatatype dt = p->datatype; + VGint i; + VGint end = start + count; + VGfloat *itr = out; + + switch(dt) { + case VG_PATH_DATATYPE_S_8: { + VGbyte **bdata = (VGbyte **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_S_16: { + VGshort **bdata = (VGshort **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_S_32: { + VGint **bdata = (VGint **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_F: { + VGfloat **fdata = (VGfloat **)data; + for (i = start; i < end; ++i) { + *itr = (*fdata)[i]; + ++itr; + } + *fdata += count; + } + break; + default: + debug_assert(!"Unknown path datatype!"); + } +} + + +void vg_float_to_datatype(VGPathDatatype datatype, + VGubyte *common_data, + const VGfloat *data, + VGint num_coords) +{ + VGint i; + switch(datatype) { + case VG_PATH_DATATYPE_S_8: { + for (i = 0; i < num_coords; ++i) { + common_data[i] = (VGubyte)data[i]; + } + } + break; + case VG_PATH_DATATYPE_S_16: { + VGshort *buf = (VGshort*)common_data; + for (i = 0; i < num_coords; ++i) { + buf[i] = (VGshort)data[i]; + } + } + break; + case VG_PATH_DATATYPE_S_32: { + VGint *buf = (VGint*)common_data; + for (i = 0; i < num_coords; ++i) { + buf[i] = (VGint)data[i]; + } + } + break; + case VG_PATH_DATATYPE_F: { + memcpy(common_data, data, sizeof(VGfloat) * num_coords); + } + break; + default: + debug_assert(!"Unknown path datatype!"); + } +} + +static void coords_adjust_by_scale_bias(struct path *p, + void *pdata, VGint num_coords, + VGfloat scale, VGfloat bias, + VGPathDatatype datatype) +{ + VGfloat data[8]; + void *coords = (VGfloat *)pdata; + VGubyte *common_data = (VGubyte *)pdata; + VGint size_dst = size_for_datatype(datatype); + VGint i; + + for (i = 0; i < num_coords; ++i) { + data_at(&coords, p, 0, 1, data); + data[0] = data[0] * scale + bias; + vg_float_to_datatype(datatype, common_data, data, 1); + common_data += size_dst; + } +} + +struct path * path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) +{ + struct path *path = CALLOC_STRUCT(path); + + vg_init_object(&path->base, vg_current_context(), VG_OBJECT_PATH); + path->caps = capabilities & VG_PATH_CAPABILITY_ALL; + vg_context_add_object(vg_current_context(), VG_OBJECT_PATH, path); + + path->datatype = dt; + path->scale = scale; + path->bias = bias; + + path->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8)); + path->control_points = array_create(size_for_datatype(dt)); + + path->dirty = VG_TRUE; + path->dirty_stroke = VG_TRUE; + + return path; +} + +void path_destroy(struct path *p) +{ + vg_context_remove_object(vg_current_context(), VG_OBJECT_PATH, p); + + array_destroy(p->segments); + array_destroy(p->control_points); + array_destroy(p->fill_polys.polygon_array.array); + + if (p->stroked.path) + path_destroy(p->stroked.path); + + free(p); +} + +VGbitfield path_capabilities(struct path *p) +{ + return p->caps; +} + +void path_set_capabilities(struct path *p, VGbitfield bf) +{ + p->caps = (bf & VG_PATH_CAPABILITY_ALL); +} + +void path_append_data(struct path *p, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) +{ + VGint old_segments = p->num_segments; + VGint num_new_coords = num_elements_for_segments(pathSegments, numSegments); + array_append_data(p->segments, pathSegments, numSegments); + array_append_data(p->control_points, pathData, num_new_coords); + + p->num_segments += numSegments; + if (!floatsEqual(p->scale, 1.f) || !floatsEqual(p->bias, 0.f)) { + VGubyte *coords = (VGubyte*)p->control_points->data; + coords_adjust_by_scale_bias(p, + coords + old_segments * p->control_points->datatype_size, + num_new_coords, + p->scale, p->bias, p->datatype); + } + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +VGint path_num_segments(struct path *p) +{ + return p->num_segments; +} + +static INLINE void map_if_relative(VGfloat ox, VGfloat oy, + VGboolean relative, + VGfloat *x, VGfloat *y) +{ + if (relative) { + if (x) + *x += ox; + if (y) + *y += oy; + } +} + +static INLINE void close_polygon(struct polygon *current, + VGfloat sx, VGfloat sy, + VGfloat ox, VGfloat oy, + struct matrix *matrix) +{ + if (!floatsEqual(sx, ox) || + !floatsEqual(sy, oy)) { + VGfloat x0 = sx; + VGfloat y0 = sy; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + } +} + +static void convert_path(struct path *p, + VGPathDatatype to, + void *dst, + VGint num_coords) +{ + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + VGubyte *common_data = (VGubyte *)dst; + VGint size_dst = size_for_datatype(to); + VGint i; + + for (i = 0; i < num_coords; ++i) { + data_at(&coords, p, 0, 1, data); + vg_float_to_datatype(to, common_data, data, 1); + common_data += size_dst; + } +} + + +static void polygon_array_calculate_bounds( struct polygon_array *polyarray ) +{ + struct array *polys = polyarray->array; + VGfloat min_x, max_x; + VGfloat min_y, max_y; + VGfloat bounds[4]; + unsigned i; + + assert(polys); + assert(polys->num_elements); + polygon_bounding_rect((((struct polygon**)polys->data)[0]), bounds); + min_x = bounds[0]; + min_y = bounds[1]; + max_x = bounds[0] + bounds[2]; + max_y = bounds[1] + bounds[3]; + for (i = 1; i < polys->num_elements; ++i) { + struct polygon *p = (((struct polygon**)polys->data)[i]); + polygon_bounding_rect(p, bounds); + min_x = MIN2(min_x, bounds[0]); + min_y = MIN2(min_y, bounds[1]); + max_x = MAX2(max_x, bounds[0] + bounds[2]); + max_y = MAX2(max_y, bounds[1] + bounds[3]); + } + + polyarray->min_x = min_x; + polyarray->min_y = min_y; + polyarray->max_x = max_x; + polyarray->max_y = max_y; +} + + +static struct polygon_array * path_get_fill_polygons(struct path *p, struct matrix *matrix) +{ + VGint i; + struct polygon *current = 0; + VGfloat sx, sy, px, py, ox, oy; + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + struct array *array; + + if (p->fill_polys.polygon_array.array) + { + if (memcmp( &p->fill_polys.matrix, + matrix, + sizeof *matrix ) == 0 && p->dirty == VG_FALSE) + { + return &p->fill_polys.polygon_array; + } + else { + array_destroy( p->fill_polys.polygon_array.array ); + p->fill_polys.polygon_array.array = NULL; + } + } + + array = array_create(sizeof(struct array*)); + + sx = sy = px = py = ox = oy = 0.f; + + current = polygon_create(32); + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment = ((VGubyte*)(p->segments->data))[i]; + VGint command = SEGMENT_COMMAND(segment); + VGboolean relative = SEGMENT_ABS_REL(segment); + + switch(command) { + case VG_CLOSE_PATH: + close_polygon(current, sx, sy, ox, oy, matrix); + ox = sx; + oy = sy; + break; + case VG_MOVE_TO: + if (current && polygon_vertex_count(current) > 0) { + /* add polygon */ + close_polygon(current, sx, sy, ox, oy, matrix); + array_append_data(array, ¤t, 1); + current = polygon_create(32); + } + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + sx = x0; + sy = y0; + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_LINE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_HLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = data[0]; + y0 = oy; + map_if_relative(ox, oy, relative, &x0, 0); + ox = x0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_VLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = ox; + y0 = data[0]; + map_if_relative(ox, oy, relative, 0, &y0); + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_CUBIC_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 6, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x2 = data[2]; + y2 = data[3]; + x3 = data[4]; + y3 = data[5]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_QUAD_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SQUAD_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 2, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SCUBIC_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + VGfloat rh, rv, rot; + struct arc arc; + + data_at(&coords, p, 0, 5, data); + x0 = ox; + y0 = oy; + rh = data[0]; + rv = data[1]; + rot = data[2]; + x1 = data[3]; + y1 = data[4]; + map_if_relative(ox, oy, relative, &x1, &y1); +#if 0 + debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n", + x0, y0, x1, y1, rh, rv, rot); +#endif + arc_init(&arc, command, x0, y0, x1, y1, + rh, rv, rot); + arc_add_to_polygon(&arc, current, + matrix); + ox = x1; + oy = y1; + px = x1; + py = y1; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } + if (current) { + if (polygon_vertex_count(current) > 0) { + close_polygon(current, sx, sy, ox, oy, matrix); + array_append_data(array, ¤t, 1); + } else + polygon_destroy(current); + } + + p->fill_polys.polygon_array.array = array; + p->fill_polys.matrix = *matrix; + + polygon_array_calculate_bounds( &p->fill_polys.polygon_array ); + + p->dirty = VG_FALSE; + + return &p->fill_polys.polygon_array; +} + +VGbyte path_datatype_size(struct path *p) +{ + return size_for_datatype(p->datatype); +} + +VGPathDatatype path_datatype(struct path *p) +{ + return p->datatype; +} + +VGfloat path_scale(struct path *p) +{ + return p->scale; +} + +VGfloat path_bias(struct path *p) +{ + return p->bias; +} + +VGint path_num_coords(struct path *p) +{ + return num_elements_for_segments((VGubyte*)p->segments->data, + p->num_segments); +} + +void path_modify_coords(struct path *p, + VGint startIndex, + VGint numSegments, + const void * pathData) +{ + VGubyte *segments = (VGubyte*)(p->segments->data); + VGint count = num_elements_for_segments(&segments[startIndex], numSegments); + VGint start_cp = num_elements_for_segments(segments, startIndex); + + array_change_data(p->control_points, pathData, start_cp, count); + coords_adjust_by_scale_bias(p, + ((VGubyte*)p->control_points->data) + + (startIndex * p->control_points->datatype_size), + path_num_coords(p), + p->scale, p->bias, p->datatype); + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +void path_for_each_segment(struct path *path, + path_for_each_cb cb, + void *user_data) +{ + VGint i; + struct path_for_each_data p; + VGfloat data[8]; + void *coords = (VGfloat *)path->control_points->data; + + p.coords = data; + p.sx = p.sy = p.px = p.py = p.ox = p.oy = 0.f; + p.user_data = user_data; + + for (i = 0; i < path->num_segments; ++i) { + VGint command; + VGboolean relative; + + p.segment = ((VGubyte*)(path->segments->data))[i]; + command = SEGMENT_COMMAND(p.segment); + relative = SEGMENT_ABS_REL(p.segment); + + switch(command) { + case VG_CLOSE_PATH: + cb(path, &p); + break; + case VG_MOVE_TO: + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.sx = data[0]; + p.sy = data[1]; + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_LINE_TO: + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_HLINE_TO: + data_at(&coords, path, 0, 1, data); + map_if_relative(p.ox, p.oy, relative, &data[0], 0); + p.segment = VG_LINE_TO; + data[1] = p.oy; + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_VLINE_TO: + data_at(&coords, path, 0, 1, data); + map_if_relative(p.ox, p.oy, relative, 0, &data[0]); + p.segment = VG_LINE_TO; + data[1] = data[0]; + data[0] = p.ox; + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_CUBIC_TO: { + data_at(&coords, path, 0, 6, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + map_if_relative(p.ox, p.oy, relative, &data[4], &data[5]); + cb(path, &p); + p.px = data[2]; + p.py = data[3]; + p.ox = data[4]; + p.oy = data[5]; + } + break; + case VG_QUAD_TO: { + data_at(&coords, path, 0, 4, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + cb(path, &p); + p.px = data[0]; + p.py = data[1]; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SQUAD_TO: { + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.px = 2*p.ox-p.px; + p.py = 2*p.oy-p.py; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SCUBIC_TO: { + data_at(&coords, path, 0, 4, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + cb(path, &p); + p.px = data[0]; + p.py = data[1]; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + data_at(&coords, path, 0, 5, data); + map_if_relative(p.ox, p.oy, relative, &data[3], &data[4]); +#if 0 + debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n", + p.ox, p.oy, data[3], data[4], data[0], data[1], data[2]); +#endif + cb(path, &p); + p.ox = data[3]; + p.oy = data[4]; + p.px = data[3]; + p.py = data[4]; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } +} + +struct transform_data { + struct array *segments; + struct array *coords; + + struct matrix *matrix; + + VGPathDatatype datatype; +}; + +static VGboolean transform_cb(struct path *p, + struct path_for_each_data *pd) +{ + struct transform_data *td = (struct transform_data *)pd->user_data; + VGint num_coords = num_elements_for_segments(&pd->segment, 1); + VGubyte segment = SEGMENT_COMMAND(pd->segment);/* abs bit is 0 */ + VGfloat data[8]; + VGubyte common_data[sizeof(VGfloat)*8]; + + memcpy(data, pd->coords, sizeof(VGfloat) * num_coords); + + switch(segment) { + case VG_CLOSE_PATH: + break; + case VG_MOVE_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_LINE_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_HLINE_TO: + case VG_VLINE_TO: + assert(0); + break; + case VG_QUAD_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + break; + case VG_CUBIC_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + matrix_map_point(td->matrix, + data[4], data[5], &data[4], &data[5]); + break; + case VG_SQUAD_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_SCUBIC_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct path *path = path_create(td->datatype, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + arc_init(&arc, segment, + pd->ox, pd->oy, data[3], data[4], + data[0], data[1], data[2]); + + arc_to_path(&arc, path, td->matrix); + + num_coords = path_num_coords(path); + + array_append_data(td->segments, path->segments->data, + path->num_segments); + array_append_data(td->coords, path->control_points->data, + num_coords); + path_destroy(path); + + return VG_TRUE; + } + break; + default: + break; + } + + vg_float_to_datatype(td->datatype, common_data, data, num_coords); + + array_append_data(td->segments, &segment, 1); + array_append_data(td->coords, common_data, num_coords); + return VG_TRUE; +} + +void path_transform(struct path *dst, struct path *src) +{ + struct transform_data data; + struct vg_context *ctx = dst->base.ctx; + + data.segments = dst->segments; + data.coords = dst->control_points; + data.matrix = &ctx->state.vg.path_user_to_surface_matrix; + data.datatype = dst->datatype; + + path_for_each_segment(src, transform_cb, (void*)&data); + + dst->num_segments = dst->segments->num_elements; + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; +} + +void path_append_path(struct path *dst, + struct path *src) +{ + VGint num_coords = path_num_coords(src); + void *dst_data = malloc(size_for_datatype(dst->datatype) * num_coords); + array_append_data(dst->segments, + src->segments->data, + src->num_segments); + convert_path(src, dst->datatype, + dst_data, num_coords); + array_append_data(dst->control_points, + dst_data, + num_coords); + free(dst_data); + + dst->num_segments += src->num_segments; + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; +} + +static INLINE VGboolean is_segment_arc(VGubyte segment) +{ + VGubyte scommand = SEGMENT_COMMAND(segment); + return (scommand == VG_SCCWARC_TO || + scommand == VG_SCWARC_TO || + scommand == VG_LCCWARC_TO || + scommand == VG_LCWARC_TO); +} + +struct path_iter_data { + struct path *path; + VGubyte segment; + void *coords; + VGfloat px, py, ox, oy, sx, sy; +}; +static INLINE VGubyte normalize_coords(struct path_iter_data *pd, + VGint *num_coords, + VGfloat *data) +{ + VGint command = SEGMENT_COMMAND(pd->segment); + VGboolean relative = SEGMENT_ABS_REL(pd->segment); + + switch(command) { + case VG_CLOSE_PATH: + *num_coords = 0; + pd->ox = pd->sx; + pd->oy = pd->sy; + return VG_CLOSE_PATH; + break; + case VG_MOVE_TO: + data_at(&pd->coords, pd->path, 0, 2, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + pd->sx = data[0]; + pd->sy = data[1]; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_MOVE_TO_ABS; + break; + case VG_LINE_TO: + data_at(&pd->coords, pd->path, 0, 2, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_HLINE_TO: + data_at(&pd->coords, pd->path, 0, 1, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], 0); + data[1] = pd->oy; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_VLINE_TO: + data_at(&pd->coords, pd->path, 0, 1, data); + map_if_relative(pd->ox, pd->oy, relative, 0, &data[0]); + data[1] = data[0]; + data[0] = pd->ox; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_CUBIC_TO: { + data_at(&pd->coords, pd->path, 0, 6, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + map_if_relative(pd->ox, pd->oy, relative, &data[2], &data[3]); + map_if_relative(pd->ox, pd->oy, relative, &data[4], &data[5]); + pd->px = data[2]; + pd->py = data[3]; + pd->ox = data[4]; + pd->oy = data[5]; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_QUAD_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 4, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(pd->ox, pd->oy, relative, &x1, &y1); + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->px = x1; + pd->py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + pd->ox = x3; + pd->oy = y3; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SQUAD_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 2, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = 2 * pd->ox - pd->px; + y1 = 2 * pd->oy - pd->py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->px = x1; + pd->py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + pd->ox = x3; + pd->oy = y3; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SCUBIC_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 4, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = 2*pd->ox-pd->px; + y1 = 2*pd->oy-pd->py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(pd->ox, pd->oy, relative, &x2, &y2); + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->ox = x3; + pd->oy = y3; + pd->px = x2; + pd->py = y2; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + data_at(&pd->coords, pd->path, 0, 5, data); + map_if_relative(pd->ox, pd->oy, relative, &data[3], &data[4]); + pd->ox = data[3]; + pd->oy = data[4]; + pd->px = data[3]; + pd->py = data[4]; + *num_coords = 5; + return command | VG_ABSOLUTE; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } +} + +static void linearly_interpolate(VGfloat *result, + const VGfloat *start, + const VGfloat *end, + VGfloat amount, + VGint number) +{ + VGint i; + for (i = 0; i < number; ++i) { + result[i] = start[i] + (end[i] - start[i]) * amount; + } +} + +VGboolean path_interpolate(struct path *dst, + struct path *start, struct path *end, + VGfloat amount) +{ + /* temporary path that we can discard if it will turn + * out that start is not compatible with end */ + struct path *res_path = path_create(dst->datatype, + 1.0, 0.0, + 0, 0, dst->caps); + VGint i; + VGfloat start_coords[8]; + VGfloat end_coords[8]; + VGfloat results[8]; + VGubyte common_data[sizeof(VGfloat)*8]; + struct path_iter_data start_iter, end_iter; + + memset(&start_iter, 0, sizeof(struct path_iter_data)); + memset(&end_iter, 0, sizeof(struct path_iter_data)); + + start_iter.path = start; + start_iter.coords = start->control_points->data; + end_iter.path = end; + end_iter.coords = end->control_points->data; + + for (i = 0; i < start->num_segments; ++i) { + VGubyte segment; + VGubyte ssegment, esegment; + VGint snum_coords, enum_coords; + start_iter.segment = ((VGubyte*)(start->segments->data))[i]; + end_iter.segment = ((VGubyte*)(end->segments->data))[i]; + + ssegment = normalize_coords(&start_iter, &snum_coords, + start_coords); + esegment = normalize_coords(&end_iter, &enum_coords, + end_coords); + + if (is_segment_arc(ssegment)) { + if (!is_segment_arc(esegment)) { + path_destroy(res_path); + return VG_FALSE; + } + if (amount > 0.5) + segment = esegment; + else + segment = ssegment; + } else if (is_segment_arc(esegment)) { + path_destroy(res_path); + return VG_FALSE; + } + else if (ssegment != esegment) { + path_destroy(res_path); + return VG_FALSE; + } + else + segment = ssegment; + + linearly_interpolate(results, start_coords, end_coords, + amount, snum_coords); + vg_float_to_datatype(dst->datatype, common_data, results, snum_coords); + path_append_data(res_path, 1, &segment, common_data); + } + + path_append_path(dst, res_path); + path_destroy(res_path); + + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; + + return VG_TRUE; +} + +void path_clear(struct path *p, VGbitfield capabilities) +{ + path_set_capabilities(p, capabilities); + array_destroy(p->segments); + array_destroy(p->control_points); + p->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8)); + p->control_points = array_create(size_for_datatype(p->datatype)); + p->num_segments = 0; + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +struct path * path_create_stroke(struct path *p, + struct matrix *matrix) +{ + VGint i; + VGfloat sx, sy, px, py, ox, oy; + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + int dashed = (p->base.ctx->state.vg.stroke.dash_pattern_num ? 1 : 0); + struct dash_stroker stroker; + struct vg_state *vg_state = &p->base.ctx->state.vg; + + if (p->stroked.path) + { + /* ### compare the dash patterns to see if we can cache them. + * for now we simply always bail out if the path is dashed. + */ + if (memcmp( &p->stroked.matrix, + matrix, + sizeof *matrix ) == 0 && + !dashed && !p->dirty_stroke && + floatsEqual(p->stroked.stroke_width, vg_state->stroke.line_width.f) && + floatsEqual(p->stroked.miter_limit, vg_state->stroke.miter_limit.f) && + p->stroked.cap_style == vg_state->stroke.cap_style && + p->stroked.join_style == vg_state->stroke.join_style) + { + return p->stroked.path; + } + else { + path_destroy( p->stroked.path ); + p->stroked.path = NULL; + } + } + + + sx = sy = px = py = ox = oy = 0.f; + + if (dashed) + dash_stroker_init((struct stroker *)&stroker, vg_state); + else + stroker_init((struct stroker *)&stroker, vg_state); + + stroker_begin((struct stroker *)&stroker); + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment = ((VGubyte*)(p->segments->data))[i]; + VGint command = SEGMENT_COMMAND(segment); + VGboolean relative = SEGMENT_ABS_REL(segment); + + switch(command) { + case VG_CLOSE_PATH: { + VGfloat x0 = sx; + VGfloat y0 = sy; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + } + break; + case VG_MOVE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + sx = x0; + sy = y0; + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_move_to((struct stroker *)&stroker, x0, y0); + break; + case VG_LINE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_HLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = data[0]; + y0 = oy; + map_if_relative(ox, oy, relative, &x0, 0); + ox = x0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_VLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = ox; + y0 = data[0]; + map_if_relative(ox, oy, relative, 0, &y0); + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_CUBIC_TO: { + data_at(&coords, p, 0, 6, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x2 = data[2]; + y2 = data[3]; + x3 = data[4]; + y3 = data[5]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_QUAD_TO: { + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SQUAD_TO: { + data_at(&coords, p, 0, 2, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SCUBIC_TO: { + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + VGfloat rh, rv, rot; + struct arc arc; + + data_at(&coords, p, 0, 5, data); + x0 = ox; + y0 = oy; + rh = data[0]; + rv = data[1]; + rot = data[2]; + x1 = data[3]; + y1 = data[4]; + map_if_relative(ox, oy, relative, &x1, &y1); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy)) { + /* if dup vertex, emit a line */ + ox = x1; + oy = y1; + matrix_map_point(matrix, x1, y1, &x1, &y1); + stroker_line_to((struct stroker *)&stroker, x1, y1); + continue; + } + arc_init(&arc, command, x0, y0, x1, y1, + rh, rv, rot); + arc_stroke_cb(&arc, (struct stroker *)&stroker, + matrix); + ox = x1; + oy = y1; + px = x1; + py = y1; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } + + stroker_end((struct stroker *)&stroker); + + if (dashed) + dash_stroker_cleanup((struct dash_stroker *)&stroker); + else + stroker_cleanup((struct stroker *)&stroker); + + p->stroked.path = stroker.base.path; + p->stroked.matrix = *matrix; + p->dirty_stroke = VG_FALSE; + p->stroked.stroke_width = vg_state->stroke.line_width.f; + p->stroked.miter_limit = vg_state->stroke.miter_limit.f; + p->stroked.cap_style = vg_state->stroke.cap_style; + p->stroked.join_style = vg_state->stroke.join_style; + + return stroker.base.path; +} + +void path_render(struct path *p, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + + vg_validate_state(ctx); + + shader_set_drawing_image(ctx->shader, VG_FALSE); + shader_set_image(ctx->shader, 0); +#if 0 + fprintf(stderr, "Matrix(11=%f 12=%f 13=%f 21=%f 22=%f 23=%f 31=%f 32=%f 33=%f)\n", + mat->m[0], mat->m[1], mat->m[2], + mat->m[3], mat->m[4], mat->m[5], + mat->m[6], mat->m[7], mat->m[8]); +#endif + if (paintModes & VG_FILL_PATH) { + /* First the fill */ + shader_set_paint(ctx->shader, ctx->state.vg.fill_paint); + shader_bind(ctx->shader); + path_fill(p, mat); + } + + if (paintModes & VG_STROKE_PATH){ + /* 8.7.5: "line width less than or equal to 0 prevents stroking from + * taking place."*/ + if (ctx->state.vg.stroke.line_width.f <= 0) + return; + shader_set_paint(ctx->shader, ctx->state.vg.stroke_paint); + shader_bind(ctx->shader); + path_stroke(p); + } +} + +void path_fill(struct path *p, struct matrix *mat) +{ + struct vg_context *ctx = vg_current_context(); + { + struct polygon_array *polygon_array = path_get_fill_polygons(p, mat); + struct array *polys = polygon_array->array; + + if (!polygon_array || !polys || !polys->num_elements) { + return; + } + polygon_array_fill(polygon_array, ctx); + } +} + +void path_stroke(struct path *p) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + VGFillRule old_fill = ctx->state.vg.fill_rule; + struct matrix identity; + struct path *stroke; + + matrix_load_identity(&identity); + stroke = path_create_stroke(p, &identity); + if (stroke && !path_is_empty(stroke)) { + ctx->state.vg.fill_rule = VG_NON_ZERO; + + path_fill(stroke, mat); + + ctx->state.vg.fill_rule = old_fill; + } +} + +void path_move_to(struct path *p, float x, float y) +{ + VGubyte segment = VG_MOVE_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 2]; + VGfloat data[2] = {x, y}; + + vg_float_to_datatype(p->datatype, common_data, data, 2); + path_append_data(p, 1, &segment, common_data); +} + +void path_line_to(struct path *p, float x, float y) +{ + VGubyte segment = VG_LINE_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 2]; + VGfloat data[2] = {x, y}; + + vg_float_to_datatype(p->datatype, common_data, data, 2); + + path_append_data(p, 1, &segment, common_data); +} + +void path_cubic_to(struct path *p, float px1, float py1, + float px2, float py2, + float x, float y) +{ + VGubyte segment = VG_CUBIC_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 6]; + VGfloat data[6]; + + data[0] = px1; data[1] = py1; + data[2] = px2; data[3] = py2; + data[4] = x; data[5] = y; + + vg_float_to_datatype(p->datatype, common_data, data, 6); + + path_append_data(p, 1, &segment, common_data); +} + +static INLINE void line_bounds(VGfloat *line /*x1,y1,x2,y2*/, + VGfloat *bounds) +{ + bounds[0] = MIN2(line[0], line[2]); + bounds[1] = MIN2(line[1], line[3]); + bounds[2] = MAX2(line[0], line[2]) - bounds[0]; + bounds[3] = MAX2(line[1], line[3]) - bounds[1]; +} + +static INLINE void unite_bounds(VGfloat *bounds, + VGfloat *el) +{ + VGfloat cx1, cy1, cx2, cy2; + VGfloat nx1, ny1, nx2, ny2; + + cx1 = bounds[0]; + cy1 = bounds[1]; + cx2 = bounds[0] + bounds[2]; + cy2 = bounds[1] + bounds[3]; + + nx1 = el[0]; + ny1 = el[1]; + nx2 = el[0] + el[2]; + ny2 = el[1] + el[3]; + + bounds[0] = MIN2(cx1, nx1); + bounds[1] = MIN2(cy1, ny1); + bounds[2] = MAX2(cx2, nx2) - bounds[0]; + bounds[3] = MAX2(cy2, ny2) - bounds[1]; +} + +static INLINE void set_bounds(VGfloat *bounds, + VGfloat *element_bounds, + VGboolean *initialized) +{ + if (!(*initialized)) { + memcpy(bounds, element_bounds, 4 * sizeof(VGfloat)); + *initialized = VG_TRUE; + } else + unite_bounds(bounds, element_bounds); +} + +void path_bounding_rect(struct path *p, float *x, float *y, + float *w, float *h) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter; + VGint num_coords; + VGfloat bounds[4]; + VGfloat element_bounds[4]; + VGfloat ox, oy; + VGboolean bounds_inited = VG_FALSE; + + memset(&iter, 0, sizeof(struct path_iter_data)); + memset(&bounds, 0, sizeof(bounds)); + + if (!p->num_segments) { + bounds[2] = -1; + bounds[3] = -1; + } + + + iter.path = p; + iter.coords = p->control_points->data; + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment; + iter.segment = ((VGubyte*)(p->segments->data))[i]; + + ox = iter.ox; + oy = iter.oy; + + segment = normalize_coords(&iter, &num_coords, coords); + + switch(segment) { + case VG_CLOSE_PATH: + case VG_MOVE_TO_ABS: + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {ox, oy, coords[0], coords[1]}; + line_bounds(line, element_bounds); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, ox, oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + bezier_exact_bounds(&bezier, element_bounds); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, segment, + ox, oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + path_bounding_rect(path, element_bounds + 0, element_bounds + 1, + element_bounds + 2, element_bounds + 3); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + default: + assert(0); + } + } + + *x = bounds[0]; + *y = bounds[1]; + *w = bounds[2]; + *h = bounds[3]; +} + +float path_length(struct path *p, int start_segment, int num_segments) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter; + VGint num_coords; + VGfloat length = 0; + VGfloat ox, oy; + VGboolean in_range = VG_FALSE; + + memset(&iter, 0, sizeof(struct path_iter_data)); + + iter.path = p; + iter.coords = p->control_points->data; + + for (i = 0; i < (start_segment + num_segments); ++i) { + VGubyte segment; + + iter.segment = ((VGubyte*)(p->segments->data))[i]; + + ox = iter.ox; + oy = iter.oy; + + segment = normalize_coords(&iter, &num_coords, coords); + + in_range = (i >= start_segment) && i <= (start_segment + num_segments); + if (!in_range) + continue; + + switch(segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {ox, oy, iter.sx, iter.sy}; + length += line_lengthv(line); + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {ox, oy, coords[0], coords[1]}; + length += line_lengthv(line); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, ox, oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + length += bezier_length(&bezier, BEZIER_DEFAULT_ERROR); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, segment, + ox, oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + length += path_length(path, 0, path_num_segments(path)); + } + break; + default: + assert(0); + } + } + + return length; +} + +static INLINE VGboolean point_on_current_segment(VGfloat distance, + VGfloat length, + VGfloat segment_length) +{ + return + (((floatIsZero(distance) || distance < 0) && floatIsZero(length)) || + ((distance > length || floatsEqual(distance, length)) && + (floatsEqual(distance, length + segment_length) || + distance < (length + segment_length)))); +} + +static VGboolean path_point_segment(struct path_iter_data iter, + struct path_iter_data prev_iter, + VGfloat coords[8], + VGfloat distance, + VGfloat length, VGfloat *current_length, + VGfloat *point, VGfloat *normal) +{ + switch (iter.segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy}; + VGboolean on_current_segment = VG_FALSE; + *current_length = line_lengthv(line); + on_current_segment = point_on_current_segment(distance, + length, + *current_length); + if (on_current_segment) { + VGfloat at = (distance - length) / line_lengthv(line); + line_normal_vector(line, normal); + line_point_at(line, at, point); + return VG_TRUE; + } + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]}; + VGboolean on_current_segment = VG_FALSE; + *current_length = line_lengthv(line); + on_current_segment = point_on_current_segment(distance, + length, + *current_length); + if (on_current_segment) { + VGfloat at = (distance - length) / line_lengthv(line); + line_normal_vector(line, normal); + line_point_at(line, at, point); + return VG_TRUE; + } + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, prev_iter.ox, prev_iter.oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + *current_length = bezier_length(&bezier, BEZIER_DEFAULT_ERROR); + if (point_on_current_segment(distance, length, *current_length)) { + bezier_point_at_length(&bezier, distance - length, + point, normal); + return VG_TRUE; + } + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, iter.segment, + prev_iter.ox, prev_iter.oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + *current_length = path_length(path, 0, path_num_segments(path)); + if (point_on_current_segment(distance, length, *current_length)) { + path_point(path, 0, path_num_segments(path), + distance - length, point, normal); + return VG_TRUE; + } + } + break; + default: + assert(0); + } + return VG_FALSE; +} + +void path_point(struct path *p, VGint start_segment, VGint num_segments, + VGfloat distance, VGfloat *point, VGfloat *normal) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter, prev_iter; + VGint num_coords; + VGfloat length = 0; + VGfloat current_length = 0; + + memset(&iter, 0, sizeof(struct path_iter_data)); + memset(&prev_iter, 0, sizeof(struct path_iter_data)); + + point[0] = 0; + point[1] = 0; + + normal[0] = 0; + normal[1] = -1; + + iter.path = p; + iter.coords = p->control_points->data; + if (distance < 0) + distance = 0; + + for (i = 0; i < (start_segment + num_segments); ++i) { + VGboolean outside_range = (i < start_segment || + i >= (start_segment + num_segments)); + + prev_iter = iter; + + iter.segment = ((VGubyte*)(p->segments->data))[i]; + iter.segment = normalize_coords(&iter, &num_coords, coords); + + if (outside_range) + continue; + + if (path_point_segment(iter, prev_iter, coords, + distance, length, ¤t_length, + point, normal)) + return; + + length += current_length; + } + + /* + *OpenVG 1.0 - 8.6.11 vgPointAlongPath + * + * If distance is greater than or equal to the path length + *(i.e., the value returned by vgPathLength when called with the same + *startSegment and numSegments parameters), the visual ending point of + *the path is used. + */ + { + switch (iter.segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy}; + line_normal_vector(line, normal); + line_point_at(line, 1.f, point); + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]}; + line_normal_vector(line, normal); + line_point_at(line, 1.f, point); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, prev_iter.ox, prev_iter.oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + bezier_point_at_t(&bezier, 1.f, point, normal); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, iter.segment, + prev_iter.ox, prev_iter.oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + path_point(path, 0, path_num_segments(path), + /* to make sure we're bigger than len * 2 it */ + 2 * path_length(path, 0, path_num_segments(path)), + point, normal); + } + break; + default: + assert(0); + } + } +} + +VGboolean path_is_empty(struct path *p) +{ + return p->segments->num_elements == 0; +} diff --git a/src/gallium/state_trackers/vega/path.h b/src/gallium/state_trackers/vega/path.h new file mode 100644 index 0000000000..e34538b736 --- /dev/null +++ b/src/gallium/state_trackers/vega/path.h @@ -0,0 +1,126 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef _PATH_H +#define _PATH_H + +#include "VG/openvg.h" + +struct path; +struct polygon; +struct matrix; + +enum fill_rule { + ODD_EVEN_FILL, + WINDING_FILL +}; + + +struct path_for_each_data { + VGubyte segment; + /* all coords are absolute, even if segment is relative */ + const VGfloat *coords; + VGfloat sx, sy, ox, oy, px, py; + void *user_data; +}; + +typedef VGboolean (*path_for_each_cb)(struct path *p, + struct path_for_each_data *data); + + +struct path *path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities); +void path_destroy(struct path *p); + +VGbitfield path_capabilities(struct path *p); +void path_set_capabilities(struct path *p, VGbitfield bf); + +void path_append_data(struct path *p, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData); + +void path_append_path(struct path *dst, + struct path *src); + +VGint path_num_segments(struct path *p); + +void path_bounding_rect(struct path *p, float *x, float *y, + float *w, float *h); +float path_length(struct path *p, int start_segment, int num_segments); + +void path_set_fill_rule(enum fill_rule fill); +enum fill_rule path_fill_rule(enum fill_rule fill); + +VGboolean path_is_empty(struct path *p); + +VGbyte path_datatype_size(struct path *p); + +VGPathDatatype path_datatype(struct path *p); +VGfloat path_scale(struct path *p); +VGfloat path_bias(struct path *p); +VGint path_num_coords(struct path *p); + +void path_modify_coords(struct path *p, + VGint startIndex, + VGint numSegments, + const void * pathData); + +struct path *path_create_stroke(struct path *p, + struct matrix *m); + +void path_for_each_segment(struct path *path, + path_for_each_cb cb, + void *user_data); + +void path_transform(struct path *dst, struct path *src); +VGboolean path_interpolate(struct path *dst, + struct path *start, struct path *end, + VGfloat amount); + +void path_clear(struct path *p, VGbitfield capabilities); +void path_render(struct path *p, VGbitfield paintModes); +void path_fill(struct path *p, struct matrix *mat); +void path_stroke(struct path *p); + +void path_move_to(struct path *p, float x, float y); +void path_line_to(struct path *p, float x, float y); +void path_cubic_to(struct path *p, float px1, float py1, + float px2, float py2, + float x, float y); + +void path_point(struct path *p, VGint startSegment, VGint numSegments, + VGfloat distance, VGfloat *point, VGfloat *normal); + + + +void vg_float_to_datatype(VGPathDatatype datatype, + VGubyte *common_data, + const VGfloat *data, + VGint num_coords); +#endif diff --git a/src/gallium/state_trackers/vega/path_utils.h b/src/gallium/state_trackers/vega/path_utils.h new file mode 100644 index 0000000000..c2b3221dc5 --- /dev/null +++ b/src/gallium/state_trackers/vega/path_utils.h @@ -0,0 +1,109 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef PATH_UTILS_H +#define PATH_UTILS_H + +#include "VG/openvg.h" + +#define SEGMENT_COMMAND(command) /* Extract segment type */ \ + ((command) & 0x1e) +#define SEGMENT_ABS_REL(command) /* Extract absolute/relative bit */ \ + ((command) & 0x1) + +static INLINE VGint size_for_datatype(VGPathDatatype datatype) +{ + switch(datatype) { + case VG_PATH_DATATYPE_S_8: + return 1; + case VG_PATH_DATATYPE_S_16: + return 2; + case VG_PATH_DATATYPE_S_32: + return 4; + case VG_PATH_DATATYPE_F: + return 4; + default: + assert(!"unknown datatype"); + } + return 0; +} + +static INLINE VGint num_elements_for_segments(const VGubyte *segments, + VGint num_segments) +{ + VGint i; + VGint count = 0; + + for (i = 0; i < num_segments; ++i) { + VGubyte segment = segments[i]; + VGint command = SEGMENT_COMMAND(segment); + switch(command) { + case VG_CLOSE_PATH: + break; + case VG_MOVE_TO: + count += 2; + break; + case VG_LINE_TO: + count += 2; + break; + case VG_HLINE_TO: + count += 1; + break; + case VG_VLINE_TO: + count += 1; + break; + case VG_QUAD_TO: + count += 4; + break; + case VG_CUBIC_TO: + count += 6; + break; + case VG_SQUAD_TO: + count += 2; + break; + case VG_SCUBIC_TO: + count += 4; + break; + case VG_SCCWARC_TO: + count += 5; + break; + case VG_SCWARC_TO: + count += 5; + break; + case VG_LCCWARC_TO: + count += 5; + break; + case VG_LCWARC_TO: + count += 5; + break; + default: + assert(!"Unknown segment!"); + } + } + return count; +} + +#endif diff --git a/src/gallium/state_trackers/vega/polygon.c b/src/gallium/state_trackers/vega/polygon.c new file mode 100644 index 0000000000..b6d282d803 --- /dev/null +++ b/src/gallium/state_trackers/vega/polygon.c @@ -0,0 +1,550 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "polygon.h" + +#include "matrix.h" /*for floatsEqual*/ +#include "vg_context.h" +#include "vg_state.h" +#include "paint.h" +#include "renderer.h" +#include "util_array.h" +#include "VG/openvg.h" + +#include "pipe/p_context.h" +#include "pipe/p_defines.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" + +#include "util/u_draw_quad.h" +#include "util/u_math.h" + +#include +#include + +#define DEBUG_POLYGON 0 + +#define COMPONENTS 2 + +struct polygon +{ + VGfloat *data; + VGint size; + + VGint num_verts; + + VGboolean dirty; + struct pipe_buffer *vbuf; + struct pipe_screen *screen; +}; + +static float *ptr_to_vertex(float *data, int idx) +{ + return data + (idx * COMPONENTS); +} + +#if 0 +static void polygon_print(struct polygon *poly) +{ + int i; + float *vert; + debug_printf("Polygon %p, size = %d\n", poly, poly->num_verts); + for (i = 0; i < poly->num_verts; ++i) { + vert = ptr_to_vertex(poly->data, i); + debug_printf("%f, %f, ", vert[0], vert[1]); + } + debug_printf("\nend\n"); +} +#endif + + +struct polygon * polygon_create(int size) +{ + struct polygon *poly = (struct polygon*)malloc(sizeof(struct polygon)); + + poly->data = malloc(sizeof(float) * COMPONENTS * size); + poly->size = size; + poly->num_verts = 0; + poly->dirty = VG_TRUE; + poly->vbuf = NULL; + + return poly; +} + +struct polygon * polygon_create_from_data(float *data, int size) +{ + struct polygon *poly = polygon_create(size); + + memcpy(poly->data, data, sizeof(float) * COMPONENTS * size); + poly->num_verts = size; + poly->dirty = VG_TRUE; + poly->vbuf = NULL; + + return poly; +} + +void polygon_destroy(struct polygon *poly) +{ + if (poly->vbuf) + pipe_buffer_reference(&poly->vbuf, NULL); + + free(poly->data); + free(poly); +} + +void polygon_resize(struct polygon *poly, int new_size) +{ + float *data = (float*)malloc(sizeof(float) * COMPONENTS * new_size); + int size = MIN2(sizeof(float) * COMPONENTS * new_size, + sizeof(float) * COMPONENTS * poly->size); + memcpy(data, poly->data, size); + free(poly->data); + poly->data = data; + poly->size = new_size; + poly->dirty = VG_TRUE; +} + +int polygon_size(struct polygon *poly) +{ + return poly->size; +} + +int polygon_vertex_count(struct polygon *poly) +{ + return poly->num_verts; +} + +float * polygon_data(struct polygon *poly) +{ + return poly->data; +} + +void polygon_vertex_append(struct polygon *p, + float x, float y) +{ + float *vert; +#if DEBUG_POLYGON + debug_printf("Append vertex [%f, %f]\n", x, y); +#endif + if (p->num_verts >= p->size) { + polygon_resize(p, p->size * 2); + } + + vert = ptr_to_vertex(p->data, p->num_verts); + vert[0] = x; + vert[1] = y; + ++p->num_verts; + p->dirty = VG_TRUE; +} + +void polygon_set_vertex(struct polygon *p, int idx, + float x, float y) +{ + float *vert; + if (idx >= p->num_verts) { + /*fixme: error reporting*/ + abort(); + return; + } + + vert = ptr_to_vertex(p->data, idx); + vert[0] = x; + vert[1] = y; + p->dirty = VG_TRUE; +} + +void polygon_vertex(struct polygon *p, int idx, + float *vertex) +{ + float *vert; + if (idx >= p->num_verts) { + /*fixme: error reporting*/ + abort(); + return; + } + + vert = ptr_to_vertex(p->data, idx); + vertex[0] = vert[0]; + vertex[1] = vert[1]; +} + +void polygon_bounding_rect(struct polygon *p, + float *rect) +{ + int i; + float minx, miny, maxx, maxy; + float *vert = ptr_to_vertex(p->data, 0); + minx = vert[0]; + maxx = vert[0]; + miny = vert[1]; + maxy = vert[1]; + + for (i = 1; i < p->num_verts; ++i) { + vert = ptr_to_vertex(p->data, i); + minx = MIN2(vert[0], minx); + miny = MIN2(vert[1], miny); + + maxx = MAX2(vert[0], maxx); + maxy = MAX2(vert[1], maxy); + } + + rect[0] = minx; + rect[1] = miny; + rect[2] = maxx - minx; + rect[3] = maxy - miny; +} + +int polygon_contains_point(struct polygon *p, + float x, float y) +{ + return 0; +} + +void polygon_append_polygon(struct polygon *dst, + struct polygon *src) +{ + if (dst->num_verts + src->num_verts >= dst->size) { + polygon_resize(dst, dst->num_verts + src->num_verts * 1.5); + } + memcpy(ptr_to_vertex(dst->data, dst->num_verts), + src->data, src->num_verts * COMPONENTS * sizeof(VGfloat)); + dst->num_verts += src->num_verts; +} + +VGboolean polygon_is_closed(struct polygon *p) +{ + VGfloat start[2], end[2]; + + polygon_vertex(p, 0, start); + polygon_vertex(p, p->num_verts - 1, end); + + return floatsEqual(start[0], end[0]) && floatsEqual(start[1], end[1]); +} + +static void set_blend_for_fill(struct pipe_blend_state *blend) +{ + memset(blend, 0, sizeof(struct pipe_blend_state)); + blend->colormask = 0; /*disable colorwrites*/ + + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; +} + +static void draw_polygon(struct vg_context *ctx, + struct polygon *poly) +{ + int vert_size; + struct pipe_context *pipe; + struct pipe_vertex_buffer vbuffer; + struct pipe_vertex_element velement; + + vert_size = poly->num_verts * COMPONENTS * sizeof(float); + + /*polygon_print(poly);*/ + + pipe = ctx->pipe; + + if (poly->vbuf == NULL || poly->dirty) { + if (poly->vbuf) { + pipe_buffer_reference(&poly->vbuf, + NULL); + } + poly->screen = pipe->screen; + poly->vbuf= pipe_user_buffer_create(poly->screen, + poly->data, + vert_size); + poly->dirty = VG_FALSE; + } + + + /* tell pipe about the vertex buffer */ + memset(&vbuffer, 0, sizeof(vbuffer)); + vbuffer.buffer = poly->vbuf; + vbuffer.stride = COMPONENTS * sizeof(float); /* vertex size */ + vbuffer.buffer_offset = 0; + vbuffer.max_index = poly->num_verts - 1; + pipe->set_vertex_buffers(pipe, 1, &vbuffer); + + /* tell pipe about the vertex attributes */ + velement.src_offset = 0; + velement.vertex_buffer_index = 0; + velement.src_format = PIPE_FORMAT_R32G32_FLOAT; + velement.nr_components = COMPONENTS; + pipe->set_vertex_elements(pipe, 1, &velement); + + /* draw */ + pipe->draw_arrays(pipe, PIPE_PRIM_TRIANGLE_FAN, + 0, poly->num_verts); +} + +void polygon_fill(struct polygon *poly, struct vg_context *ctx) +{ + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_blend_state blend; + VGfloat bounds[4]; + VGfloat min_x, min_y, max_x, max_y; + assert(poly); + polygon_bounding_rect(poly, bounds); + min_x = bounds[0]; + min_y = bounds[1]; + max_x = bounds[0] + bounds[2]; + max_y = bounds[1] + bounds[3]; + +#if DEBUG_POLYGON + debug_printf("Poly bounds are [%f, %f], [%f, %f]\n", + min_x, min_y, max_x, max_y); +#endif + + set_blend_for_fill(&blend); + + memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + cso_save_blend(ctx->cso_context); + cso_save_depth_stencil_alpha(ctx->cso_context); + + dsa.stencil[0].enabled = 1; + if (ctx->state.vg.fill_rule == VG_EVEN_ODD) { + dsa.stencil[0].writemask = 1; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + draw_polygon(ctx, poly); + } else if (ctx->state.vg.fill_rule == VG_NON_ZERO) { + struct pipe_screen *screen = ctx->pipe->screen; + + if (screen->get_param(screen, PIPE_CAP_TWO_SIDED_STENCIL)) { + /* front */ + dsa.stencil[0].writemask = ~0; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + /* back */ + dsa.stencil[1].enabled = 1; + dsa.stencil[1].writemask = ~0; + dsa.stencil[1].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + dsa.stencil[1].func = PIPE_FUNC_ALWAYS; + dsa.stencil[1].ref_value = 0; + dsa.stencil[1].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + draw_polygon(ctx, poly); + } else { + struct pipe_rasterizer_state raster; + + memcpy(&raster, &ctx->state.g3d.rasterizer, sizeof(struct pipe_rasterizer_state)); + + cso_save_rasterizer(ctx->cso_context); + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + raster.cull_mode = raster.front_winding ^ PIPE_WINDING_BOTH; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + draw_polygon(ctx, poly); + + raster.cull_mode = raster.front_winding; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + draw_polygon(ctx, poly); + + cso_restore_rasterizer(ctx->cso_context); + } + } + + /* restore color writes */ + cso_restore_blend(ctx->cso_context); + /* setup stencil ops */ + dsa.stencil[0].func = PIPE_FUNC_NOTEQUAL; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = dsa.stencil[0].writemask; + dsa.stencil[1].enabled = 0; + memcpy(&dsa.depth, &ctx->state.g3d.dsa.depth, + sizeof(struct pipe_depth_state)); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_quad(ctx->renderer, min_x, min_y, + max_x, max_y, 0.0f/*depth should be disabled*/); + + cso_restore_depth_stencil_alpha(ctx->cso_context); +} + +void polygon_array_fill(struct polygon_array *polyarray, struct vg_context *ctx) +{ + struct array *polys = polyarray->array; + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_blend_state blend; + VGfloat min_x = polyarray->min_x; + VGfloat min_y = polyarray->min_y; + VGfloat max_x = polyarray->max_x; + VGfloat max_y = polyarray->max_y; + VGint i; + + +#if DEBUG_POLYGON + debug_printf("%s: Poly bounds are [%f, %f], [%f, %f]\n", + __FUNCTION__, + min_x, min_y, max_x, max_y); +#endif + + set_blend_for_fill(&blend); + + memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + cso_save_blend(ctx->cso_context); + cso_save_depth_stencil_alpha(ctx->cso_context); + + dsa.stencil[0].enabled = 1; + if (ctx->state.vg.fill_rule == VG_EVEN_ODD) { + dsa.stencil[0].writemask = 1; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + } else if (ctx->state.vg.fill_rule == VG_NON_ZERO) { + struct pipe_screen *screen = ctx->pipe->screen; + + if (screen->get_param(screen, PIPE_CAP_TWO_SIDED_STENCIL)) { + /* front */ + dsa.stencil[0].writemask = ~0; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + /* back */ + dsa.stencil[1].enabled = 1; + dsa.stencil[1].writemask = ~0; + dsa.stencil[1].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + dsa.stencil[1].func = PIPE_FUNC_ALWAYS; + dsa.stencil[1].ref_value = 0; + dsa.stencil[1].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + } else { + struct pipe_rasterizer_state raster; + + memcpy(&raster, &ctx->state.g3d.rasterizer, sizeof(struct pipe_rasterizer_state)); + + cso_save_rasterizer(ctx->cso_context); + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + raster.cull_mode = raster.front_winding ^ PIPE_WINDING_BOTH; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + + raster.cull_mode = raster.front_winding; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + + cso_restore_rasterizer(ctx->cso_context); + } + } + + /* restore color writes */ + cso_restore_blend(ctx->cso_context); + /* setup stencil ops */ + dsa.stencil[0].func = PIPE_FUNC_NOTEQUAL; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = dsa.stencil[0].writemask; + dsa.stencil[1].enabled = 0; + memcpy(&dsa.depth, &ctx->state.g3d.dsa.depth, + sizeof(struct pipe_depth_state)); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_quad(ctx->renderer, min_x, min_y, + max_x, max_y, 0.0f/*depth should be disabled*/); + + cso_restore_depth_stencil_alpha(ctx->cso_context); +} diff --git a/src/gallium/state_trackers/vega/polygon.h b/src/gallium/state_trackers/vega/polygon.h new file mode 100644 index 0000000000..22672b728e --- /dev/null +++ b/src/gallium/state_trackers/vega/polygon.h @@ -0,0 +1,75 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef POLYGON_H +#define POLYGON_H + +#include "VG/openvg.h" + +struct polygon; +struct vg_context; +struct vg_paint; +struct array; + +struct polygon *polygon_create(int size); +struct polygon *polygon_create_from_data(float *data, int size); +void polygon_destroy(struct polygon *poly); + +void polygon_resize(struct polygon *poly, int new_size); +int polygon_size(struct polygon *poly); + +int polygon_vertex_count(struct polygon *poly); +float * polygon_data(struct polygon *poly); + +void polygon_vertex_append(struct polygon *p, + float x, float y); +void polygon_append_polygon(struct polygon *dst, + struct polygon *src); +void polygon_set_vertex(struct polygon *p, int idx, + float x, float y); +void polygon_vertex(struct polygon *p, int idx, + float *vertex); + +void polygon_bounding_rect(struct polygon *p, + float *rect); +int polygon_contains_point(struct polygon *p, + float x, float y); + +VGboolean polygon_is_closed(struct polygon *p); + +void polygon_fill(struct polygon *p, struct vg_context *pipe); + +/* TODO: make a file/module around this struct + */ +struct polygon_array { + struct array *array; + VGfloat min_x, max_x; + VGfloat min_y, max_y; +}; + +void polygon_array_fill(struct polygon_array *polyarray, struct vg_context *ctx); + +#endif diff --git a/src/gallium/state_trackers/vega/renderer.c b/src/gallium/state_trackers/vega/renderer.c new file mode 100644 index 0000000000..f7c5f2f0cd --- /dev/null +++ b/src/gallium/state_trackers/vega/renderer.c @@ -0,0 +1,592 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "renderer.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "util/u_draw_quad.h" +#include "util/u_simple_shaders.h" +#include "util/u_memory.h" + +#include "cso_cache/cso_context.h" + +struct renderer { + struct pipe_context *pipe; + struct vg_context *owner; + + struct cso_context *cso; + + void *fs; + + VGfloat vertices[4][2][4]; +}; + +static void setup_shaders(struct renderer *ctx) +{ + struct pipe_context *pipe = ctx->pipe; + /* fragment shader */ + ctx->fs = util_make_fragment_tex_shader(pipe); +} + +static struct pipe_buffer * +setup_vertex_data(struct renderer *ctx, + float x0, float y0, float x1, float y1, float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = 0.0f; /*s*/ + ctx->vertices[0][1][1] = 0.0f; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y0; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = 1.0f; /*s*/ + ctx->vertices[1][1][1] = 0.0f; /*t*/ + + ctx->vertices[2][0][0] = x1; + ctx->vertices[2][0][1] = y1; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = 1.0f; + ctx->vertices[2][1][1] = 1.0f; + + ctx->vertices[3][0][0] = x0; + ctx->vertices[3][0][1] = y1; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = 0.0f; + ctx->vertices[3][1][1] = 1.0f; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + +static struct pipe_buffer * +setup_vertex_data_tex(struct renderer *ctx, + float x0, float y0, float x1, float y1, + float s0, float t0, float s1, float t1, + float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = s0; /*s*/ + ctx->vertices[0][1][1] = t0; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y0; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = s1; /*s*/ + ctx->vertices[1][1][1] = t0; /*t*/ + + ctx->vertices[2][0][0] = x1; + ctx->vertices[2][0][1] = y1; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = s1; + ctx->vertices[2][1][1] = t1; + + ctx->vertices[3][0][0] = x0; + ctx->vertices[3][0][1] = y1; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = s0; + ctx->vertices[3][1][1] = t1; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + + +static struct pipe_buffer * +setup_vertex_data_qtex(struct renderer *ctx, + float x0, float y0, float x1, float y1, + float x2, float y2, float x3, float y3, + float s0, float t0, float s1, float t1, + float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = s0; /*s*/ + ctx->vertices[0][1][1] = t0; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y1; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = s1; /*s*/ + ctx->vertices[1][1][1] = t0; /*t*/ + + ctx->vertices[2][0][0] = x2; + ctx->vertices[2][0][1] = y2; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = s1; + ctx->vertices[2][1][1] = t1; + + ctx->vertices[3][0][0] = x3; + ctx->vertices[3][0][1] = y3; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = s0; + ctx->vertices[3][1][1] = t1; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + +struct renderer * renderer_create(struct vg_context *owner) +{ + VGint i; + struct renderer *renderer = CALLOC_STRUCT(renderer); + + if (!renderer) + return NULL; + + renderer->owner = owner; + renderer->pipe = owner->pipe; + renderer->cso = owner->cso_context; + + setup_shaders(renderer); + + /* init vertex data that doesn't change */ + for (i = 0; i < 4; i++) { + renderer->vertices[i][0][3] = 1.0f; /* w */ + renderer->vertices[i][1][2] = 0.0f; /* r */ + renderer->vertices[i][1][3] = 1.0f; /* q */ + } + + return renderer; +} + +void renderer_destroy(struct renderer *ctx) +{ +#if 0 + if (ctx->fs) { + cso_delete_fragment_shader(ctx->cso, ctx->fs); + ctx->fs = NULL; + } +#endif + free(ctx); +} + +void renderer_draw_quad(struct renderer *r, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat depth) +{ + struct pipe_buffer *buf; + + buf = setup_vertex_data(r, x1, y1, x2, y2, depth); + + if (buf) { + util_draw_vertex_buffer(r->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } +} + +void renderer_draw_texture(struct renderer *r, + struct pipe_texture *tex, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2) +{ + struct pipe_context *pipe = r->pipe; + struct pipe_buffer *buf; + VGfloat s0, t0, s1, t1; + + assert(tex->width[0] != 0); + assert(tex->height[0] != 0); + + s0 = x1offset / tex->width[0]; + s1 = x2offset / tex->width[0]; + t0 = y1offset / tex->height[0]; + t1 = y2offset / tex->height[0]; + + cso_save_vertex_shader(r->cso); + /* shaders */ + cso_set_vertex_shader_handle(r->cso, vg_texture_vs(r->owner)); + + /* draw quad */ + buf = setup_vertex_data_tex(r, x1, y1, x2, y2, + s0, t0, s1, t1, 0.0f); + + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + cso_restore_vertex_shader(r->cso); +} + +void renderer_copy_texture(struct renderer *ctx, + struct pipe_texture *src, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + struct pipe_texture *dst, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_buffer *buf; + struct pipe_surface *dst_surf = screen->get_tex_surface( + screen, dst, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + struct pipe_framebuffer_state fb; + float s0, t0, s1, t1; + + assert(src->width[0] != 0); + assert(src->height[0] != 0); + assert(dst->width[0] != 0); + assert(dst->height[0] != 0); + +#if 0 + debug_printf("copy texture [%f, %f, %f, %f], [%f, %f, %f, %f]\n", + sx1, sy1, sx2, sy2, dx1, dy1, dx2, dy2); +#endif + +#if 1 + s0 = sx1 / src->width[0]; + s1 = sx2 / src->width[0]; + t0 = sy1 / src->height[0]; + t1 = sy2 / src->height[0]; +#else + s0 = 0; + s1 = 1; + t0 = 0; + t1 = 1; +#endif + + assert(screen->is_format_supported(screen, dst_surf->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_RENDER_TARGET, 0)); + + /* save state (restored below) */ + cso_save_blend(ctx->cso); + cso_save_samplers(ctx->cso); + cso_save_sampler_textures(ctx->cso); + cso_save_framebuffer(ctx->cso); + cso_save_fragment_shader(ctx->cso); + cso_save_vertex_shader(ctx->cso); + + cso_save_viewport(ctx->cso); + + + /* set misc state we care about */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask = PIPE_MASK_RGBA; + cso_set_blend(ctx->cso, &blend); + } + + /* sampler */ + { + struct pipe_sampler_state sampler; + memset(&sampler, 0, sizeof(sampler)); + sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.normalized_coords = 1; + cso_single_sampler(ctx->cso, 0, &sampler); + cso_single_sampler_done(ctx->cso); + } + + vg_set_viewport(ctx->owner, VEGA_Y0_TOP); + + /* texture */ + cso_set_sampler_textures(ctx->cso, 1, &src); + + /* shaders */ + cso_set_vertex_shader_handle(ctx->cso, vg_texture_vs(ctx->owner)); + cso_set_fragment_shader_handle(ctx->cso, ctx->fs); + + /* drawing dest */ + memset(&fb, 0, sizeof(fb)); + fb.width = dst_surf->width; + fb.height = dst_surf->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst_surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso, &fb); + + /* draw quad */ + buf = setup_vertex_data_tex(ctx, + dx1, dy1, + dx2, dy2, + s0, t0, s1, t1, + 0.0f); + + if (buf) { + util_draw_vertex_buffer(ctx->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + /* restore state we changed */ + cso_restore_blend(ctx->cso); + cso_restore_samplers(ctx->cso); + cso_restore_sampler_textures(ctx->cso); + cso_restore_framebuffer(ctx->cso); + cso_restore_vertex_shader(ctx->cso); + cso_restore_fragment_shader(ctx->cso); + cso_restore_viewport(ctx->cso); + + pipe_surface_reference(&dst_surf, NULL); +} + +void renderer_copy_surface(struct renderer *ctx, + struct pipe_surface *src, + int srcX0, int srcY0, + int srcX1, int srcY1, + struct pipe_surface *dst, + int dstX0, int dstY0, + int dstX1, int dstY1, + float z, unsigned filter) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_buffer *buf; + struct pipe_texture texTemp, *tex; + struct pipe_surface *texSurf; + struct pipe_framebuffer_state fb; + struct st_framebuffer *stfb = ctx->owner->draw_buffer; + const int srcW = abs(srcX1 - srcX0); + const int srcH = abs(srcY1 - srcY0); + const int srcLeft = MIN2(srcX0, srcX1); + const int srcTop = MIN2(srcY0, srcY1); + + assert(filter == PIPE_TEX_MIPFILTER_NEAREST || + filter == PIPE_TEX_MIPFILTER_LINEAR); + + if (srcLeft != srcX0) { + /* left-right flip */ + int tmp = dstX0; + dstX0 = dstX1; + dstX1 = tmp; + } + + if (srcTop != srcY0) { + /* up-down flip */ + int tmp = dstY0; + dstY0 = dstY1; + dstY1 = tmp; + } + + assert(screen->is_format_supported(screen, src->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + assert(screen->is_format_supported(screen, dst->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + assert(screen->is_format_supported(screen, dst->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_RENDER_TARGET, 0)); + + /* + * XXX for now we're always creating a temporary texture. + * Strictly speaking that's not always needed. + */ + + /* create temp texture */ + memset(&texTemp, 0, sizeof(texTemp)); + texTemp.target = PIPE_TEXTURE_2D; + texTemp.format = src->format; + texTemp.last_level = 0; + texTemp.width[0] = srcW; + texTemp.height[0] = srcH; + texTemp.depth[0] = 1; + pf_get_block(src->format, &texTemp.block); + + tex = screen->texture_create(screen, &texTemp); + if (!tex) + return; + + texSurf = screen->get_tex_surface(screen, tex, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* load temp texture */ + pipe->surface_copy(pipe, + texSurf, 0, 0, /* dest */ + src, srcLeft, srcTop, /* src */ + srcW, srcH); /* size */ + + /* free the surface, update the texture if necessary.*/ + screen->tex_surface_destroy(texSurf); + + /* save state (restored below) */ + cso_save_blend(ctx->cso); + cso_save_samplers(ctx->cso); + cso_save_sampler_textures(ctx->cso); + cso_save_framebuffer(ctx->cso); + cso_save_fragment_shader(ctx->cso); + cso_save_vertex_shader(ctx->cso); + cso_save_viewport(ctx->cso); + + /* set misc state we care about */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask = PIPE_MASK_RGBA; + cso_set_blend(ctx->cso, &blend); + } + + vg_set_viewport(ctx->owner, VEGA_Y0_TOP); + + /* sampler */ + { + struct pipe_sampler_state sampler; + memset(&sampler, 0, sizeof(sampler)); + sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.normalized_coords = 1; + cso_single_sampler(ctx->cso, 0, &sampler); + cso_single_sampler_done(ctx->cso); + } + + /* texture */ + cso_set_sampler_textures(ctx->cso, 1, &tex); + + /* shaders */ + cso_set_fragment_shader_handle(ctx->cso, ctx->fs); + cso_set_vertex_shader_handle(ctx->cso, vg_texture_vs(ctx->owner)); + + /* drawing dest */ + if (stfb->strb->surface != dst) { + memset(&fb, 0, sizeof(fb)); + fb.width = dst->width; + fb.height = dst->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst; + fb.zsbuf = stfb->dsrb->surface; + cso_set_framebuffer(ctx->cso, &fb); + } + + /* draw quad */ + buf = setup_vertex_data(ctx, + (float) dstX0, (float) dstY0, + (float) dstX1, (float) dstY1, z); + + if (buf) { + util_draw_vertex_buffer(ctx->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + + /* restore state we changed */ + cso_restore_blend(ctx->cso); + cso_restore_samplers(ctx->cso); + cso_restore_sampler_textures(ctx->cso); + cso_restore_framebuffer(ctx->cso); + cso_restore_fragment_shader(ctx->cso); + cso_restore_vertex_shader(ctx->cso); + cso_restore_viewport(ctx->cso); + + pipe_texture_reference(&tex, NULL); +} + +void renderer_texture_quad(struct renderer *r, + struct pipe_texture *tex, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, + VGfloat x4, VGfloat y4) +{ + struct pipe_context *pipe = r->pipe; + struct pipe_buffer *buf; + VGfloat s0, t0, s1, t1; + + assert(tex->width[0] != 0); + assert(tex->height[0] != 0); + + s0 = x1offset / tex->width[0]; + s1 = x2offset / tex->width[0]; + t0 = y1offset / tex->height[0]; + t1 = y2offset / tex->height[0]; + + cso_save_vertex_shader(r->cso); + /* shaders */ + cso_set_vertex_shader_handle(r->cso, vg_texture_vs(r->owner)); + + /* draw quad */ + buf = setup_vertex_data_qtex(r, x1, y1, x2, y2, x3, y3, x4, y4, + s0, t0, s1, t1, 0.0f); + + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference(&buf, + NULL); + } + + cso_restore_vertex_shader(r->cso); +} diff --git a/src/gallium/state_trackers/vega/renderer.h b/src/gallium/state_trackers/vega/renderer.h new file mode 100644 index 0000000000..990cd32c31 --- /dev/null +++ b/src/gallium/state_trackers/vega/renderer.h @@ -0,0 +1,76 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef RENDERER_H +#define RENDERER_H + +#include "VG/openvg.h" + +struct renderer; + +struct vg_context; +struct pipe_texture; +struct pipe_surface; + +struct renderer *renderer_create(struct vg_context *owner); +void renderer_destroy(struct renderer *); + +void renderer_draw_quad(struct renderer *, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat depth); +void renderer_draw_texture(struct renderer *, + struct pipe_texture *texture, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2); +void renderer_texture_quad(struct renderer *, + struct pipe_texture *texture, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, + VGfloat x4, VGfloat y4); +void renderer_copy_texture(struct renderer *r, + struct pipe_texture *src, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + struct pipe_texture *dst, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2); +void renderer_copy_surface(struct renderer *r, + struct pipe_surface *src, + int sx1, int sy1, + int sx2, int sy2, + struct pipe_surface *dst, + int dx1, int dy1, + int dx2, int dy2, + float z, unsigned filter); + + +#endif diff --git a/src/gallium/state_trackers/vega/shader.c b/src/gallium/state_trackers/vega/shader.c new file mode 100644 index 0000000000..d9074a377b --- /dev/null +++ b/src/gallium/state_trackers/vega/shader.c @@ -0,0 +1,310 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "shader.h" + +#include "vg_context.h" +#include "shaders_cache.h" +#include "paint.h" +#include "mask.h" +#include "image.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "util/u_memory.h" + +#define MAX_CONSTANTS 20 + +struct shader { + struct vg_context *context; + + VGboolean masking; + struct vg_paint *paint; + struct vg_image *image; + + VGboolean drawing_image; + VGImageMode image_mode; + + float constants[MAX_CONSTANTS]; + struct pipe_constant_buffer cbuf; + struct pipe_shader_state fs_state; + void *fs; +}; + +struct shader * shader_create(struct vg_context *ctx) +{ + struct shader *shader = 0; + + shader = CALLOC_STRUCT(shader); + shader->context = ctx; + + return shader; +} + +void shader_destroy(struct shader *shader) +{ + free(shader); +} + +void shader_set_masking(struct shader *shader, VGboolean set) +{ + shader->masking = set; +} + +VGboolean shader_is_masking(struct shader *shader) +{ + return shader->masking; +} + +void shader_set_paint(struct shader *shader, struct vg_paint *paint) +{ + shader->paint = paint; +} + +struct vg_paint * shader_paint(struct shader *shader) +{ + return shader->paint; +} + + +static void setup_constant_buffer(struct shader *shader) +{ + struct vg_context *ctx = shader->context; + struct pipe_context *pipe = shader->context->pipe; + struct pipe_constant_buffer *cbuf = &shader->cbuf; + VGint param_bytes = paint_constant_buffer_size(shader->paint); + float temp_buf[MAX_CONSTANTS]; + + assert(param_bytes <= sizeof(temp_buf)); + paint_fill_constant_buffer(shader->paint, temp_buf); + + if (cbuf->buffer == NULL || + memcmp(temp_buf, shader->constants, param_bytes) != 0) + { + pipe_buffer_reference(&cbuf->buffer, NULL); + + memcpy(shader->constants, temp_buf, param_bytes); + cbuf->buffer = pipe_user_buffer_create(pipe->screen, + &shader->constants, + sizeof(shader->constants)); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); +} + +static VGint blend_bind_samplers(struct vg_context *ctx, + struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + VGBlendMode bmode = ctx->state.vg.blend_mode; + + if (bmode == VG_BLEND_MULTIPLY || + bmode == VG_BLEND_SCREEN || + bmode == VG_BLEND_DARKEN || + bmode == VG_BLEND_LIGHTEN) { + struct st_framebuffer *stfb = ctx->draw_buffer; + + vg_prepare_blend_surface(ctx); + + samplers[2] = &ctx->blend_sampler; + textures[2] = stfb->blend_texture; + + if (!samplers[0] || !textures[0]) { + samplers[1] = samplers[2]; + textures[1] = textures[2]; + } + if (!samplers[1] || !textures[1]) { + samplers[1] = samplers[0]; + textures[1] = textures[0]; + } + + return 1; + } + return 0; +} + +static void setup_samplers(struct shader *shader) +{ + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct vg_context *ctx = shader->context; + /* a little wonky: we use the num as a boolean that just says + * whether any sampler/textures have been set. the actual numbering + * for samplers is always the same: + * 0 - paint sampler/texture for gradient/pattern + * 1 - mask sampler/texture + * 2 - blend sampler/texture + * 3 - image sampler/texture + * */ + VGint num = 0; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + samplers[3] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + textures[3] = NULL; + + num += paint_bind_samplers(shader->paint, samplers, textures); + num += mask_bind_samplers(samplers, textures); + num += blend_bind_samplers(ctx, samplers, textures); + if (shader->drawing_image && shader->image) + num += image_bind_samplers(shader->image, samplers, textures); + + if (num) { + cso_set_samplers(ctx->cso_context, 4, (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, 4, textures); + } +} + +static INLINE VGboolean is_format_bw(struct shader *shader) +{ +#if 0 + struct vg_context *ctx = shader->context; + struct st_framebuffer *stfb = ctx->draw_buffer; +#endif + + if (shader->drawing_image && shader->image) { + if (shader->image->format == VG_BW_1) + return VG_TRUE; + } + + return VG_FALSE; +} + +static void setup_shader_program(struct shader *shader) +{ + struct vg_context *ctx = shader->context; + VGint shader_id = 0; + VGBlendMode blend_mode = ctx->state.vg.blend_mode; + VGboolean black_white = is_format_bw(shader); + + /* 1st stage: fill */ + if (!shader->drawing_image || + (shader->image_mode == VG_DRAW_IMAGE_MULTIPLY || shader->image_mode == VG_DRAW_IMAGE_STENCIL)) { + switch(paint_type(shader->paint)) { + case VG_PAINT_TYPE_COLOR: + shader_id |= VEGA_SOLID_FILL_SHADER; + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + shader_id |= VEGA_LINEAR_GRADIENT_SHADER; + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + shader_id |= VEGA_RADIAL_GRADIENT_SHADER; + break; + case VG_PAINT_TYPE_PATTERN: + shader_id |= VEGA_PATTERN_SHADER; + break; + + default: + abort(); + } + } + + /* second stage image */ + if (shader->drawing_image) { + switch(shader->image_mode) { + case VG_DRAW_IMAGE_NORMAL: + shader_id |= VEGA_IMAGE_NORMAL_SHADER; + break; + case VG_DRAW_IMAGE_MULTIPLY: + shader_id |= VEGA_IMAGE_MULTIPLY_SHADER; + break; + case VG_DRAW_IMAGE_STENCIL: + shader_id |= VEGA_IMAGE_STENCIL_SHADER; + break; + default: + debug_printf("Unknown image mode!"); + } + } + + if (shader->masking) + shader_id |= VEGA_MASK_SHADER; + + switch(blend_mode) { + case VG_BLEND_MULTIPLY: + shader_id |= VEGA_BLEND_MULTIPLY_SHADER; + break; + case VG_BLEND_SCREEN: + shader_id |= VEGA_BLEND_SCREEN_SHADER; + break; + case VG_BLEND_DARKEN: + shader_id |= VEGA_BLEND_DARKEN_SHADER; + break; + case VG_BLEND_LIGHTEN: + shader_id |= VEGA_BLEND_LIGHTEN_SHADER; + break; + default: + /* handled by pipe_blend_state */ + break; + } + + if (black_white) + shader_id |= VEGA_BW_SHADER; + + shader->fs = shaders_cache_fill(ctx->sc, shader_id); + cso_set_fragment_shader_handle(ctx->cso_context, shader->fs); +} + + +void shader_bind(struct shader *shader) +{ + /* first resolve the real paint type */ + paint_resolve_type(shader->paint); + + setup_constant_buffer(shader); + setup_samplers(shader); + setup_shader_program(shader); +} + +void shader_set_image_mode(struct shader *shader, VGImageMode image_mode) +{ + shader->image_mode = image_mode; +} + +VGImageMode shader_image_mode(struct shader *shader) +{ + return shader->image_mode; +} + +void shader_set_drawing_image(struct shader *shader, VGboolean drawing_image) +{ + shader->drawing_image = drawing_image; +} + +VGboolean shader_drawing_image(struct shader *shader) +{ + return shader->drawing_image; +} + +void shader_set_image(struct shader *shader, struct vg_image *img) +{ + shader->image = img; +} diff --git a/src/gallium/state_trackers/vega/shader.h b/src/gallium/state_trackers/vega/shader.h new file mode 100644 index 0000000000..847eee6a31 --- /dev/null +++ b/src/gallium/state_trackers/vega/shader.h @@ -0,0 +1,56 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef SHADER_H +#define SHADER_H + +#include "VG/openvg.h" + +struct shader; +struct vg_paint; +struct vg_context; +struct vg_image; + +struct shader *shader_create(struct vg_context *context); +void shader_destroy(struct shader *shader); + +void shader_set_masking(struct shader *shader, VGboolean set); +VGboolean shader_is_masking(struct shader *shader); + +void shader_set_paint(struct shader *shader, struct vg_paint *paint); +struct vg_paint *shader_paint(struct shader *shader); + +void shader_set_image_mode(struct shader *shader, VGImageMode image_mode); +VGImageMode shader_image_mode(struct shader *shader); + +void shader_set_drawing_image(struct shader *shader, VGboolean drawing_image); +VGboolean shader_drawing_image(struct shader *shader); + +void shader_set_image(struct shader *shader, struct vg_image *img); + +void shader_bind(struct shader *shader); + +#endif diff --git a/src/gallium/state_trackers/vega/shaders_cache.c b/src/gallium/state_trackers/vega/shaders_cache.c new file mode 100644 index 0000000000..fd0831fab1 --- /dev/null +++ b/src/gallium/state_trackers/vega/shaders_cache.c @@ -0,0 +1,439 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "shaders_cache.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_defines.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "tgsi/tgsi_build.h" +#include "tgsi/tgsi_dump.h" +#include "tgsi/tgsi_parse.h" +#include "tgsi/tgsi_util.h" +#include "tgsi/tgsi_text.h" + +#include "util/u_memory.h" +#include "util/u_math.h" +#include "util/u_debug.h" +#include "cso_cache/cso_hash.h" +#include "cso_cache/cso_context.h" + +#include "VG/openvg.h" + +#include "asm_fill.h" + +/* Essentially we construct an ubber-shader based on the state + * of the pipeline. The stages are: + * 1) Fill (mandatory, solid color/gradient/pattern/image draw) + * 2) Image composition (image mode multiply and stencil) + * 3) Mask + * 4) Extended blend (multiply/screen/darken/lighten) + * 5) Premultiply/Unpremultiply + * 6) Color transform (to black and white) + */ +#define SHADER_STAGES 6 + +struct cached_shader { + void *driver_shader; + struct pipe_shader_state state; +}; + +struct shaders_cache { + struct vg_context *pipe; + + struct cso_hash *hash; +}; + + +static INLINE struct tgsi_token *tokens_from_assembly(const char *txt, int num_tokens) +{ + struct tgsi_token *tokens; + + tokens = (struct tgsi_token *) MALLOC(num_tokens * sizeof(tokens[0])); + + tgsi_text_translate(txt, tokens, num_tokens); + +#if DEBUG_SHADERS + tgsi_dump(tokens, 0); +#endif + + return tokens; +} + +#define ALL_FILLS (VEGA_SOLID_FILL_SHADER | \ + VEGA_LINEAR_GRADIENT_SHADER | \ + VEGA_RADIAL_GRADIENT_SHADER | \ + VEGA_PATTERN_SHADER | \ + VEGA_IMAGE_NORMAL_SHADER) + + +/* +static const char max_shader_preamble[] = + "FRAG1.1\n" + "DCL IN[0], POSITION, LINEAR\n" + "DCL IN[1], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL CONST[0..9], CONSTANT\n" + "DCL TEMP[0..9], CONSTANT\n" + "DCL SAMP[0..9], CONSTANT\n"; + + max_shader_preamble strlen == 175 +*/ +#define MAX_PREAMBLE 175 + +static INLINE VGint range_min(VGint min, VGint current) +{ + if (min < 0) + min = current; + else + min = MIN2(min, current); + return min; +} + +static INLINE VGint range_max(VGint max, VGint current) +{ + return MAX2(max, current); +} + +static void +create_preamble(char *txt, + const struct shader_asm_info *shaders[SHADER_STAGES], + int num_shaders) +{ + VGboolean declare_input = VG_FALSE; + VGint start_const = -1, end_const = 0; + VGint start_temp = -1, end_temp = 0; + VGint start_sampler = -1, end_sampler = 0; + VGint i; + VGint num_consts, num_temps, num_samplers; + + for (i = 0; i < num_shaders; ++i) { + if (shaders[i]->num_consts) + start_const = range_min(start_const, shaders[i]->start_const); + if (shaders[i]->num_temps) + start_temp = range_min(start_temp, shaders[i]->start_temp); + if (shaders[i]->num_samplers) + start_sampler = range_min(start_sampler, shaders[i]->start_sampler); + + end_const = range_max(end_const, shaders[i]->start_const + + shaders[i]->num_consts); + end_temp = range_max(end_temp, shaders[i]->start_temp + + shaders[i]->num_temps); + end_sampler = range_max(end_sampler, shaders[i]->start_sampler + + shaders[i]->num_samplers); + if (shaders[i]->needs_position) + declare_input = VG_TRUE; + } + /* if they're still unitialized, initialize them */ + if (start_const < 0) + start_const = 0; + if (start_temp < 0) + start_temp = 0; + if (start_sampler < 0) + start_sampler = 0; + + num_consts = end_const - start_const; + num_temps = end_temp - start_temp; + num_samplers = end_sampler - start_sampler; + /* end exclusive */ + --end_const; + --end_temp; + --end_sampler; + + sprintf(txt, "FRAG1.1\n"); + + if (declare_input) { + sprintf(txt + strlen(txt), "DCL IN[0], POSITION, LINEAR\n"); + sprintf(txt + strlen(txt), "DCL IN[1], GENERIC[0], PERSPECTIVE\n"); + } + + /* we always have a color output */ + sprintf(txt + strlen(txt), "DCL OUT[0], COLOR, CONSTANT\n"); + + if (num_consts > 1) + sprintf(txt + strlen(txt), "DCL CONST[%d..%d], CONSTANT\n", start_const, end_const); + else if (num_consts == 1) + sprintf(txt + strlen(txt), "DCL CONST[%d], CONSTANT\n", start_const); + + if (num_temps > 1) + sprintf(txt + strlen(txt), "DCL TEMP[%d..%d], CONSTANT\n", start_temp, end_temp); + else if (num_temps > 1) + sprintf(txt + strlen(txt), "DCL TEMP[%d], CONSTANT\n", start_temp); + + if (num_samplers > 1) + sprintf(txt + strlen(txt), "DCL SAMP[%d..%d], CONSTANT\n", start_sampler, end_sampler); + else if (num_samplers == 1) + sprintf(txt + strlen(txt), "DCL SAMP[%d], CONSTANT\n", start_sampler); +} + +static void * +combine_shaders(const struct shader_asm_info *shaders[SHADER_STAGES], int num_shaders, + struct pipe_context *pipe, + struct pipe_shader_state *shader) +{ + char *combined_txt; + int combined_len = MAX_PREAMBLE; + int combined_tokens = 0; + int i = 0; + int current_shader = 0; + int current_len; + + for (i = 0; i < num_shaders; ++i) { + combined_len += strlen(shaders[i]->txt); + combined_tokens += shaders[i]->num_tokens; + } + /* add for the %s->TEMP[0] substitutions */ + combined_len += num_shaders * 7 /*TEMP[0]*/ + 4 /*"END\n"*/; + + combined_txt = (char*)malloc(combined_len); + combined_txt[0] = '\0'; + + create_preamble(combined_txt, shaders, num_shaders); + + while (current_shader < num_shaders) { + const char temp[] = "TEMP[0]"; + const char out[] = "OUT[0]"; + const char *subst = temp; + + current_len = strlen(combined_txt); + + /* if the last shader then output */ + if (current_shader + 1 == num_shaders) + subst = out; + + snprintf(combined_txt + current_len, + combined_len - current_len, + shaders[current_shader]->txt, + subst); + ++current_shader; + } + + + current_len = strlen(combined_txt); + snprintf(combined_txt + current_len, + combined_len - current_len, + "END\n"); + + debug_printf("Combined shader is : \n%s\n", + combined_txt); + + shader->tokens = tokens_from_assembly( + combined_txt, combined_tokens); + + free(combined_txt); + + return pipe->create_fs_state(pipe, shader); +} + +static void * +create_shader(struct pipe_context *pipe, + int id, + struct pipe_shader_state *shader) +{ + int idx = 0; + const struct shader_asm_info * shaders[SHADER_STAGES]; + + /* the shader has to have a fill */ + debug_assert(id & ALL_FILLS); + + /* first stage */ + if (id & VEGA_SOLID_FILL_SHADER) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[0]; + debug_assert(shaders_asm[0].id == VEGA_SOLID_FILL_SHADER); + ++idx; + } + if ((id & VEGA_LINEAR_GRADIENT_SHADER)) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[1]; + debug_assert(shaders_asm[1].id == VEGA_LINEAR_GRADIENT_SHADER); + ++idx; + } + if ((id & VEGA_RADIAL_GRADIENT_SHADER)) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[2]; + debug_assert(shaders_asm[2].id == VEGA_RADIAL_GRADIENT_SHADER); + ++idx; + } + if ((id & VEGA_PATTERN_SHADER)) { + debug_assert(idx == 0); + debug_assert(shaders_asm[3].id == VEGA_PATTERN_SHADER); + shaders[idx] = &shaders_asm[3]; + ++idx; + } + if ((id & VEGA_IMAGE_NORMAL_SHADER)) { + debug_assert(idx == 0); + debug_assert(shaders_asm[4].id == VEGA_IMAGE_NORMAL_SHADER); + shaders[idx] = &shaders_asm[4]; + ++idx; + } + + /* second stage */ + if ((id & VEGA_IMAGE_MULTIPLY_SHADER)) { + debug_assert(shaders_asm[5].id == VEGA_IMAGE_MULTIPLY_SHADER); + shaders[idx] = &shaders_asm[5]; + ++idx; + } else if ((id & VEGA_IMAGE_STENCIL_SHADER)) { + debug_assert(shaders_asm[6].id == VEGA_IMAGE_STENCIL_SHADER); + shaders[idx] = &shaders_asm[6]; + ++idx; + } + + /* third stage */ + if ((id & VEGA_MASK_SHADER)) { + debug_assert(idx == 1); + debug_assert(shaders_asm[7].id == VEGA_MASK_SHADER); + shaders[idx] = &shaders_asm[7]; + ++idx; + } + + /* fourth stage */ + if ((id & VEGA_BLEND_MULTIPLY_SHADER)) { + debug_assert(shaders_asm[8].id == VEGA_BLEND_MULTIPLY_SHADER); + shaders[idx] = &shaders_asm[8]; + ++idx; + } else if ((id & VEGA_BLEND_SCREEN_SHADER)) { + debug_assert(shaders_asm[9].id == VEGA_BLEND_SCREEN_SHADER); + shaders[idx] = &shaders_asm[9]; + ++idx; + } else if ((id & VEGA_BLEND_DARKEN_SHADER)) { + debug_assert(shaders_asm[10].id == VEGA_BLEND_DARKEN_SHADER); + shaders[idx] = &shaders_asm[10]; + ++idx; + } else if ((id & VEGA_BLEND_LIGHTEN_SHADER)) { + debug_assert(shaders_asm[11].id == VEGA_BLEND_LIGHTEN_SHADER); + shaders[idx] = &shaders_asm[11]; + ++idx; + } + + /* fifth stage */ + if ((id & VEGA_PREMULTIPLY_SHADER)) { + debug_assert(shaders_asm[12].id == VEGA_PREMULTIPLY_SHADER); + shaders[idx] = &shaders_asm[12]; + ++idx; + } else if ((id & VEGA_UNPREMULTIPLY_SHADER)) { + debug_assert(shaders_asm[13].id == VEGA_UNPREMULTIPLY_SHADER); + shaders[idx] = &shaders_asm[13]; + ++idx; + } + + /* sixth stage */ + if ((id & VEGA_BW_SHADER)) { + debug_assert(shaders_asm[14].id == VEGA_BW_SHADER); + shaders[idx] = &shaders_asm[14]; + ++idx; + } + + return combine_shaders(shaders, idx, pipe, shader); +} + +/*************************************************/ + +struct shaders_cache * shaders_cache_create(struct vg_context *vg) +{ + struct shaders_cache *sc = CALLOC_STRUCT(shaders_cache); + + sc->pipe = vg; + sc->hash = cso_hash_create(); + + return sc; +} + +void shaders_cache_destroy(struct shaders_cache *sc) +{ + struct cso_hash_iter iter = cso_hash_first_node(sc->hash); + + while (!cso_hash_iter_is_null(iter)) { + struct cached_shader *cached = + (struct cached_shader *)cso_hash_iter_data(iter); + cso_delete_fragment_shader(sc->pipe->cso_context, + cached->driver_shader); + iter = cso_hash_erase(sc->hash, iter); + } + + cso_hash_delete(sc->hash); + free(sc); +} + +void * shaders_cache_fill(struct shaders_cache *sc, + int shader_key) +{ + VGint key = shader_key; + struct cached_shader *cached; + struct cso_hash_iter iter = cso_hash_find(sc->hash, key); + + if (cso_hash_iter_is_null(iter)) { + cached = CALLOC_STRUCT(cached_shader); + cached->driver_shader = create_shader(sc->pipe->pipe, key, &cached->state); + + cso_hash_insert(sc->hash, key, cached); + + return cached->driver_shader; + } + + cached = (struct cached_shader *)cso_hash_iter_data(iter); + + assert(cached->driver_shader); + return cached->driver_shader; +} + +struct vg_shader * shader_create_from_text(struct pipe_context *pipe, + const char *txt, int num_tokens, + int type) +{ + struct vg_shader *shader = (struct vg_shader *)malloc( + sizeof(struct vg_shader)); + struct tgsi_token *tokens = tokens_from_assembly(txt, num_tokens); + struct pipe_shader_state state; + + debug_assert(type == PIPE_SHADER_VERTEX || + type == PIPE_SHADER_FRAGMENT); + + state.tokens = tokens; + shader->type = type; + shader->tokens = tokens; + + if (type == PIPE_SHADER_FRAGMENT) + shader->driver = pipe->create_fs_state(pipe, &state); + else + shader->driver = pipe->create_vs_state(pipe, &state); + return shader; +} + +void vg_shader_destroy(struct vg_context *ctx, struct vg_shader *shader) +{ + if (shader->type == PIPE_SHADER_FRAGMENT) + cso_delete_fragment_shader(ctx->cso_context, shader->driver); + else + cso_delete_vertex_shader(ctx->cso_context, shader->driver); + free(shader->tokens); + free(shader); +} diff --git a/src/gallium/state_trackers/vega/shaders_cache.h b/src/gallium/state_trackers/vega/shaders_cache.h new file mode 100644 index 0000000000..feca58b61a --- /dev/null +++ b/src/gallium/state_trackers/vega/shaders_cache.h @@ -0,0 +1,77 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef SHADERS_CACHE_H +#define SHADERS_CACHE_H + + +struct vg_context; +struct pipe_context; +struct tgsi_token; +struct shaders_cache; + +enum VegaShaderType { + VEGA_SOLID_FILL_SHADER = 1 << 0, + VEGA_LINEAR_GRADIENT_SHADER = 1 << 1, + VEGA_RADIAL_GRADIENT_SHADER = 1 << 2, + VEGA_PATTERN_SHADER = 1 << 3, + VEGA_IMAGE_NORMAL_SHADER = 1 << 4, + VEGA_IMAGE_MULTIPLY_SHADER = 1 << 5, + VEGA_IMAGE_STENCIL_SHADER = 1 << 6, + + VEGA_MASK_SHADER = 1 << 7, + + VEGA_BLEND_MULTIPLY_SHADER = 1 << 8, + VEGA_BLEND_SCREEN_SHADER = 1 << 9, + VEGA_BLEND_DARKEN_SHADER = 1 << 10, + VEGA_BLEND_LIGHTEN_SHADER = 1 << 11, + + VEGA_PREMULTIPLY_SHADER = 1 << 12, + VEGA_UNPREMULTIPLY_SHADER = 1 << 13, + + VEGA_BW_SHADER = 1 << 14 +}; + +struct vg_shader { + void *driver; + struct tgsi_token *tokens; + int type;/* PIPE_SHADER_VERTEX, PIPE_SHADER_FRAGMENT */ +}; + +struct shaders_cache *shaders_cache_create(struct vg_context *pipe); +void shaders_cache_destroy(struct shaders_cache *sc); +void *shaders_cache_fill(struct shaders_cache *sc, + int shader_key); + +struct vg_shader *shader_create_from_text(struct pipe_context *pipe, + const char *txt, int num_tokens, + int type); + +void vg_shader_destroy(struct vg_context *ctx, struct vg_shader *shader); + + + +#endif diff --git a/src/gallium/state_trackers/vega/st_inlines.h b/src/gallium/state_trackers/vega/st_inlines.h new file mode 100644 index 0000000000..1f331dfcdb --- /dev/null +++ b/src/gallium/state_trackers/vega/st_inlines.h @@ -0,0 +1,159 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +/** + * Functions for checking if buffers/textures are referenced when we need + * to read/write from/to them. Flush when needed. + */ + +#ifndef ST_INLINES_H +#define ST_INLINES_H + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_defines.h" +#include "pipe/p_inlines.h" +#include "pipe/p_state.h" + +static INLINE struct pipe_transfer * +st_cond_flush_get_tex_transfer(struct vg_context *st, + struct pipe_texture *pt, + unsigned int face, + unsigned int level, + unsigned int zslice, + enum pipe_transfer_usage usage, + unsigned int x, unsigned int y, + unsigned int w, unsigned int h) +{ + struct pipe_screen *screen = st->pipe->screen; + struct pipe_context *pipe = st->pipe; + unsigned referenced = + pipe->is_texture_referenced(pipe, pt, face, level); + + if (referenced && ((referenced & PIPE_REFERENCED_FOR_WRITE) || + usage == PIPE_TRANSFER_WRITE || + usage == PIPE_TRANSFER_READ_WRITE)) + vgFlush(); + + return screen->get_tex_transfer(screen, pt, face, level, zslice, usage, + x, y, w, h); +} + +static INLINE struct pipe_transfer * +st_no_flush_get_tex_transfer(struct vg_context *st, + struct pipe_texture *pt, + unsigned int face, + unsigned int level, + unsigned int zslice, + enum pipe_transfer_usage usage, + unsigned int x, unsigned int y, + unsigned int w, unsigned int h) +{ + struct pipe_screen *screen = st->pipe->screen; + + return screen->get_tex_transfer(screen, pt, face, level, + zslice, usage, x, y, w, h); +} + +static INLINE void * +st_cond_flush_pipe_buffer_map(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int map_flags) +{ + struct pipe_context *pipe = st->pipe; + unsigned int referenced = pipe->is_buffer_referenced(pipe, buf); + + if (referenced && ((referenced & PIPE_REFERENCED_FOR_WRITE) || + (map_flags & PIPE_BUFFER_USAGE_CPU_WRITE))) + vgFlush(); + + return pipe_buffer_map(pipe->screen, buf, map_flags); +} + +static INLINE void * +st_no_flush_pipe_buffer_map(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int map_flags) +{ + return pipe_buffer_map(st->pipe->screen, buf, map_flags); +} + + +static INLINE void +st_cond_flush_pipe_buffer_write(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + const void * data) +{ + struct pipe_context *pipe = st->pipe; + + if (pipe->is_buffer_referenced(pipe, buf)) + vgFlush(); + + pipe_buffer_write(pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_no_flush_pipe_buffer_write(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + const void * data) +{ + pipe_buffer_write(st->pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_cond_flush_pipe_buffer_read(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + void * data) +{ + struct pipe_context *pipe = st->pipe; + + if (pipe->is_buffer_referenced(pipe, buf) & PIPE_REFERENCED_FOR_WRITE) + vgFlush(); + + pipe_buffer_read(pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_no_flush_pipe_buffer_read(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + void * data) +{ + pipe_buffer_read(st->pipe->screen, buf, offset, size, data); +} + +#endif + diff --git a/src/gallium/state_trackers/vega/stroker.c b/src/gallium/state_trackers/vega/stroker.c new file mode 100644 index 0000000000..1b92d2b5c6 --- /dev/null +++ b/src/gallium/state_trackers/vega/stroker.c @@ -0,0 +1,1349 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "stroker.h" + +#include "path.h" +#include "vg_state.h" +#include "util_array.h" +#include "arc.h" +#include "bezier.h" +#include "matrix.h" +#include "path_utils.h" +#include "polygon.h" + +#include "math.h" + +#ifndef M_2PI +#define M_2PI 6.28318530717958647692528676655900576 +#endif + +#define STROKE_SEGMENTS 0 +#define STROKE_DEBUG 0 +#define DEBUG_EMITS 0 + +static const VGfloat curve_threshold = 0.25f; + +static const VGfloat zero_coords[] = {0.f, 0.f}; + +enum intersection_type { + NoIntersections, + BoundedIntersection, + UnboundedIntersection, +}; + +enum line_join_mode { + FlatJoin, + SquareJoin, + MiterJoin, + RoundJoin, + RoundCap +}; + +struct stroke_iterator { + void (*next)(struct stroke_iterator *); + VGboolean (*has_next)(struct stroke_iterator *); + + VGPathCommand (*current_command)(struct stroke_iterator *it); + void (*current_coords)(struct stroke_iterator *it, VGfloat *coords); + + VGint position; + VGint coord_position; + + const VGubyte *cmds; + const VGfloat *coords; + VGint num_commands; + VGint num_coords; + + struct polygon *curve_poly; + VGint curve_index; +}; + +static VGPathCommand stroke_itr_command(struct stroke_iterator *itr) +{ + return itr->current_command(itr); +} + +static void stroke_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + itr->current_coords(itr, coords); +} + +static void stroke_fw_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->position >= itr->num_commands) + return; + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + coords[2] = itr->coords[itr->coord_position + 2]; + coords[3] = itr->coords[itr->coord_position + 3]; + coords[4] = itr->coords[itr->coord_position + 4]; + coords[5] = itr->coords[itr->coord_position + 5]; + break; + default: + debug_assert(!"invalid command!\n"); + } +} + + +static void stroke_bw_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->position >= itr->num_commands) + return; + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + coords[0] = itr->coords[itr->coord_position + 4]; + coords[1] = itr->coords[itr->coord_position + 5]; + coords[2] = itr->coords[itr->coord_position + 2]; + coords[3] = itr->coords[itr->coord_position + 3]; + coords[4] = itr->coords[itr->coord_position + 0]; + coords[5] = itr->coords[itr->coord_position + 1]; + break; + default: + debug_assert(!"invalid command!\n"); + } +} + + +static VGPathCommand stroke_fw_current_command(struct stroke_iterator *it) +{ + return it->cmds[it->position]; +} + +static VGPathCommand stroke_bw_current_command(struct stroke_iterator *it) +{ + VGPathCommand prev_cmd; + if (it->position == it->num_commands -1) + return VG_MOVE_TO_ABS; + + prev_cmd = it->cmds[it->position + 1]; + return prev_cmd; +} + +static VGboolean stroke_fw_has_next(struct stroke_iterator *itr) +{ + return itr->position < (itr->num_commands - 1); +} + +static VGboolean stroke_bw_has_next(struct stroke_iterator *itr) +{ + return itr->position > 0; +} + +static void stroke_fw_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + debug_assert(stroke_fw_has_next(itr)); + + cmd = stroke_itr_command(itr); + + itr->coord_position += num_elements_for_segments(&cmd, 1); + ++itr->position; +} + +static void stroke_bw_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + debug_assert(stroke_bw_has_next(itr)); + + --itr->position; + cmd = stroke_itr_command(itr); + + itr->coord_position -= num_elements_for_segments(&cmd, 1); +} + +static void stroke_itr_common_init(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + itr->cmds = (VGubyte*)cmds->data; + itr->num_commands = cmds->num_elements; + + itr->coords = (VGfloat*)coords->data; + itr->num_coords = coords->num_elements; +} + +static void stroke_forward_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + stroke_itr_common_init(itr, cmds, coords); + itr->position = 0; + itr->coord_position = 0; + + itr->next = stroke_fw_next; + itr->has_next = stroke_fw_has_next; + itr->current_command = stroke_fw_current_command; + itr->current_coords = stroke_fw_itr_coords; +} + +static void stroke_backward_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + VGubyte cmd; + stroke_itr_common_init(itr, cmds, coords); + itr->position = itr->num_commands - 1; + + cmd = stroke_bw_current_command(itr); + itr->coord_position = itr->num_coords - + num_elements_for_segments(&cmd, 1); + + itr->next = stroke_bw_next; + itr->has_next = stroke_bw_has_next; + itr->current_command = stroke_bw_current_command; + itr->current_coords = stroke_bw_itr_coords; +} + + + +static void stroke_flat_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + + if (itr->curve_index >= 0) { + ++itr->curve_index; + if (itr->curve_index >= polygon_vertex_count(itr->curve_poly)) { + itr->curve_index = -1; + polygon_destroy(itr->curve_poly); + itr->curve_poly = 0; + } else + return; + } + debug_assert(stroke_fw_has_next(itr)); + + cmd = itr->cmds[itr->position]; + itr->coord_position += num_elements_for_segments(&cmd, 1); + ++itr->position; + + cmd = itr->cmds[itr->position]; + + if (cmd == VG_CUBIC_TO_ABS) { + struct bezier bezier; + VGfloat bez[8]; + + bez[0] = itr->coords[itr->coord_position - 2]; + bez[1] = itr->coords[itr->coord_position - 1]; + bez[2] = itr->coords[itr->coord_position]; + bez[3] = itr->coords[itr->coord_position + 1]; + bez[4] = itr->coords[itr->coord_position + 2]; + bez[5] = itr->coords[itr->coord_position + 3]; + bez[6] = itr->coords[itr->coord_position + 4]; + bez[7] = itr->coords[itr->coord_position + 5]; + + bezier_init(&bezier, + bez[0], bez[1], + bez[2], bez[3], + bez[4], bez[5], + bez[6], bez[7]); + /* skip the first one, it's the same as the prev point */ + itr->curve_index = 1; + if (itr->curve_poly) { + polygon_destroy(itr->curve_poly); + itr->curve_poly = 0; + } + itr->curve_poly = bezier_to_polygon(&bezier); + } +} + +static VGboolean stroke_flat_has_next(struct stroke_iterator *itr) +{ + return (itr->curve_index >= 0 && + itr->curve_index < (polygon_vertex_count(itr->curve_poly)-1)) + || itr->position < (itr->num_commands - 1); +} + +static VGPathCommand stroke_flat_current_command(struct stroke_iterator *it) +{ + if (it->cmds[it->position] == VG_CUBIC_TO_ABS) { + return VG_LINE_TO_ABS; + } + return it->cmds[it->position]; +} + +static void stroke_flat_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->curve_index <= -1 && itr->position >= itr->num_commands) + return; + + if (itr->curve_index >= 0) { + polygon_vertex(itr->curve_poly, itr->curve_index, + coords); + return; + } + + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + default: + debug_assert(!"invalid command!\n"); + } +} + +static void stroke_flat_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + stroke_itr_common_init(itr, cmds, coords); + itr->position = 0; + itr->coord_position = 0; + + itr->next = stroke_flat_next; + itr->has_next = stroke_flat_has_next; + itr->current_command = stroke_flat_current_command; + itr->current_coords = stroke_flat_itr_coords; + itr->curve_index = -1; + itr->curve_poly = 0; +} + + +static INLINE VGboolean finite_coords4(const VGfloat *c) +{ + return + isfinite(c[0]) && isfinite(c[1]) && + isfinite(c[2]) && isfinite(c[3]); +} + +/* from Graphics Gems II */ +#define SAME_SIGNS(a, b) ((a) * (b) >= 0) +static VGboolean do_lines_intersect(VGfloat x1, VGfloat y1, VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, VGfloat x4, VGfloat y4) +{ + VGfloat a1, a2, b1, b2, c1, c2; /* Coefficients of line eqns */ + VGfloat r1, r2, r3, r4; /* 'sign' values */ + + a1 = y2 - y1; + b1 = x1 - x2; + c1 = x2 * y1 - x1 * y2; + + r3 = a1 * x3 + b1 * y3 + c1; + r4 = a1 * x4 + b1 * y4 + c1; + + if (r3 != 0 && r4 != 0 && SAME_SIGNS(r3, r4)) + return VG_FALSE; + + a2 = y4 - y3; + b2 = x3 - x4; + c2 = x4 * y3 - x3 * y4; + + r1 = a2 * x1 + b2 * y1 + c2; + r2 = a2 * x2 + b2 * y2 + c2; + + if (r1 != 0 && r2 != 0 && SAME_SIGNS(r1, r2)) + return VG_FALSE; + + return VG_TRUE; +} + +static INLINE VGfloat line_dx(const VGfloat *l) +{ + return l[2] - l[0]; +} + +static INLINE VGfloat line_dy(const VGfloat *l) +{ + return l[3] - l[1]; +} + +static INLINE VGfloat line_angle(const VGfloat *l) +{ + const VGfloat dx = line_dx(l); + const VGfloat dy = line_dy(l); + + const VGfloat theta = atan2(-dy, dx) * 360.0 / M_2PI; + + const VGfloat theta_normalized = theta < 0 ? theta + 360 : theta; + + if (floatsEqual(theta_normalized, 360.f)) + return 0; + else + return theta_normalized; +} + +static INLINE void line_set_length(VGfloat *l, VGfloat len) +{ + VGfloat uv[] = {l[0], l[1], l[2], l[3]}; + if (null_line(l)) + return; + line_normalize(uv); + l[2] = l[0] + line_dx(uv) * len; + l[3] = l[1] + line_dy(uv) * len; +} + +static INLINE void line_translate(VGfloat *l, VGfloat x, VGfloat y) +{ + l[0] += x; + l[1] += y; + l[2] += x; + l[3] += y; +} + +static INLINE VGfloat line_angle_to(const VGfloat *l1, + const VGfloat *l2) +{ + VGfloat a1, a2, delta, delta_normalized; + if (null_line(l1) || null_line(l1)) + return 0; + + a1 = line_angle(l1); + a2 = line_angle(l2); + + delta = a2 - a1; + delta_normalized = delta < 0 ? delta + 360 : delta; + + if (floatsEqual(delta, 360.f)) + return 0; + else + return delta_normalized; +} + +static INLINE VGfloat line_angles(const VGfloat *l1, + const VGfloat *l2) +{ + VGfloat cos_line, rad = 0; + + if (null_line(l1) || null_line(l2)) + return 0; + + cos_line = (line_dx(l1)*line_dx(l2) + line_dy(l1)*line_dy(l2)) / + (line_lengthv(l1)*line_lengthv(l2)); + rad = 0; + + if (cos_line >= -1.0 && cos_line <= 1.0) + rad = acos(cos_line); + return rad * 360 / M_2PI; +} + + +static INLINE VGfloat adapted_angle_on_x(const VGfloat *line) +{ + const VGfloat identity[] = {0, 0, 1, 0}; + VGfloat angle = line_angles(line, identity); + if (line_dy(line) > 0) + angle = 360 - angle; + return angle; +} + +static enum intersection_type line_intersect(const VGfloat *l1, + const VGfloat *l2, + float *intersection_point) +{ + VGfloat isect[2]; + enum intersection_type type; + VGboolean dx_zero, ldx_zero; + + if (null_line(l1) || null_line(l2) || + !finite_coords4(l1) || !finite_coords4(l2)) + return NoIntersections; + + type = do_lines_intersect(l1[0], l1[1], l1[2], l1[3], l2[0], l2[1], l2[2], l2[3]) + ? BoundedIntersection : UnboundedIntersection; + + dx_zero = floatsEqual(line_dx(l1) + 1, 1); + ldx_zero = floatsEqual(line_dx(l2) + 1, 1); + + /* one of the lines is vertical */ + if (dx_zero && ldx_zero) { + type = NoIntersections; + } else if (dx_zero) { + VGfloat la = line_dy(l2) / line_dx(l2); + isect[0] = l1[0]; + isect[1] = la * l1[0] + l2[1] - la * l2[0]; + } else if (ldx_zero) { + VGfloat ta = line_dy(l1) / line_dx(l1); + isect[0] = l2[0]; + isect[1] = ta * l2[0] + l1[1] - ta*l1[0]; + } else { + VGfloat x; + VGfloat ta = line_dy(l1) / line_dx(l1); + VGfloat la = line_dy(l2) / line_dx(l2); + if (ta == la) + return NoIntersections; + + x = ( - l2[1] + la * l2[0] + l1[1] - ta * l1[0] ) / (la - ta); + isect[0] = x; + isect[1] = ta*(x - l1[0]) + l1[1]; + } + if (intersection_point) { + intersection_point[0] = isect[0]; + intersection_point[1] = isect[1]; + } + return type; +} + +static INLINE enum line_join_mode stroker_join_mode(struct stroker *s) +{ + switch(s->join_style) { + case VG_JOIN_MITER: + return MiterJoin; + case VG_JOIN_ROUND: + return RoundJoin; + case VG_JOIN_BEVEL: + return FlatJoin; + default: + return FlatJoin; + } +} + +static INLINE enum line_join_mode stroker_cap_mode(struct stroker *s) +{ + switch(s->cap_style) { + case VG_CAP_BUTT: + return FlatJoin; + case VG_CAP_ROUND: + return RoundCap; + case VG_CAP_SQUARE: + return SquareJoin; + default: + return FlatJoin; + } +} + +void stroker_emit_move_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_MOVE_TO_ABS; + VGfloat coords[2] = {x, y}; +#if DEBUG_EMITS + debug_printf("emit move %f, %f\n", x, y); +#endif + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + stroker->back1_x = x; + stroker->back1_y = y; + + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +void stroker_emit_line_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_LINE_TO_ABS; + VGfloat coords[2] = {x, y}; +#if DEBUG_EMITS + debug_printf("emit line %f, %f\n", x, y); +#endif + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + stroker->back1_x = x; + stroker->back1_y = y; + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +void stroker_emit_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_CUBIC_TO_ABS; + VGfloat coords[6] = {px1, py1, px2, py2, x, y}; +#if DEBUG_EMITS + debug_printf("emit curve %f, %f, %f, %f, %f, %f\n", px1, py1, + px2, py2, x, y); +#endif + + if (px2 == x && py2 == y) { + if (px1 == x && py1 == y) { + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + } else { + stroker->back2_x = px1; + stroker->back2_y = py1; + } + } else { + stroker->back2_x = px2; + stroker->back2_y = py2; + } + stroker->back1_x = x; + stroker->back1_y = y; + + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +static INLINE void create_round_join(struct stroker *stroker, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat width, VGfloat height) +{ + struct arc arc; + struct matrix matrix; + + matrix_load_identity(&matrix); + + /*stroker_emit_line_to(stroker, nx, ny);*/ + + arc_init(&arc, VG_SCCWARC_TO_ABS, + x1, y1, x2, y2, width/2, height/2, 0); + arc_stroker_emit(&arc, stroker, &matrix); +} + + +static void create_joins(struct stroker *stroker, + VGfloat focal_x, VGfloat focal_y, + const VGfloat *next_line, enum line_join_mode join) +{ +#if DEBUG_EMITS + debug_printf("create_joins: focal=[%f, %f], next_line=[%f, %f,%f, %f]\n", + focal_x, focal_y, + next_line[0], next_line[1], next_line[2], next_line[3]); +#endif + /* if we're alredy connected do nothing */ + if (floatsEqual(stroker->back1_x, next_line[0]) && + floatsEqual(stroker->back1_y, next_line[1])) + return; + + if (join == FlatJoin) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else { + VGfloat prev_line[] = {stroker->back2_x, stroker->back2_y, + stroker->back1_x, stroker->back1_y}; + + VGfloat isect[2]; + enum intersection_type type = line_intersect(prev_line, next_line, isect); + + if (join == SquareJoin) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat l1[4] = {prev_line[0], + prev_line[1], + prev_line[2], + prev_line[3]}; + VGfloat l2[4] = {next_line[2], + next_line[3], + next_line[0], + next_line[1]}; + + line_translate(l1, line_dx(l1), line_dy(l1)); + line_set_length(l1, offset); + + line_translate(l2, line_dx(l2), line_dy(l2)); + line_set_length(l2, offset); + + stroker_emit_line_to(stroker, l1[2], l1[3]); + stroker_emit_line_to(stroker, l2[2], l2[3]); + stroker_emit_line_to(stroker, l2[0], l2[1]); + } else if (join == RoundJoin) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat short_cut[4] = {prev_line[2], prev_line[3], + next_line[0], next_line[1]}; + VGfloat angle = line_angles(prev_line, short_cut); + + if (type == BoundedIntersection || + (angle > 90 && !floatsEqual(angle, 90.f))) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + return; + } + create_round_join(stroker, prev_line[2], prev_line[3], + next_line[0], next_line[1], + offset * 2, offset * 2); + + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else if (join == RoundCap) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat l1[4] = { prev_line[0], prev_line[1], + prev_line[2], prev_line[3] }; + VGfloat l2[4] = {focal_x, focal_y, + prev_line[2], prev_line[3]}; + + line_translate(l1, line_dx(l1), line_dy(l1)); + line_set_length(l1, KAPPA * offset); + + /* normal between prev_line and focal */ + line_translate(l2, -line_dy(l2), line_dx(l2)); + line_set_length(l2, KAPPA * offset); + + stroker_emit_curve_to(stroker, l1[2], l1[3], + l2[2], l2[3], + l2[0], l2[1]); + + l2[0] = l2[0]; + l2[1] = l2[1]; + l2[2] = l2[0] - line_dx(l2); + l2[3] = l2[1] - line_dy(l2); + + line_translate(l1, next_line[0] - l1[0], next_line[1] - l1[1]); + + stroker_emit_curve_to(stroker, + l2[2], l2[3], + l1[2], l1[3], + l1[0], l1[1]); + } else if (join == MiterJoin) { + VGfloat miter_line[4] = {stroker->back1_x, stroker->back1_y, + isect[0], isect[1]}; + VGfloat sl = (stroker->stroke_width * stroker->miter_limit); + VGfloat inside_line[4] = {prev_line[2], prev_line[3], + next_line[0], next_line[1]}; + VGfloat angle = line_angle_to(inside_line, prev_line); + + if (type == BoundedIntersection || + (angle > 90 && !floatsEqual(angle, 90.f))) { + /* + debug_printf("f = %f, nl = %f, pl = %f, is = %f\n", + focal_x, next_line[0], + prev_line[2], isect[0]);*/ + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + return; + } + + if (type == NoIntersections || line_lengthv(miter_line) > sl) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else { + stroker_emit_line_to(stroker, isect[0], isect[1]); + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } + } else { + debug_assert(!"create_joins bad join style"); + } + } +} + +static void stroker_add_segment(struct stroker *stroker, + VGPathCommand cmd, + const VGfloat *coords, + VGint num_coords) +{ + /* skip duplicated points */ + if (stroker->segments->num_elements && + stroker->last_cmd == cmd) { + VGfloat *data = stroker->control_points->data; + data += stroker->control_points->num_elements; + data -= num_coords; + switch (cmd) { + case VG_MOVE_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + break; + case VG_LINE_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + break; + case VG_CUBIC_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1]) && + floatsEqual(coords[2], data[2]) && + floatsEqual(coords[3], data[3]) && + floatsEqual(coords[4], data[4]) && + floatsEqual(coords[5], data[5])) + return; + break; + default: + debug_assert(!"Invalid stroke segment"); + } + } else if (stroker->last_cmd == VG_CUBIC_TO_ABS && + cmd == VG_LINE_TO_ABS) { + VGfloat *data = stroker->control_points->data; + data += stroker->control_points->num_elements; + data -= 2; + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + } + stroker->last_cmd = cmd; + array_append_data(stroker->segments, &cmd, 1); + array_append_data(stroker->control_points, coords, num_coords); +} + +void stroker_move_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGfloat coords[2] = {x, y}; +#if STROKE_SEGMENTS + debug_printf("stroker_move_to(%f, %f)\n", x, y); +#endif + + if (stroker->segments->num_elements > 0) + stroker->process_subpath(stroker); + + array_reset(stroker->segments); + array_reset(stroker->control_points); + + stroker_add_segment(stroker, VG_MOVE_TO_ABS, coords, 2); +} + +void stroker_line_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGfloat coords[] = {x, y}; + +#if STROKE_SEGMENTS + debug_printf("stroker_line_to(%f, %f)\n", x, y); +#endif + if (!stroker->segments->num_elements) + stroker_add_segment(stroker, VG_MOVE_TO_ABS, zero_coords, 2); + + stroker_add_segment(stroker, VG_LINE_TO_ABS, coords, 2); +} + +void stroker_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y) +{ + VGfloat coords[] = {px1, py1, + px2, py2, + x, y}; +#if STROKE_SEGMENTS + debug_printf("stroker_curve_to(%f, %f, %f, %f, %f, %f)\n", + px1, py1, px2, py2, x, y); +#endif + if (!stroker->segments->num_elements) + stroker_add_segment(stroker, VG_MOVE_TO_ABS, zero_coords, 2); + + stroker_add_segment(stroker, VG_CUBIC_TO_ABS, coords, 6); +} + +static INLINE VGboolean is_segment_null(VGPathCommand cmd, + VGfloat *coords, + VGfloat *res) +{ + switch(cmd) { + case VG_MOVE_TO_ABS: + case VG_LINE_TO_ABS: + return floatsEqual(coords[0], res[0]) && + floatsEqual(coords[1], res[1]); + break; + case VG_CUBIC_TO_ABS: + return floatsEqual(coords[0], res[0]) && + floatsEqual(coords[1], res[1]) && + floatsEqual(coords[2], res[0]) && + floatsEqual(coords[3], res[1]) && + floatsEqual(coords[4], res[0]) && + floatsEqual(coords[5], res[1]); + break; + default: + assert(0); + } + return VG_FALSE; +} + +static VGboolean vg_stroke_outline(struct stroke_iterator *it, + struct stroker *stroker, + VGboolean cap_first, + VGfloat *start_tangent) +{ + const int MAX_OFFSET = 16; + struct bezier offset_curves[MAX_OFFSET]; + VGPathCommand first_element; + VGfloat start[2], prev[2]; + VGboolean first = VG_TRUE; + VGfloat offset; + + first_element = stroke_itr_command(it); + if (first_element != VG_MOVE_TO_ABS) { + stroker_emit_move_to(stroker, 0.f, 0.f); + prev[0] = 0.f; + prev[1] = 0.f; + } + stroke_itr_coords(it, start); +#if STROKE_DEBUG + debug_printf(" -> (side) [%.2f, %.2f]\n", + start[0], + start[1]); +#endif + + prev[0] = start[0]; + prev[1] = start[1]; + + offset = stroker->stroke_width / 2; + + if (!it->has_next(it)) { + /* single point */ + + return VG_TRUE; + } + + while (it->has_next(it)) { + VGPathCommand cmd; + VGfloat coords[8]; + + it->next(it); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + + if (cmd == VG_LINE_TO_ABS) { + VGfloat line[4] = {prev[0], prev[1], coords[0], coords[1]}; + VGfloat normal[4]; + line_normal(line, normal); + +#if STROKE_DEBUG + debug_printf("\n ---> (side) lineto [%.2f, %.2f]\n", coords[0], coords[1]); +#endif + line_set_length(normal, offset); + line_translate(line, line_dx(normal), line_dy(normal)); + + /* if we are starting a new subpath, move to correct starting point */ + if (first) { + if (cap_first) + create_joins(stroker, prev[0], prev[1], line, + stroker_cap_mode(stroker)); + else + stroker_emit_move_to(stroker, line[0], line[1]); + memcpy(start_tangent, line, + sizeof(VGfloat) * 4); + first = VG_FALSE; + } else { + create_joins(stroker, prev[0], prev[1], line, + stroker_join_mode(stroker)); + } + + /* add the stroke for this line */ + stroker_emit_line_to(stroker, line[2], line[3]); + prev[0] = coords[0]; + prev[1] = coords[1]; + } else if (cmd == VG_CUBIC_TO_ABS) { +#if STROKE_DEBUG + debug_printf("\n ---> (side) cubicTo [%.2f, %.2f]\n", + coords[4], + coords[5]); +#endif + struct bezier bezier; + int count; + + bezier_init(&bezier, + prev[0], prev[1], coords[0], coords[1], + coords[2], coords[3], coords[4], coords[5]); + + count = bezier_translate_by_normal(&bezier, + offset_curves, + MAX_OFFSET, + offset, + curve_threshold); + + if (count) { + /* if we are starting a new subpath, move to correct starting point */ + VGfloat tangent[4]; + VGint i; + + bezier_start_tangent(&bezier, tangent); + line_translate(tangent, + offset_curves[0].x1 - bezier.x1, + offset_curves[0].y1 - bezier.y1); + if (first) { + VGfloat pt[2] = {offset_curves[0].x1, + offset_curves[0].y1}; + + if (cap_first) { + create_joins(stroker, prev[0], prev[1], tangent, + stroker_cap_mode(stroker)); + } else { + stroker_emit_move_to(stroker, pt[0], pt[1]); + } + start_tangent[0] = tangent[0]; + start_tangent[1] = tangent[1]; + start_tangent[2] = tangent[2]; + start_tangent[3] = tangent[3]; + first = VG_FALSE; + } else { + create_joins(stroker, prev[0], prev[1], tangent, + stroker_join_mode(stroker)); + } + + /* add these beziers */ + for (i = 0; i < count; ++i) { + struct bezier *bez = &offset_curves[i]; + stroker_emit_curve_to(stroker, + bez->x2, bez->y2, + bez->x3, bez->y3, + bez->x4, bez->y4); + } + } + + prev[0] = coords[4]; + prev[1] = coords[5]; + } + } + + if (floatsEqual(start[0], prev[0]) && + floatsEqual(start[1], prev[1])) { + /* closed subpath, join first and last point */ +#if STROKE_DEBUG + debug_printf("\n stroker: closed subpath\n"); +#endif + create_joins(stroker, prev[0], prev[1], start_tangent, + stroker_join_mode(stroker)); + return VG_TRUE; + } else { +#if STROKE_DEBUG + debug_printf("\n stroker: open subpath\n"); +#endif + return VG_FALSE; + } +} + +static void stroker_process_subpath(struct stroker *stroker) +{ + VGboolean fwclosed, bwclosed; + VGfloat fw_start_tangent[4], bw_start_tangent[4]; + struct stroke_iterator fwit; + struct stroke_iterator bwit; + debug_assert(stroker->segments->num_elements > 0); + + memset(fw_start_tangent, 0, + sizeof(VGfloat)*4); + memset(bw_start_tangent, 0, + sizeof(VGfloat)*4); + + stroke_forward_iterator(&fwit, stroker->segments, + stroker->control_points); + stroke_backward_iterator(&bwit, stroker->segments, + stroker->control_points); + + debug_assert(fwit.cmds[0] == VG_MOVE_TO_ABS); + + fwclosed = vg_stroke_outline(&fwit, stroker, VG_FALSE, fw_start_tangent); + bwclosed = vg_stroke_outline(&bwit, stroker, !fwclosed, bw_start_tangent); + + if (!bwclosed) + create_joins(stroker, + fwit.coords[0], fwit.coords[1], fw_start_tangent, + stroker_cap_mode(stroker)); + else { + /* hack to handle the requirement of the VG spec that says that strokes + * of len==0 that have butt cap or round cap still need + * to be rendered. (8.7.4 Stroke Generation) */ + if (stroker->segments->num_elements <= 3) { + VGPathCommand cmd; + VGfloat data[8], coords[8]; + struct stroke_iterator *it = &fwit; + + stroke_forward_iterator(it, stroker->segments, + stroker->control_points); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + if (cmd != VG_MOVE_TO_ABS) { + memset(data, 0, sizeof(VGfloat) * 8); + if (!is_segment_null(cmd, coords, data)) + return; + } else { + data[0] = coords[0]; + data[1] = coords[1]; + } + while (it->has_next(it)) { + it->next(it); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + if (!is_segment_null(cmd, coords, data)) + return; + } + /* generate the square/round cap */ + if (stroker->cap_style == VG_CAP_SQUARE) { + VGfloat offset = stroker->stroke_width / 2; + stroker_emit_move_to(stroker, data[0] - offset, + data[1] - offset); + stroker_emit_line_to(stroker, data[0] + offset, + data[1] - offset); + stroker_emit_line_to(stroker, data[0] + offset, + data[1] + offset); + stroker_emit_line_to(stroker, data[0] - offset, + data[1] + offset); + stroker_emit_line_to(stroker, data[0] - offset, + data[1] - offset); + } else if (stroker->cap_style == VG_CAP_ROUND) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat cx = data[0], cy = data[1]; + { /*circle */ + struct arc arc; + struct matrix matrix; + matrix_load_identity(&matrix); + + stroker_emit_move_to(stroker, cx + offset, cy); + arc_init(&arc, VG_SCCWARC_TO_ABS, + cx + offset, cy, + cx - offset, cy, + offset, offset, 0); + arc_stroker_emit(&arc, stroker, &matrix); + arc_init(&arc, VG_SCCWARC_TO_ABS, + cx - offset, cy, + cx + offset, cy, + offset, offset, 0); + arc_stroker_emit(&arc, stroker, &matrix); + } + } + } + } +} + +static INLINE VGfloat dash_pattern(struct dash_stroker *stroker, + VGint idx) +{ + if (stroker->dash_pattern[idx] < 0) + return 0.f; + return stroker->dash_pattern[idx]; +} + +static void dash_stroker_process_subpath(struct stroker *str) +{ + struct dash_stroker *stroker = (struct dash_stroker *)str; + VGfloat sum_length = 0; + VGint i; + VGint idash = 0; + VGfloat pos = 0; + VGfloat elen = 0; + VGfloat doffset = stroker->dash_phase; + VGfloat estart = 0; + VGfloat estop = 0; + VGfloat cline[4]; + struct stroke_iterator it; + VGfloat prev[2]; + VGfloat move_to_pos[2]; + VGfloat line_to_pos[2]; + + VGboolean has_move_to = VG_FALSE; + + stroke_flat_iterator(&it, stroker->base.segments, + stroker->base.control_points); + + stroke_itr_coords(&it, prev); + move_to_pos[0] = prev[0]; + move_to_pos[1] = prev[1]; + + debug_assert(stroker->dash_pattern_num > 0); + + for (i = 0; i < stroker->dash_pattern_num; ++i) { + sum_length += dash_pattern(stroker, i); + } + + if (floatIsZero(sum_length)) { + return; + } + + doffset -= floorf(doffset / sum_length) * sum_length; + + while (!floatIsZero(doffset) && doffset >= dash_pattern(stroker, idash)) { + doffset -= dash_pattern(stroker, idash); + idash = (idash + 1) % stroker->dash_pattern_num; + } + + while (it.has_next(&it)) { + VGPathCommand cmd; + VGfloat coords[8]; + VGboolean done; + + it.next(&it); + cmd = stroke_itr_command(&it); + stroke_itr_coords(&it, coords); + + debug_assert(cmd == VG_LINE_TO_ABS); + cline[0] = prev[0]; + cline[1] = prev[1]; + cline[2] = coords[0]; + cline[3] = coords[1]; + + elen = line_lengthv(cline); + + estop = estart + elen; + + done = pos >= estop; + while (!done) { + VGfloat p2[2]; + + VGint idash_incr = 0; + VGboolean has_offset = doffset > 0; + VGfloat dpos = pos + dash_pattern(stroker, idash) - doffset - estart; + + debug_assert(dpos >= 0); + + if (dpos > elen) { /* dash extends this line */ + doffset = dash_pattern(stroker, idash) - (dpos - elen); + pos = estop; + done = VG_TRUE; + p2[0] = cline[2]; + p2[1] = cline[3]; + } else { /* Dash is on this line */ + line_point_at(cline, dpos/elen, p2); + pos = dpos + estart; + done = pos >= estop; + idash_incr = 1; + doffset = 0; + } + + if (idash % 2 == 0) { + line_to_pos[0] = p2[0]; + line_to_pos[1] = p2[1]; + + if (!has_offset || !has_move_to) { + stroker_move_to(&stroker->stroker, move_to_pos[0], move_to_pos[1]); + has_move_to = VG_TRUE; + } + stroker_line_to(&stroker->stroker, line_to_pos[0], line_to_pos[1]); + } else { + move_to_pos[0] = p2[0]; + move_to_pos[1] = p2[1]; + } + + idash = (idash + idash_incr) % stroker->dash_pattern_num; + } + + estart = estop; + prev[0] = coords[0]; + prev[1] = coords[1]; + } + + if (it.curve_poly) { + polygon_destroy(it.curve_poly); + it.curve_poly = 0; + } + + stroker->base.path = stroker->stroker.path; +} + +static void default_begin(struct stroker *stroker) +{ + array_reset(stroker->segments); + array_reset(stroker->control_points); +} + +static void default_end(struct stroker *stroker) +{ + if (stroker->segments->num_elements > 0) + stroker->process_subpath(stroker); +} + + +static void dash_stroker_begin(struct stroker *stroker) +{ + struct dash_stroker *dasher = + (struct dash_stroker *)stroker; + + default_begin(&dasher->stroker); + default_begin(stroker); +} + +static void dash_stroker_end(struct stroker *stroker) +{ + struct dash_stroker *dasher = + (struct dash_stroker *)stroker; + + default_end(stroker); + default_end(&dasher->stroker); +} + +void stroker_init(struct stroker *stroker, + struct vg_state *state) +{ + stroker->stroke_width = state->stroke.line_width.f; + stroker->miter_limit = state->stroke.miter_limit.f; + stroker->cap_style = state->stroke.cap_style; + stroker->join_style = state->stroke.join_style; + + stroker->begin = default_begin; + stroker->process_subpath = stroker_process_subpath; + stroker->end = default_end; + + stroker->segments = array_create(sizeof(VGubyte)); + stroker->control_points = array_create(sizeof(VGfloat)); + + stroker->back1_x = 0; + stroker->back1_y = 0; + stroker->back2_x = 0; + stroker->back2_y = 0; + + stroker->path = path_create(VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, VG_PATH_CAPABILITY_ALL); + + stroker->last_cmd = VG_CLOSE_PATH; +} + +void dash_stroker_init(struct stroker *str, + struct vg_state *state) +{ + struct dash_stroker *stroker = (struct dash_stroker *)str; + int i; + + stroker_init(str, state); + stroker_init(&stroker->stroker, state); + + { + int real_num = state->stroke.dash_pattern_num; + if (real_num % 2)/* if odd, ignore the last one */ + --real_num; + for (i = 0; i < real_num; ++i) + stroker->dash_pattern[i] = state->stroke.dash_pattern[i].f; + stroker->dash_pattern_num = real_num; + } + + stroker->dash_phase = state->stroke.dash_phase.f; + stroker->dash_phase_reset = state->stroke.dash_phase_reset; + + stroker->base.begin = dash_stroker_begin; + stroker->base.process_subpath = dash_stroker_process_subpath; + stroker->base.end = dash_stroker_end; + path_destroy(stroker->base.path); + stroker->base.path = NULL; +} + +void stroker_begin(struct stroker *stroker) +{ + stroker->begin(stroker); +} + +void stroker_end(struct stroker *stroker) +{ + stroker->end(stroker); +} + +void stroker_cleanup(struct stroker *stroker) +{ + array_destroy(stroker->segments); + array_destroy(stroker->control_points); +} + +void dash_stroker_cleanup(struct dash_stroker *stroker) +{ + /* if stroker->base.path is null means we never + * processed a valid path so delete the temp one + * we already created */ + if (!stroker->base.path) + path_destroy(stroker->stroker.path); + stroker_cleanup(&stroker->stroker); + stroker_cleanup((struct stroker*)stroker); +} diff --git a/src/gallium/state_trackers/vega/stroker.h b/src/gallium/state_trackers/vega/stroker.h new file mode 100644 index 0000000000..36543cd923 --- /dev/null +++ b/src/gallium/state_trackers/vega/stroker.h @@ -0,0 +1,89 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef STROKER_H +#define STROKER_H + +#include "VG/openvg.h" +#include "api_consts.h" + +struct path; +struct vg_state; +struct array; + +struct stroker { + void (*begin)(struct stroker *stroker); + void (*process_subpath)(struct stroker *stroker); + void (*end)(struct stroker *stroker); + + struct array *segments; + struct array *control_points; + struct path *path; + + VGfloat back1_x, back1_y; + VGfloat back2_x, back2_y; + + VGfloat stroke_width; + VGfloat miter_limit; + VGCapStyle cap_style; + VGJoinStyle join_style; + + VGPathCommand last_cmd; +}; + +struct dash_stroker { + struct stroker base; + + struct stroker stroker; + + VGfloat dash_pattern[VEGA_MAX_DASH_COUNT]; + VGint dash_pattern_num; + VGfloat dash_phase; + VGboolean dash_phase_reset; +}; + +void stroker_init(struct stroker *stroker, + struct vg_state *state); +void dash_stroker_init(struct stroker *stroker, + struct vg_state *state); +void dash_stroker_cleanup(struct dash_stroker *stroker); +void stroker_cleanup(struct stroker *stroker); + +void stroker_begin(struct stroker *stroker); +void stroker_move_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_line_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y); +void stroker_end(struct stroker *stroker); + +void stroker_emit_move_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_emit_line_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_emit_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y); + +#endif diff --git a/src/gallium/state_trackers/vega/util_array.h b/src/gallium/state_trackers/vega/util_array.h new file mode 100644 index 0000000000..4343dfe36e --- /dev/null +++ b/src/gallium/state_trackers/vega/util_array.h @@ -0,0 +1,122 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef UTIL_ARRAY_H +#define UTIL_ARRAY_H + +#include "util/u_memory.h" + +#define DEFAULT_ARRAY_SIZE 256 + +struct array { + VGint datatype_size; + void *data; + VGint size; + VGint num_elements; +}; + +static INLINE struct array *array_create(VGint datatype_size) +{ + struct array *array = CALLOC_STRUCT(array); + array->datatype_size = datatype_size; + + array->size = DEFAULT_ARRAY_SIZE; + array->data = malloc(array->size * array->datatype_size); + + return array; +} + + +static INLINE struct array *array_create_size(VGint datatype_size, VGint size) +{ + struct array *array = CALLOC_STRUCT(array); + array->datatype_size = datatype_size; + + array->size = size; + array->data = malloc(array->size * array->datatype_size); + + return array; +} + +static INLINE void array_destroy(struct array *array) +{ + if (array) + free(array->data); + free(array); +} + +static INLINE void array_resize(struct array *array, int num) +{ + VGint size = array->datatype_size * num; + void *data = malloc(size); + memcpy(data, array->data, array->size * array->datatype_size); + free(array->data); + array->data = data; + array->size = num; + array->num_elements = (array->num_elements > num) ? num : + array->num_elements; +} + +static INLINE void array_append_data(struct array *array, + const void *data, int num_elements) +{ + VGbyte *adata; + + while (array->num_elements + num_elements > array->size) { + array_resize(array, (array->num_elements + num_elements) * 1.5); + } + adata = (VGbyte *)array->data; + memcpy(adata + (array->num_elements * array->datatype_size), data, + num_elements * array->datatype_size); + array->num_elements += num_elements; +} + +static INLINE void array_change_data(struct array *array, + const void *data, + int start_idx, + int num_elements) +{ + VGbyte *adata = (VGbyte *)array->data; + memcpy(adata + (start_idx * array->datatype_size), data, + num_elements * array->datatype_size); +} + +static INLINE void array_remove_element(struct array *array, + int idx) +{ + VGbyte *adata = (VGbyte *)array->data; + memmove(adata + (idx * array->datatype_size), + adata + ((idx + 1) * array->datatype_size), + (array->num_elements - idx - 1) * array->datatype_size); + --array->num_elements; +} + +static INLINE void array_reset(struct array *array) +{ + array->num_elements = 0; +} + +#endif diff --git a/src/gallium/state_trackers/vega/vg_context.c b/src/gallium/state_trackers/vega/vg_context.c new file mode 100644 index 0000000000..e0ff02f3a9 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_context.c @@ -0,0 +1,543 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_context.h" + +#include "paint.h" +#include "renderer.h" +#include "shaders_cache.h" +#include "shader.h" +#include "asm_util.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/p_shader_tokens.h" + +#include "cso_cache/cso_context.h" + +#include "util/u_simple_shaders.h" +#include "util/u_memory.h" +#include "util/u_blit.h" + +struct vg_context *_vg_context = 0; + +struct vg_context * vg_current_context(void) +{ + return _vg_context; +} + +static void init_clear(struct vg_context *st) +{ + struct pipe_context *pipe = st->pipe; + + /* rasterizer state: bypass clipping */ + memset(&st->clear.raster, 0, sizeof(st->clear.raster)); + st->clear.raster.gl_rasterization_rules = 1; + + /* fragment shader state: color pass-through program */ + st->clear.fs = + util_make_fragment_passthrough_shader(pipe); +} +void vg_set_current_context(struct vg_context *ctx) +{ + _vg_context = ctx; +} + +struct vg_context * vg_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share) +{ + struct vg_context *ctx; + + ctx = CALLOC_STRUCT(vg_context); + + ctx->pipe = pipe; + + vg_init_state(&ctx->state.vg); + ctx->state.dirty = ALL_DIRTY; + + ctx->cso_context = cso_create_context(pipe); + + init_clear(ctx); + + ctx->default_paint = paint_create(ctx); + ctx->state.vg.stroke_paint = ctx->default_paint; + ctx->state.vg.fill_paint = ctx->default_paint; + + + ctx->mask.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->mask.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->mask.sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + ctx->mask.sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->mask.sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->mask.sampler.normalized_coords = 0; + + ctx->blend_sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->blend_sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->blend_sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + ctx->blend_sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->blend_sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->blend_sampler.normalized_coords = 0; + + vg_set_error(ctx, VG_NO_ERROR); + + ctx->owned_objects[VG_OBJECT_PAINT] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_IMAGE] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_MASK] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_FONT] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_PATH] = cso_hash_create(); + + ctx->renderer = renderer_create(ctx); + ctx->sc = shaders_cache_create(ctx); + ctx->shader = shader_create(ctx); + + ctx->blit = util_create_blit(ctx->pipe, ctx->cso_context); + + return ctx; +} + +void vg_destroy_context(struct vg_context *ctx) +{ + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + struct pipe_constant_buffer *vsbuf = &ctx->vs_const_buffer; + + util_destroy_blit(ctx->blit); + renderer_destroy(ctx->renderer); + shaders_cache_destroy(ctx->sc); + shader_destroy(ctx->shader); + paint_destroy(ctx->default_paint); + + if (cbuf && cbuf->buffer) + pipe_buffer_reference(&cbuf->buffer, NULL); + + if (vsbuf && vsbuf->buffer) + pipe_buffer_reference(&vsbuf->buffer, NULL); + + if (ctx->clear.fs) { + cso_delete_fragment_shader(ctx->cso_context, ctx->clear.fs); + ctx->clear.fs = NULL; + } + + if (ctx->plain_vs) { + vg_shader_destroy(ctx, ctx->plain_vs); + ctx->plain_vs = NULL; + } + if (ctx->clear_vs) { + vg_shader_destroy(ctx, ctx->clear_vs); + ctx->clear_vs = NULL; + } + if (ctx->texture_vs) { + vg_shader_destroy(ctx, ctx->texture_vs); + ctx->texture_vs = NULL; + } + + if (ctx->pass_through_depth_fs) + vg_shader_destroy(ctx, ctx->pass_through_depth_fs); + if (ctx->mask.union_fs) + vg_shader_destroy(ctx, ctx->mask.union_fs); + if (ctx->mask.intersect_fs) + vg_shader_destroy(ctx, ctx->mask.intersect_fs); + if (ctx->mask.subtract_fs) + vg_shader_destroy(ctx, ctx->mask.subtract_fs); + if (ctx->mask.set_fs) + vg_shader_destroy(ctx, ctx->mask.set_fs); + + cso_release_all(ctx->cso_context); + cso_destroy_context(ctx->cso_context); + + cso_hash_delete(ctx->owned_objects[VG_OBJECT_PAINT]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_IMAGE]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_MASK]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_FONT]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_PATH]); + + free(ctx); +} + +void vg_init_object(struct vg_object *obj, struct vg_context *ctx, enum vg_object_type type) +{ + obj->type = type; + obj->ctx = ctx; +} + +VGboolean vg_context_is_object_valid(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return VG_FALSE; + return cso_hash_contains(hash, (unsigned)(long)ptr); + } + return VG_FALSE; +} + +void vg_context_add_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return; + cso_hash_insert(hash, (unsigned)(long)ptr, ptr); + } +} + +void vg_context_remove_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return; + cso_hash_take(hash, (unsigned)(long)ptr); + } +} + +static void update_clip_state(struct vg_context *ctx) +{ + struct pipe_depth_stencil_alpha_state *dsa = &ctx->state.g3d.dsa; + struct vg_state *state = &ctx->state.vg; + + memset(dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + if (state->scissoring) { + struct pipe_blend_state *blend = &ctx->state.g3d.blend; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + dsa->depth.writemask = 1;/*glDepthMask(TRUE);*/ + dsa->depth.func = PIPE_FUNC_ALWAYS; + dsa->depth.enabled = 1; + + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + /* set a passthrough shader */ + if (!ctx->pass_through_depth_fs) + ctx->pass_through_depth_fs = shader_create_from_text(ctx->pipe, + pass_through_depth_asm, + 40, + PIPE_SHADER_FRAGMENT); + cso_set_fragment_shader_handle(ctx->cso_context, + ctx->pass_through_depth_fs->driver); + cso_set_depth_stencil_alpha(ctx->cso_context, dsa); + + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_DEPTHSTENCIL, NULL, 1.0, 0); + + /* disable color writes */ + blend->colormask = 0; /*disable colorwrites*/ + cso_set_blend(ctx->cso_context, blend); + + /* enable scissoring */ + for (int i = 0; i < state->scissor_rects_num; ++i) { + const float x = state->scissor_rects[i * 4 + 0].f; + const float y = state->scissor_rects[i * 4 + 1].f; + const float width = state->scissor_rects[i * 4 + 2].f; + const float height = state->scissor_rects[i * 4 + 3].f; + VGfloat minx, miny, maxx, maxy; + + minx = 0; + miny = 0; + maxx = fb->width; + maxy = fb->height; + + if (x > minx) + minx = x; + if (y > miny) + miny = y; + + if (x + width < maxx) + maxx = x + width; + if (y + height < maxy) + maxy = y + height; + + /* check for null space */ + if (minx >= maxx || miny >= maxy) + minx = miny = maxx = maxy = 0; + + /*glClear(GL_DEPTH_BUFFER_BIT);*/ + renderer_draw_quad(ctx->renderer, minx, miny, maxx, maxy, 0.0f); + } + + blend->colormask = 1; /*enable colorwrites*/ + cso_restore_blend(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + + dsa->depth.enabled = 1; /* glEnable(GL_DEPTH_TEST); */ + dsa->depth.writemask = 0;/*glDepthMask(FALSE);*/ + dsa->depth.func = PIPE_FUNC_GEQUAL; + } +} + +void vg_validate_state(struct vg_context *ctx) +{ + if ((ctx->state.dirty & BLEND_DIRTY)) { + struct pipe_blend_state *blend = &ctx->state.g3d.blend; + memset(blend, 0, sizeof(struct pipe_blend_state)); + blend->blend_enable = 1; + blend->colormask |= PIPE_MASK_R; + blend->colormask |= PIPE_MASK_G; + blend->colormask |= PIPE_MASK_B; + blend->colormask |= PIPE_MASK_A; + + switch (ctx->state.vg.blend_mode) { + case VG_BLEND_SRC: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_SRC_OVER: + blend->rgb_src_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + break; + case VG_BLEND_DST_OVER: + blend->rgb_src_factor = PIPE_BLENDFACTOR_INV_DST_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_INV_DST_ALPHA; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_DST_ALPHA; + break; + case VG_BLEND_SRC_IN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_DST_IN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ZERO; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + break; + case VG_BLEND_MULTIPLY: + case VG_BLEND_SCREEN: + case VG_BLEND_DARKEN: + case VG_BLEND_LIGHTEN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_ADDITIVE: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ONE; + break; + default: + assert(!"not implemented blend mode"); + } + cso_set_blend(ctx->cso_context, &ctx->state.g3d.blend); + } + if ((ctx->state.dirty & RASTERIZER_DIRTY)) { + struct pipe_rasterizer_state *raster = &ctx->state.g3d.rasterizer; + memset(raster, 0, sizeof(struct pipe_rasterizer_state)); + raster->gl_rasterization_rules = 1; + cso_set_rasterizer(ctx->cso_context, &ctx->state.g3d.rasterizer); + } + if ((ctx->state.dirty & VIEWPORT_DIRTY)) { + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + const VGint param_bytes = 8 * sizeof(VGfloat); + VGfloat vs_consts[8] = { + 2.f/fb->width, 2.f/fb->height, 1, 1, + -1, -1, 0, 0 + }; + struct pipe_constant_buffer *cbuf = &ctx->vs_const_buffer; + + vg_set_viewport(ctx, VEGA_Y0_BOTTOM); + + pipe_buffer_reference(&cbuf->buffer, NULL); + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 16, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, vs_consts); + } + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_VERTEX, 0, cbuf); + } + if ((ctx->state.dirty & VS_DIRTY)) { + cso_set_vertex_shader_handle(ctx->cso_context, + vg_plain_vs(ctx)); + } + + /* must be last because it renders to the depth buffer*/ + if ((ctx->state.dirty & DEPTH_STENCIL_DIRTY)) { + update_clip_state(ctx); + cso_set_depth_stencil_alpha(ctx->cso_context, &ctx->state.g3d.dsa); + } + + shader_set_masking(ctx->shader, ctx->state.vg.masking); + shader_set_image_mode(ctx->shader, ctx->state.vg.image_mode); + + ctx->state.dirty = NONE_DIRTY; +} + +VGboolean vg_object_is_valid(void *ptr, enum vg_object_type type) +{ + struct vg_object *obj = ptr; + if (ptr && is_aligned(obj) && obj->type == type) + return VG_TRUE; + else + return VG_FALSE; +} + +void vg_set_error(struct vg_context *ctx, + VGErrorCode code) +{ + /*vgGetError returns the oldest error code provided by + * an API call on the current context since the previous + * call to vgGetError on that context (or since the creation + of the context).*/ + if (ctx->_error == VG_NO_ERROR) + ctx->_error = code; +} + +void vg_prepare_blend_surface(struct vg_context *ctx) +{ + struct pipe_surface *dest_surface = NULL; + struct pipe_context *pipe = ctx->pipe; + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + + /* first finish all pending rendering */ + vgFinish(); + + dest_surface = pipe->screen->get_tex_surface(pipe->screen, + stfb->blend_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + /* flip it, because we want to use it as a sampler */ + util_blit_pixels_tex(ctx->blit, + strb->texture, + 0, strb->height, + strb->width, 0, + dest_surface, + 0, 0, + strb->width, strb->height, + 0.0, PIPE_TEX_MIPFILTER_NEAREST); + + if (dest_surface) + pipe_surface_reference(&dest_surface, NULL); + + /* make sure it's complete */ + vgFinish(); +} + + +void vg_prepare_blend_surface_from_mask(struct vg_context *ctx) +{ + struct pipe_surface *dest_surface = NULL; + struct pipe_context *pipe = ctx->pipe; + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + + vg_validate_state(ctx); + + /* first finish all pending rendering */ + vgFinish(); + + dest_surface = pipe->screen->get_tex_surface(pipe->screen, + stfb->blend_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* flip it, because we want to use it as a sampler */ + util_blit_pixels_tex(ctx->blit, + stfb->alpha_mask, + 0, strb->height, + strb->width, 0, + dest_surface, + 0, 0, + strb->width, strb->height, + 0.0, PIPE_TEX_MIPFILTER_NEAREST); + + /* make sure it's complete */ + vgFinish(); + + if (dest_surface) + pipe_surface_reference(&dest_surface, NULL); +} + +void * vg_plain_vs(struct vg_context *ctx) +{ + if (!ctx->plain_vs) { + ctx->plain_vs = shader_create_from_text(ctx->pipe, + vs_plain_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->plain_vs->driver; +} + + +void * vg_clear_vs(struct vg_context *ctx) +{ + if (!ctx->clear_vs) { + ctx->clear_vs = shader_create_from_text(ctx->pipe, + vs_clear_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->clear_vs->driver; +} + +void * vg_texture_vs(struct vg_context *ctx) +{ + if (!ctx->texture_vs) { + ctx->texture_vs = shader_create_from_text(ctx->pipe, + vs_texture_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->texture_vs->driver; +} + +void vg_set_viewport(struct vg_context *ctx, VegaOrientation orientation) +{ + struct pipe_viewport_state viewport; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + VGfloat y_scale = (orientation == VEGA_Y0_BOTTOM) ? -2.f : 2.f; + + viewport.scale[0] = fb->width / 2.f; + viewport.scale[1] = fb->height / y_scale; + viewport.scale[2] = 1.0; + viewport.scale[3] = 1.0; + viewport.translate[0] = fb->width / 2.f; + viewport.translate[1] = fb->height / 2.f; + viewport.translate[2] = 0.0; + viewport.translate[3] = 0.0; + + cso_set_viewport(ctx->cso_context, &viewport); +} diff --git a/src/gallium/state_trackers/vega/vg_context.h b/src/gallium/state_trackers/vega/vg_context.h new file mode 100644 index 0000000000..ccc8889c8c --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_context.h @@ -0,0 +1,292 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_CONTEXT_H +#define VG_CONTEXT_H + +#include "vg_state.h" + +#include "pipe/p_format.h" +#include "pipe/p_state.h" +#include "util/u_pointer.h" +#include "util/u_math.h" + +#include "cso_cache/cso_hash.h" +#include "cso_cache/cso_context.h" + +struct renderer; +struct shaders_cache; +struct shader; +struct vg_shader; + +struct st_renderbuffer { + enum pipe_format format; + struct pipe_surface *surface; + struct pipe_texture *texture; + VGint width, height; +}; + +struct st_framebuffer { + VGint init_width, init_height; + struct st_renderbuffer *strb; + struct st_renderbuffer *dsrb; + + struct pipe_texture *alpha_mask; + + struct pipe_texture *blend_texture; + + void *privateData; +}; + +enum vg_object_type { + VG_OBJECT_UNKNOWN = 0, + VG_OBJECT_PAINT, + VG_OBJECT_IMAGE, + VG_OBJECT_MASK, + VG_OBJECT_FONT, + VG_OBJECT_PATH, + + VG_OBJECT_LAST +}; +enum dirty_state { + NONE_DIRTY = 0<<0, + BLEND_DIRTY = 1<<1, + RASTERIZER_DIRTY = 1<<2, + VIEWPORT_DIRTY = 1<<3, + VS_DIRTY = 1<<4, + DEPTH_STENCIL_DIRTY = 1<<5, + ALL_DIRTY = BLEND_DIRTY | RASTERIZER_DIRTY | + VIEWPORT_DIRTY | VS_DIRTY | DEPTH_STENCIL_DIRTY +}; + +struct vg_context +{ + struct pipe_context *pipe; + + struct { + struct vg_state vg; + struct { + struct pipe_blend_state blend; + struct pipe_rasterizer_state rasterizer; + struct pipe_shader_state vs_state; + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_framebuffer_state fb; + } g3d; + VGbitfield dirty; + } state; + + VGErrorCode _error; + + struct st_framebuffer *draw_buffer; + + struct cso_hash *owned_objects[VG_OBJECT_LAST]; + + struct { + struct pipe_shader_state vert_shader; + struct pipe_shader_state frag_shader; + struct pipe_rasterizer_state raster; + void *fs; + float vertices[4][2][4]; /**< vertex pos + color */ + } clear; + + struct { + struct pipe_constant_buffer cbuf; + struct pipe_sampler_state sampler; + + struct vg_shader *union_fs; + struct vg_shader *intersect_fs; + struct vg_shader *subtract_fs; + struct vg_shader *set_fs; + } mask; + + struct vg_shader *pass_through_depth_fs; + + struct cso_context *cso_context; + + struct pipe_buffer *stencil_quad; + VGfloat stencil_vertices[4][2][4]; + + struct renderer *renderer; + struct shaders_cache *sc; + struct shader *shader; + + struct pipe_sampler_state blend_sampler; + struct { + struct pipe_constant_buffer buffer; + void *color_matrix_fs; + } filter; + struct vg_paint *default_paint; + + struct blit_state *blit; + + struct vg_shader *plain_vs; + struct vg_shader *clear_vs; + struct vg_shader *texture_vs; + struct pipe_constant_buffer vs_const_buffer; +}; + +struct vg_object { + enum vg_object_type type; + struct vg_context *ctx; +}; +void vg_init_object(struct vg_object *obj, struct vg_context *ctx, enum vg_object_type type); +VGboolean vg_object_is_valid(void *ptr, enum vg_object_type type); + +struct vg_context *vg_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share); +void vg_destroy_context(struct vg_context *ctx); +struct vg_context *vg_current_context(void); +void vg_set_current_context(struct vg_context *ctx); + +VGboolean vg_context_is_object_valid(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); +void vg_context_add_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); +void vg_context_remove_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); + +void vg_validate_state(struct vg_context *ctx); + +void vg_set_error(struct vg_context *ctx, + VGErrorCode code); + +void vg_prepare_blend_surface(struct vg_context *ctx); +void vg_prepare_blend_surface_from_mask(struct vg_context *ctx); + + +static INLINE VGboolean is_aligned_to(const void *ptr, VGbyte alignment) +{ + void *aligned = align_pointer(ptr, alignment); + return (ptr == aligned) ? VG_TRUE : VG_FALSE; +} + +static INLINE VGboolean is_aligned(const void *ptr) +{ + return is_aligned_to(ptr, 4); +} + +static INLINE void vg_shift_rectx(VGfloat coords[4], + const VGfloat *bounds, + const VGfloat shift) +{ + coords[0] += shift; + coords[2] -= shift; + if (bounds) { + coords[2] = MIN2(coords[2], bounds[2]); + /* bound x/y + width/height */ + if ((coords[0] + coords[2]) > (bounds[0] + bounds[2])) { + coords[2] = (bounds[0] + bounds[2]) - coords[0]; + } + } +} + +static INLINE void vg_shift_recty(VGfloat coords[4], + const VGfloat *bounds, + const VGfloat shift) +{ + coords[1] += shift; + coords[3] -= shift; + if (bounds) { + coords[3] = MIN2(coords[3], bounds[3]); + if ((coords[1] + coords[3]) > (bounds[1] + bounds[3])) { + coords[3] = (bounds[1] + bounds[3]) - coords[1]; + } + } +} + +static INLINE void vg_bound_rect(VGfloat coords[4], + const VGfloat bounds[4], + VGfloat shift[4]) +{ + /* if outside the bounds */ + if (coords[0] > (bounds[0] + bounds[2]) || + coords[1] > (bounds[1] + bounds[3]) || + (coords[0] + coords[2]) < bounds[0] || + (coords[1] + coords[3]) < bounds[1]) { + coords[0] = 0.f; + coords[1] = 0.f; + coords[2] = 0.f; + coords[3] = 0.f; + shift[0] = 0.f; + shift[1] = 0.f; + return; + } + + /* bound x */ + if (coords[0] < bounds[0]) { + shift[0] = bounds[0] - coords[0]; + coords[2] -= shift[0]; + coords[0] = bounds[0]; + } else + shift[0] = 0.f; + + /* bound y */ + if (coords[1] < bounds[1]) { + shift[1] = bounds[1] - coords[1]; + coords[3] -= shift[1]; + coords[1] = bounds[1]; + } else + shift[1] = 0.f; + + shift[2] = bounds[2] - coords[2]; + shift[3] = bounds[3] - coords[3]; + /* bound width/height */ + coords[2] = MIN2(coords[2], bounds[2]); + coords[3] = MIN2(coords[3], bounds[3]); + + /* bound x/y + width/height */ + if ((coords[0] + coords[2]) > (bounds[0] + bounds[2])) { + coords[2] = (bounds[0] + bounds[2]) - coords[0]; + } + if ((coords[1] + coords[3]) > (bounds[1] + bounds[3])) { + coords[3] = (bounds[1] + bounds[3]) - coords[1]; + } + + /* if outside the bounds */ + if ((coords[0] + coords[2]) < bounds[0] || + (coords[1] + coords[3]) < bounds[1]) { + coords[0] = 0.f; + coords[1] = 0.f; + coords[2] = 0.f; + coords[3] = 0.f; + return; + } +} + +void *vg_plain_vs(struct vg_context *ctx); +void *vg_clear_vs(struct vg_context *ctx); +void *vg_texture_vs(struct vg_context *ctx); +typedef enum { + VEGA_Y0_TOP, + VEGA_Y0_BOTTOM +} VegaOrientation; +void vg_set_viewport(struct vg_context *ctx, VegaOrientation orientation); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_state.c b/src/gallium/state_trackers/vega/vg_state.c new file mode 100644 index 0000000000..6f6bfdaf7a --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_state.c @@ -0,0 +1,124 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_state.h" + +#include + +void vg_init_state(struct vg_state *state) +{ + state->matrix_mode = VG_MATRIX_PATH_USER_TO_SURFACE; + state->fill_rule = VG_EVEN_ODD; + state->image_quality = VG_IMAGE_QUALITY_FASTER; + state->rendering_quality = VG_RENDERING_QUALITY_BETTER; + state->blend_mode = VG_BLEND_SRC_OVER; + state->image_mode = VG_DRAW_IMAGE_NORMAL; + + memset(state->scissor_rects, 0, sizeof(state->scissor_rects)); + state->scissor_rects_num = 0; + + state->color_transform = VG_FALSE; + state->color_transform_values[0] = 1.0f; + state->color_transform_values[1] = 1.0f; + state->color_transform_values[2] = 1.0f; + state->color_transform_values[3] = 1.0f; + state->color_transform_values[4] = 0.0f; + state->color_transform_values[5] = 0.0f; + state->color_transform_values[6] = 0.0f; + state->color_transform_values[7] = 0.0f; + + /* Stroke parameters */ + state->stroke.line_width.f = 1.0f; + state->stroke.line_width.i = 1; + state->stroke.cap_style = VG_CAP_BUTT; + state->stroke.join_style = VG_JOIN_MITER; + state->stroke.miter_limit.f = 4.0f; + state->stroke.miter_limit.i = 4; + state->stroke.dash_pattern_num = 0; + state->stroke.dash_phase.f = 0.0f; + state->stroke.dash_phase.i = 0; + state->stroke.dash_phase_reset = VG_FALSE; + + /* Edge fill color for VG_TILE_FILL tiling mode */ + state->tile_fill_color[0] = 0.0f; + state->tile_fill_color[1] = 0.0f; + state->tile_fill_color[2] = 0.0f; + state->tile_fill_color[3] = 0.0f; + + /* Color for vgClear */ + state->clear_color[0] = 0.0f; + state->clear_color[1] = 0.0f; + state->clear_color[2] = 0.0f; + state->clear_color[3] = 0.0f; + + /* Glyph origin */ + state->glyph_origin[0].f = 0.0f; + state->glyph_origin[1].f = 0.0f; + state->glyph_origin[0].i = 0; + state->glyph_origin[1].i = 0; + + /* Enable/disable alpha masking and scissoring */ + state->masking = VG_FALSE; + state->scissoring = VG_FALSE; + + /* Pixel layout information */ + state->pixel_layout = VG_PIXEL_LAYOUT_UNKNOWN; + state->screen_layout = VG_PIXEL_LAYOUT_UNKNOWN; + + /* Source format selection for image filters */ + state->filter_format_linear = VG_FALSE; + state->filter_format_premultiplied = VG_FALSE; + + /* Destination write enable mask for image filters */ + state->filter_channel_mask = (VG_RED | VG_GREEN | VG_BLUE | VG_ALPHA); + + matrix_load_identity(&state->path_user_to_surface_matrix); + matrix_load_identity(&state->image_user_to_surface_matrix); + matrix_load_identity(&state->fill_paint_to_user_matrix); + matrix_load_identity(&state->stroke_paint_to_user_matrix); + matrix_load_identity(&state->glyph_user_to_surface_matrix); +} + +struct matrix *vg_state_matrix(struct vg_state *state) +{ + switch(state->matrix_mode) { + case VG_MATRIX_PATH_USER_TO_SURFACE: + return &state->path_user_to_surface_matrix; + case VG_MATRIX_IMAGE_USER_TO_SURFACE: + return &state->image_user_to_surface_matrix; + case VG_MATRIX_FILL_PAINT_TO_USER: + return &state->fill_paint_to_user_matrix; + case VG_MATRIX_STROKE_PAINT_TO_USER: + return &state->stroke_paint_to_user_matrix; +#ifdef OPENVG_VERSION_1_1 + case VG_MATRIX_GLYPH_USER_TO_SURFACE: + return &state->glyph_user_to_surface_matrix; +#endif + default: + break; + } + return NULL; +} diff --git a/src/gallium/state_trackers/vega/vg_state.h b/src/gallium/state_trackers/vega/vg_state.h new file mode 100644 index 0000000000..ed90689f91 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_state.h @@ -0,0 +1,109 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_STATE_H +#define VG_STATE_H + +#include "VG/openvg.h" + +#include "api_consts.h" +#include "matrix.h" + +struct vg_value +{ + VGfloat f; + VGint i; +}; + +struct vg_state { + /* Mode settings */ + VGMatrixMode matrix_mode; + VGFillRule fill_rule; + VGImageQuality image_quality; + VGRenderingQuality rendering_quality; + VGBlendMode blend_mode; + VGImageMode image_mode; + + /* Scissoring rectangles */ + struct vg_value scissor_rects[32*4]; + VGint scissor_rects_num; + + /* Color Transformation */ + VGboolean color_transform; + VGfloat color_transform_values[8]; + + /* Stroke parameters */ + struct { + struct vg_value line_width; + VGCapStyle cap_style; + VGJoinStyle join_style; + struct vg_value miter_limit; + struct vg_value dash_pattern[VEGA_MAX_DASH_COUNT]; + VGint dash_pattern_num; + struct vg_value dash_phase; + VGboolean dash_phase_reset; + } stroke; + + /* Edge fill color for VG_TILE_FILL tiling mode */ + VGfloat tile_fill_color[4]; + VGint tile_fill_colori[4]; + + /* Color for vgClear */ + VGfloat clear_color[4]; + VGint clear_colori[4]; + + /* Glyph origin */ + struct vg_value glyph_origin[2]; + + /* Enable/disable alpha masking and scissoring */ + VGboolean masking; + VGboolean scissoring; + + /* Pixel layout information */ + VGPixelLayout pixel_layout; + VGPixelLayout screen_layout; + + /* Source format selection for image filters */ + VGboolean filter_format_linear; + VGboolean filter_format_premultiplied; + + /* Destination write enable mask for image filters */ + VGbitfield filter_channel_mask; + + struct matrix path_user_to_surface_matrix; + struct matrix image_user_to_surface_matrix; + struct matrix fill_paint_to_user_matrix; + struct matrix stroke_paint_to_user_matrix; + struct matrix glyph_user_to_surface_matrix; + + struct vg_paint *stroke_paint; + struct vg_paint *fill_paint; +}; + +void vg_init_state(struct vg_state *state); +struct matrix * vg_state_matrix(struct vg_state *state); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_tracker.c b/src/gallium/state_trackers/vega/vg_tracker.c new file mode 100644 index 0000000000..c262ce08fa --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_tracker.c @@ -0,0 +1,406 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_context.h" +#include "vg_tracker.h" +#include "mask.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "util/u_memory.h" +#include "util/u_math.h" + +static struct pipe_texture * +create_texture(struct pipe_context *pipe, enum pipe_format format, + VGint width, VGint height) +{ + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + + if (format != PIPE_FORMAT_NONE) { + templ.format = format; + } + else { + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + } + + templ.target = PIPE_TEXTURE_2D; + pf_get_block(templ.format, &templ.block); + templ.width[0] = width; + templ.height[0] = height; + templ.depth[0] = 1; + templ.last_level = 0; + + if (pf_get_component_bits(format, PIPE_FORMAT_COMP_S)) { + templ.tex_usage = PIPE_TEXTURE_USAGE_DEPTH_STENCIL; + } else { + templ.tex_usage = (PIPE_TEXTURE_USAGE_DISPLAY_TARGET | + PIPE_TEXTURE_USAGE_RENDER_TARGET | + PIPE_TEXTURE_USAGE_SAMPLER); + } + + return pipe->screen->texture_create(pipe->screen, &templ); +} + +/** + * Allocate a renderbuffer for a an on-screen window (not a user-created + * renderbuffer). The window system code determines the format. + */ +static struct st_renderbuffer * +st_new_renderbuffer_fb(enum pipe_format format) +{ + struct st_renderbuffer *strb; + + strb = CALLOC_STRUCT(st_renderbuffer); + if (!strb) { + /*_vega_error(NULL, VG_OUT_OF_MEMORY, "creating renderbuffer");*/ + return NULL; + } + + strb->format = format; + + return strb; +} + + +/** + * This is called to allocate the original drawing surface, and + * during window resize. + */ +static VGboolean +st_renderbuffer_alloc_storage(struct vg_context * ctx, + struct st_renderbuffer *strb, + VGuint width, VGuint height) +{ + struct pipe_context *pipe = ctx->pipe; + unsigned surface_usage; + + /* Free the old surface and texture + */ + pipe_surface_reference(&strb->surface, NULL); + pipe_texture_reference(&strb->texture, NULL); + + + /* Probably need dedicated flags for surface usage too: + */ + surface_usage = (PIPE_BUFFER_USAGE_GPU_READ | + PIPE_BUFFER_USAGE_GPU_WRITE); + + strb->texture = create_texture(pipe, strb->format, + width, height); + + if (!strb->texture) + return FALSE; + + strb->surface = pipe->screen->get_tex_surface(pipe->screen, + strb->texture, + 0, 0, 0, + surface_usage); + strb->width = width; + strb->height = height; + + assert(strb->surface->width == width); + assert(strb->surface->height == height); + + return strb->surface != NULL; +} + +struct vg_context * st_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share) +{ + struct vg_context *ctx = vg_create_context(pipe, visual, share); + /*debug_printf("--------- CREATE CONTEXT %p\n", ctx);*/ + return ctx; +} + +void st_destroy_context(struct vg_context *st) +{ + /*debug_printf("--------- DESTROY CONTEXT %p\n", st);*/ + vg_destroy_context(st); +} + +void st_copy_context_state(struct vg_context *dst, struct vg_context *src, + uint mask) +{ + fprintf(stderr, "FIXME: %s\n", __FUNCTION__); +} + +void st_get_framebuffer_dimensions(struct st_framebuffer *stfb, + uint *width, + uint *height) +{ + *width = stfb->strb->width; + *height = stfb->strb->height; +} + +struct st_framebuffer * st_create_framebuffer(const void *visual, + enum pipe_format colorFormat, + enum pipe_format depthFormat, + enum pipe_format stencilFormat, + uint width, uint height, + void *privateData) +{ + struct st_framebuffer *stfb = CALLOC_STRUCT(st_framebuffer); + if (stfb) { + struct st_renderbuffer *rb = + st_new_renderbuffer_fb(colorFormat); + stfb->strb = rb; +#if 0 + if (doubleBuffer) { + struct st_renderbuffer *rb = + st_new_renderbuffer_fb(colorFormat); + } +#endif + + /* we want to combine the depth/stencil */ + if (stencilFormat == depthFormat) + stfb->dsrb = st_new_renderbuffer_fb(stencilFormat); + else + stfb->dsrb = st_new_renderbuffer_fb(PIPE_FORMAT_S8Z24_UNORM); + + /*### currently we always allocate it but it's possible it's + not necessary if EGL_ALPHA_MASK_SIZE was 0 + */ + stfb->alpha_mask = 0; + + stfb->init_width = width; + stfb->init_height = height; + stfb->privateData = privateData; + } + + return stfb; +} + +static void setup_new_alpha_mask(struct vg_context *ctx, + struct st_framebuffer *stfb, + uint width, uint height) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_texture *old_texture = stfb->alpha_mask; + + /* + we use PIPE_FORMAT_A8R8G8B8_UNORM because we want to render to + this texture and use it as a sampler, so while this wastes some + space it makes both of those a lot simpler + */ + stfb->alpha_mask = + create_texture(pipe, PIPE_FORMAT_A8R8G8B8_UNORM, width, height); + + if (!stfb->alpha_mask) { + if (old_texture) + pipe_texture_reference(&old_texture, NULL); + return; + } + + vg_validate_state(ctx); + + /* alpha mask starts with 1.f alpha */ + mask_fill(0, 0, width, height, 1.f); + + /* if we had an old surface copy it over */ + if (old_texture) { + struct pipe_surface *surface = pipe->screen->get_tex_surface( + pipe->screen, + stfb->alpha_mask, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + struct pipe_surface *old_surface = pipe->screen->get_tex_surface( + pipe->screen, + old_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_READ); + pipe->surface_copy(pipe, + surface, + 0, 0, + old_surface, + 0, 0, + MIN2(old_surface->width, width), + MIN2(old_surface->height, height)); + if (surface) + pipe_surface_reference(&surface, NULL); + if (old_surface) + pipe_surface_reference(&old_surface, NULL); + } + + /* Free the old texture + */ + if (old_texture) + pipe_texture_reference(&old_texture, NULL); +} + +void st_resize_framebuffer(struct st_framebuffer *stfb, + uint width, uint height) +{ + struct vg_context *ctx = vg_current_context(); + struct st_renderbuffer *strb = stfb->strb; + struct pipe_framebuffer_state *state; + + if (!ctx) + return; + + state = &ctx->state.g3d.fb; + + /* If this is a noop, exit early and don't do the clear, etc below. + */ + if (strb->width == width && + strb->height == height && + state->zsbuf) + return; + + if (strb->width != width || strb->height != height) + st_renderbuffer_alloc_storage(ctx, strb, + width, height); + + if (stfb->dsrb->width != width || stfb->dsrb->height != height) + st_renderbuffer_alloc_storage(ctx, stfb->dsrb, + width, height); + + { + VGuint i; + + memset(state, 0, sizeof(struct pipe_framebuffer_state)); + + state->width = width; + state->height = height; + + state->nr_cbufs = 1; + state->cbufs[0] = strb->surface; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + state->cbufs[i] = 0; + + state->zsbuf = stfb->dsrb->surface; + + cso_set_framebuffer(ctx->cso_context, state); + } + + ctx->state.dirty |= VIEWPORT_DIRTY; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY;/*to reset the scissors*/ + + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_DEPTHSTENCIL, + NULL, 0.0, 0); + + /* we need all the other state already set */ + + setup_new_alpha_mask(ctx, stfb, width, height); + + pipe_texture_reference( &stfb->blend_texture, NULL ); + stfb->blend_texture = create_texture(ctx->pipe, PIPE_FORMAT_A8R8G8B8_UNORM, + width, height); +} + +void st_set_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface *surf) +{ + struct st_renderbuffer *rb = stfb->strb; + + /* unreference existing surfaces */ + pipe_surface_reference( &rb->surface, NULL ); + pipe_texture_reference( &rb->texture, NULL ); + + /* reference new ones */ + pipe_surface_reference( &rb->surface, surf ); + pipe_texture_reference( &rb->texture, surf->texture ); + + rb->width = surf->width; + rb->height = surf->height; +} + +int st_get_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface **surf) +{ + struct st_renderbuffer *rb = stfb->strb; + *surf = rb->surface; + return VG_TRUE; +} + +int st_get_framebuffer_texture(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_texture **tex) +{ + struct st_renderbuffer *rb = stfb->strb; + *tex = rb->texture; + return VG_TRUE; +} + +void * st_framebuffer_private(struct st_framebuffer *stfb) +{ + return stfb->privateData; +} + +void st_unreference_framebuffer(struct st_framebuffer *stfb) +{ + /* FIXME */ +} + +void st_make_current(struct vg_context *st, + struct st_framebuffer *draw, + struct st_framebuffer *read) +{ + vg_set_current_context(st); + if (st) { + st->draw_buffer = draw; + } +} + +void st_flush(struct vg_context *st, uint pipeFlushFlags, + struct pipe_fence_handle **fence) +{ + st->pipe->flush(st->pipe, pipeFlushFlags, fence); +} + +void st_finish(struct vg_context *st) +{ + struct pipe_fence_handle *fence = NULL; + + st_flush(st, PIPE_FLUSH_RENDER_CACHE, &fence); + + st->pipe->screen->fence_finish(st->pipe->screen, fence, 0); + st->pipe->screen->fence_reference(st->pipe->screen, &fence, NULL); +} + +void st_notify_swapbuffers(struct st_framebuffer *stfb) +{ + struct vg_context *ctx = vg_current_context(); + if (ctx && ctx->draw_buffer == stfb) { + st_flush(ctx, + PIPE_FLUSH_RENDER_CACHE | + PIPE_FLUSH_SWAPBUFFERS | + PIPE_FLUSH_FRAME, + NULL); + } +} + +void st_notify_swapbuffers_complete(struct st_framebuffer *stfb) +{ +} + +int +st_set_teximage(struct pipe_texture *pt, int target) +{ + return 0; +} diff --git a/src/gallium/state_trackers/vega/vg_tracker.h b/src/gallium/state_trackers/vega/vg_tracker.h new file mode 100644 index 0000000000..805c58ccc7 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_tracker.h @@ -0,0 +1,102 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_TRACKER_H +#define VG_TRACKER_H + +#include "VG/openvg.h" + +#include "pipe/p_compiler.h" +#include "pipe/p_format.h" + +#define ST_SURFACE_FRONT_LEFT 0 +#define ST_SURFACE_BACK_LEFT 1 +#define ST_SURFACE_FRONT_RIGHT 2 +#define ST_SURFACE_BACK_RIGHT 3 +#define ST_SURFACE_DEPTH 8 + +struct vg_context; +struct st_framebuffer; +struct pipe_context; +struct pipe_fence_handle; +struct pipe_surface; + + +struct vg_context *st_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share); + +void st_destroy_context( struct vg_context *st ); + +void st_copy_context_state(struct vg_context *dst, struct vg_context *src, + uint mask); + +struct st_framebuffer *st_create_framebuffer(const void *visual, + enum pipe_format colorFormat, + enum pipe_format depthFormat, + enum pipe_format stencilFormat, + uint width, uint height, + void *privateData); + +void st_resize_framebuffer(struct st_framebuffer *stfb, + uint width, uint height); + +void st_set_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface *surf); + +void st_get_framebuffer_dimensions( struct st_framebuffer *stfb, + uint *width, uint *height); + +int st_set_teximage(struct pipe_texture *pt, int target); + +int st_get_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface **surf); + +int st_get_framebuffer_texture(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_texture **tex); + +void *st_framebuffer_private(struct st_framebuffer *stfb); + +void st_unreference_framebuffer(struct st_framebuffer *stfb); + +void st_make_current(struct vg_context *st, + struct st_framebuffer *draw, + struct st_framebuffer *read); + +void st_flush(struct vg_context *st, uint pipeFlushFlags, + struct pipe_fence_handle **fence); +void st_finish(struct vg_context *st); + +void st_notify_swapbuffers(struct st_framebuffer *stfb); +void st_notify_swapbuffers_complete(struct st_framebuffer *stfb); + + +/** Generic function type */ +typedef void (*st_proc)(); + +st_proc st_get_proc_address(const char *procname); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_translate.c b/src/gallium/state_trackers/vega/vg_translate.c new file mode 100644 index 0000000000..00e0764706 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_translate.c @@ -0,0 +1,1030 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_translate.h" + +#include "pipe/p_format.h" +#include "util/u_pack_color.h" + +void _vega_pack_rgba_span_float(struct vg_context *ctx, + VGuint n, VGfloat rgba[][4], + VGImageFormat dstFormat, + void *dstAddr) +{ + VGint i; + + switch (dstFormat) { + case VG_sRGBX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 255; + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGBA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGBA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGB_565: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + r = (r / 255.0) * 32; + g = (g / 255.0) * 32; + b = (b / 255.0) * 32; + + dst[i] = b | g << 5 | r << 11; + } + return; + } + break; + case VG_sRGBA_5551: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + r = (r / 255.0) * 32; + g = (g / 255.0) * 32; + b = (b / 255.0) * 32; + a = (a / 255.0); + + dst[i] = a | b << 1 | g << 6 | r << 11; + } + return; + } + break; + case VG_sRGBA_4444: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + r = (r / 255.0) * 16; + g = (g / 255.0) * 16; + b = (b / 255.0) * 16; + a = (a / 255.0) * 16; + + dst[i] = a | b << 4 | g << 8 | r << 12; + } + return; + } + break; + case VG_sL_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = a; + } + return; + } + break; + case VG_lRGBX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 255; + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_lRGBA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + case VG_lRGBA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_lL_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a; + } + return; + } + break; + case VG_A_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = a; + } + return; + } + break; + case VG_BW_1: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + VGubyte res; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + res = (r + g + b + a)/4; + dst[i] = (res & (128)); + } + return; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = (a & (128)); + } + return; + } + break; + case VG_A_4: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + VGubyte res; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + res = a/4; + dst[i] = (res & (128)); + } + return; + } + break; +#endif + case VG_sXRGB_8888: + break; + case VG_sARGB_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sARGB_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sARGB_1555: + break; + case VG_sARGB_4444: + break; + case VG_lXRGB_8888: + break; + case VG_lARGB_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_lARGB_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sBGRX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 0xff; + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGRA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGRA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGR_565: + break; + case VG_sBGRA_5551: + break; + case VG_sBGRA_4444: + break; + case VG_lBGRX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 0xff; + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_lBGRA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_lBGRA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sXBGR_8888: + break; + case VG_sABGR_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_sABGR_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_sABGR_1555: + break; + case VG_sABGR_4444: + break; + case VG_lXBGR_8888: + break; + case VG_lABGR_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_lABGR_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); +} + +void _vega_unpack_float_span_rgba(struct vg_context *ctx, + VGuint n, + VGuint offset, + const void * data, + VGImageFormat dataFormat, + VGfloat rgba[][4]) +{ + VGint i; + + switch (dataFormat) { + case VG_sRGBX_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sRGBA_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sRGB_565: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 10) & 31)/31.; + clr[1] = ((*src >> 5) & 95)/95.; + clr[2] = ((*src >> 0) & 31)/31.; + clr[3] = 1.f; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_5551: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 10) & 31)/31.; + clr[1] = ((*src >> 5) & 31)/31.; + clr[2] = ((*src >> 1) & 31)/31.; + clr[3] = ((*src >> 0) & 1)/1.; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_4444: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 12) & 15)/15.; + clr[1] = ((*src >> 8) & 15)/15.; + clr[2] = ((*src >> 4) & 15)/15.; + clr[3] = ((*src >> 0) & 15)/15.; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sL_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_lRGBX_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_lRGBA_8888: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lRGBA_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lL_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_A_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_BW_1: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; i += 8) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < 8 && j < n ; ++j) { + VGint shift = j; + clr[0] = (((*src) & (1<> shift); + clr[1] = clr[0]; + clr[2] = clr[0]; + clr[3] = 1.f; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i+j]); + } + ++src; + } + } + return; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; i += 8) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < 8 && j < n ; ++j) { + VGint shift = j; + clr[0] = 0.f; + clr[1] = 0.f; + clr[2] = 0.f; + clr[3] = (((*src) & (1<> shift); + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i+j]); + } + ++src; + } + } + return; + case VG_A_4: { + VGubyte *src = (VGubyte *)data; + src += offset/2; + for (i = 0; i < n; i += 2) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < n && j < 2; ++j) { + VGint bitter, shift; + if (j == 0) { + bitter = 0x0f; + shift = 0; + } else { + bitter = 0xf0; + shift = 4; + } + clr[0] = 0.f; + clr[1] = 0.f; + clr[2] = 0.f; + clr[3] = ((*src) & (bitter)) >> shift; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i +j]); + } + ++src; + } + } + return; +#endif + case VG_sXRGB_8888: + break; + case VG_sARGB_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sARGB_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sARGB_1555: + break; + case VG_sARGB_4444: + break; + case VG_lXRGB_8888: + break; + case VG_lARGB_8888: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lARGB_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGRX_8888: + break; + case VG_sBGRA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGRA_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGR_565: + break; + case VG_sBGRA_5551: + break; + case VG_sBGRA_4444: + break; + case VG_lBGRX_8888: + break; + case VG_lBGRA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lBGRA_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sXBGR_8888: + break; + case VG_sABGR_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sABGR_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sABGR_1555: + break; + case VG_sABGR_4444: + break; + case VG_lXBGR_8888: + break; + case VG_lABGR_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lABGR_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); +} + +VGint _vega_size_for_format(VGImageFormat dataFormat) +{ + switch (dataFormat) { + case VG_sRGBX_8888: + case VG_sRGBA_8888: + case VG_sRGBA_8888_PRE: + return 4; + case VG_sRGB_565: + case VG_sRGBA_5551: + case VG_sRGBA_4444: + return 2; + case VG_sL_8: + return 1; + case VG_lRGBX_8888: + case VG_lRGBA_8888: + case VG_lRGBA_8888_PRE: + return 4; + case VG_lL_8: + return 1; + case VG_A_8: + return 1; + case VG_BW_1: + return 1; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + break; + case VG_A_4: + break; +#endif + case VG_sXRGB_8888: + case VG_sARGB_8888: + case VG_sARGB_8888_PRE: + return 4; + case VG_sARGB_1555: + case VG_sARGB_4444: + return 2; + case VG_lXRGB_8888: + case VG_lARGB_8888: + case VG_lARGB_8888_PRE: + case VG_sBGRX_8888: + case VG_sBGRA_8888: + case VG_sBGRA_8888_PRE: + return 4; + case VG_sBGR_565: + case VG_sBGRA_5551: + case VG_sBGRA_4444: + return 2; + case VG_lBGRX_8888: + case VG_lBGRA_8888: + case VG_lBGRA_8888_PRE: + case VG_sXBGR_8888: + case VG_sABGR_8888: + case VG_sABGR_8888_PRE: + return 4; + case VG_sABGR_1555: + case VG_sABGR_4444: + return 2; + case VG_lXBGR_8888: + case VG_lABGR_8888: + case VG_lABGR_8888_PRE: + return 4; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); + return 0; +} diff --git a/src/gallium/state_trackers/vega/vg_translate.h b/src/gallium/state_trackers/vega/vg_translate.h new file mode 100644 index 0000000000..70815bacbc --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_translate.h @@ -0,0 +1,49 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_TRANSLATE_H +#define VG_TRANSLATE_H + +#include "VG/openvg.h" +#include "vg_context.h" + +/*FIXME: we really should be using translate module + * but pipe_format can't express some of the VG formats + * (the premultiplied ones) so currently it won't work */ + +void _vega_pack_rgba_span_float(struct vg_context *ctx, + VGuint n, VGfloat rgba[][4], + VGImageFormat dstFormat, + void *dstAddr); +void _vega_unpack_float_span_rgba(struct vg_context *ctx, + VGuint n, + VGuint offset, + const void * data, + VGImageFormat dataFormat, + VGfloat rgba[][4]); +VGint _vega_size_for_format(VGImageFormat format); + +#endif diff --git a/src/gallium/state_trackers/vega/vgu.c b/src/gallium/state_trackers/vega/vgu.c new file mode 100644 index 0000000000..7dc51c5599 --- /dev/null +++ b/src/gallium/state_trackers/vega/vgu.c @@ -0,0 +1,450 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" +#include "VG/vgu.h" + +#include "matrix.h" +#include "path.h" + +#include "util/u_debug.h" +#include "util/u_pointer.h" + +#include +#include + +static VGboolean is_aligned_to(const void *ptr, VGbyte alignment) +{ + void *aligned = align_pointer(ptr, alignment); + return (ptr == aligned) ? VG_TRUE : VG_FALSE; +} + +static VGboolean is_aligned(const void *ptr) +{ + return is_aligned_to(ptr, 4); +} + +static void vgu_append_float_coords(VGPath path, + const VGubyte *cmds, + VGint num_cmds, + const VGfloat *coords, + VGint num_coords) +{ + VGubyte common_data[40 * sizeof(VGfloat)]; + struct path *p = (struct path *)path; + + vg_float_to_datatype(path_datatype(p), common_data, coords, num_coords); + vgAppendPathData(path, num_cmds, cmds, common_data); +} + +VGUErrorCode vguLine(VGPath path, + VGfloat x0, VGfloat y0, + VGfloat x1, VGfloat y1) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat coords[4]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + + coords[0] = x0; + coords[1] = y0; + coords[2] = x1; + coords[3] = y1; + + vgu_append_float_coords(path, cmds, 2, coords, 4); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguPolygon(VGPath path, + const VGfloat * points, + VGint count, + VGboolean closed) +{ + VGubyte *cmds; + VGfloat *coords; + VGbitfield caps; + VGint i; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + + if (!points || count <= 0 || !is_aligned(points)) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + + cmds = malloc(sizeof(VGubyte) * count + 1); + coords = malloc(sizeof(VGfloat) * count * 2); + + cmds[0] = VG_MOVE_TO_ABS; + coords[0] = points[0]; + coords[1] = points[1]; + for (i = 1; i < count; ++i) { + cmds[i] = VG_LINE_TO_ABS; + coords[2*i + 0] = points[2*i + 0]; + coords[2*i + 1] = points[2*i + 1]; + } + + if (closed) { + cmds[i] = VG_CLOSE_PATH; + ++i; + } + + vgu_append_float_coords(path, cmds, i, coords, 2*i); + + free(cmds); + free(coords); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_REL, + VG_VLINE_TO_REL, + VG_HLINE_TO_REL, + VG_CLOSE_PATH + }; + VGfloat coords[5]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + coords[0] = x; + coords[1] = y; + coords[2] = width; + coords[3] = height; + coords[4] = -width; + + vgu_append_float_coords(path, cmds, 5, coords, 5); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguRoundRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, + VGfloat height, + VGfloat arcWidth, + VGfloat arcHeight) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_VLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_HLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_VLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_CLOSE_PATH + }; + VGfloat c[26]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + c[0] = x + arcWidth/2; c[1] = y; + + c[2] = width - arcWidth; + + c[3] = arcWidth/2; c[4] = arcHeight/2; c[5] = 0; + c[6] = arcWidth/2; c[7] = arcHeight/2; + + c[8] = height - arcHeight; + + c[9] = arcWidth/2; c[10] = arcHeight/2; c[11] = 0; + c[12] = -arcWidth/2; c[13] = arcHeight/2; + + c[14] = -(width - arcWidth); + + c[15] = arcWidth/2; c[16] = arcHeight/2; c[17] = 0; + c[18] = -arcWidth/2; c[19] = -arcHeight/2; + + c[20] = -(height - arcHeight); + + c[21] = arcWidth/2; c[22] = arcHeight/2; c[23] = 0; + c[24] = arcWidth/2; c[25] = -arcHeight/2; + + vgu_append_float_coords(path, cmds, 10, c, 26); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguEllipse(VGPath path, + VGfloat cx, VGfloat cy, + VGfloat width, + VGfloat height) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_SCCWARC_TO_REL, + VG_SCCWARC_TO_REL, + VG_CLOSE_PATH + }; + VGfloat coords[12]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + coords[0] = cx + width/2; coords[1] = cy; + + coords[2] = width/2; coords[3] = height/2; coords[4] = 0; + coords[5] = -width; coords[6] = 0; + + coords[7] = width/2; coords[8] = height/2; coords[9] = 0; + coords[10] = width; coords[11] = 0; + + vgu_append_float_coords(path, cmds, 4, coords, 11); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguArc(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height, + VGfloat startAngle, + VGfloat angleExtent, + VGUArcType arcType) +{ + VGubyte cmds[11]; + VGfloat coords[40]; + VGbitfield caps; + VGfloat last = startAngle + angleExtent; + VGint i, c = 0; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + if (arcType != VGU_ARC_OPEN && + arcType != VGU_ARC_CHORD && + arcType != VGU_ARC_PIE) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + cmds[c] = VG_MOVE_TO_ABS; ++c; + coords[0] = x+cos(DEGREES_TO_RADIANS(startAngle))*width/2; + coords[1] = y+sin(DEGREES_TO_RADIANS(startAngle))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("start [%f, %f]\n", coords[0], coords[1]); +#endif + i = 2; + if (angleExtent > 0) { + VGfloat angle = startAngle + 180; + while (angle < last) { + cmds[c] = VG_SCCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(angle))*width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(angle))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("1 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + angle += 180; + } + cmds[c] = VG_SCCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x+cos(DEGREES_TO_RADIANS(last))*width/2; + coords[i+4] = y+sin(DEGREES_TO_RADIANS(last))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("2 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + } else { + VGfloat angle = startAngle - 180; + while (angle > last) { + cmds[c] = VG_SCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(angle)) * width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(angle)) * height/2; +#ifdef DEBUG_VGUARC + debug_printf("3 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + angle -= 180; + i += 5; + } + cmds[c] = VG_SCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(last)) * width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(last)) * height/2; +#ifdef DEBUG_VGUARC + debug_printf("4 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + } + + if (arcType == VGU_ARC_PIE) { + cmds[c] = VG_LINE_TO_ABS; ++c; + coords[i] = x; coords[i + 1] = y; + i += 2; + } + if (arcType == VGU_ARC_PIE || arcType == VGU_ARC_CHORD) { + cmds[c] = VG_CLOSE_PATH; + ++c; + } + + assert(c < 11); + + vgu_append_float_coords(path, cmds, c, coords, i); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_quad_to_square(sx0, sy0, + sx1, sy1, + sx2, sy2, + sx3, sy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + if (!matrix_is_invertible(&mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_square_to_quad(dx0, dy0, + dx1, dy1, + dx2, dy2, + dx3, dy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + if (!matrix_is_invertible(&mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_quad_to_quad(dx0, dy0, + dx1, dy1, + dx2, dy2, + dx3, dy3, + sx0, sy0, + sx1, sy1, + sx2, sy2, + sx3, sy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} -- cgit v1.2.3 From d6318ba8a856c5a61c402fce43c3fa56c414064a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 1 May 2009 11:37:09 -0600 Subject: docs: asst updates to openvg.html --- docs/openvg.html | 34 +++++++++++++++++++++++++++------- 1 file changed, 27 insertions(+), 7 deletions(-) (limited to 'docs') diff --git a/docs/openvg.html b/docs/openvg.html index a8153b9db9..442ee522f1 100644 --- a/docs/openvg.html +++ b/docs/openvg.html @@ -14,7 +14,9 @@ The current version of the OpenVG state tracker implements OpenVG 1.0.

                    -More informations about OpenVG can be found at http://www.khronos.org/openvg/ . +More informations about OpenVG can be found at + +http://www.khronos.org/openvg/ .

                    The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation. @@ -31,14 +33,32 @@ The OpenVG state tracker depends on the Gallium architecture and a working EGL i

                    Sample build

                    A sample build looks as follows: 
                    -make linux-x86-64-debug
-cd src/gallium/state_trackers/vega
-make
-cd ../../../..
-export LD_LIBRARY_PATH=$PWD/lib64
-export EGL_DRIVER="egl_softpipe"
+  make linux-x86-64-debug
+  cd src/gallium/state_trackers/vega
+  make
+  cd ../../../..
+  export LD_LIBRARY_PATH=$PWD/lib64
+  export EGL_DRIVER="egl_softpipe"
                    +

                    OpenVG Demos

                    + +

                    +To build the OpenVG demos: +

                    +
                    +  cd progs/openvg
+  make
+
                    +

                    +To run a demo: +

                    +
                    +  cd openvg/demos
+  ./lion
+
                    + +

                    Notes

                    • EGL_DRIVER environmental variable: forces usage of a specific EGL driver. Unless you force egl_softpipe the implementation will look for a DRI hardware accelerate driver and unless you have a Gallium driver that supports it, you'll see crashes
                      • -- cgit v1.2.3 From ac5bf63f7408414bf8d7993ad77d92b76830cec6 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 13 May 2009 11:24:11 -0600 Subject: docs: GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers --- docs/relnotes-7.6.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 77ce013d43..82c0c2e947 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -43,6 +43,7 @@ tbd
                      • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics. +
                      • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers.
                      -- cgit v1.2.3 From 65b9cd74e3145b416f2c9695a0c3bc7bd6b85e25 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 15 May 2009 08:02:40 -0600 Subject: docs: updates from the 7.4 branch --- docs/news.html | 5 ++-- docs/relnotes-7.4.2.html | 74 ++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 6 ++-- 3 files changed, 80 insertions(+), 5 deletions(-) create mode 100644 docs/relnotes-7.4.2.html (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index 98cee9b8b8..8cf2f91dd0 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,9 +11,10 @@

                      News

                      -

                      May tbd, 2009

                      +

                      May 15, 2009

                      -Mesa 7.5 is released. +Mesa 7.4.2 is released. +This is a stable release fixing bugs since the 7.4.1 release.

                      diff --git a/docs/relnotes-7.4.2.html b/docs/relnotes-7.4.2.html new file mode 100644 index 0000000000..7d066e418e --- /dev/null +++ b/docs/relnotes-7.4.2.html @@ -0,0 +1,74 @@ + + +Mesa Release Notes + + + + + + + +

                      Mesa 7.4.2 Release Notes / May 15, 2009

                      + +

                      +Mesa 7.4.2 is a stable development release fixing bugs since the 7.4.1 release. +

                      +

                      +Mesa 7.4.2 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

                      +

                      +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

                      + + +

                      MD5 checksums

                      +
                      +172f5193154dad731387f97bd44ab68f  MesaLib-7.4.2.tar.gz
+b10a76e32bde4645cfc34ea0416d7d8b  MesaLib-7.4.2.tar.bz2
+cc6dfc2efd424cc342b84e6bcd78ce5d  MesaLib-7.4.2.zip
+182a7e78aa7a480b3650a5c956dbddd1  MesaDemos-7.4.2.tar.gz
+bf559a0485667a3bfa4513a23501579b  MesaDemos-7.4.2.tar.bz2
+5379e622b65e8c22022dba34aeb6f4f9  MesaDemos-7.4.2.zip
+7cc43c1c35bf6a279a16e063dea3b8c5  MesaGLUT-7.4.2.tar.gz
+e0dfc44d537904a030861e5b3c760c11  MesaGLUT-7.4.2.tar.bz2
+4a6cf5bbbac190d6ba97448b3098b7f4  MesaGLUT-7.4.2.zip
+
                      + + +

                      Bug fixes

                      +
                        +
                      • Fixed segfault when rendering to front buffer with DRI 1. +
                      • Fixed swrast texture rectangle bug when wrap mode = GL_CLAMP_TO_BORDER and + filter mode = GL_LINEAR. (bug 21461) +
                      • Fixed texture object mem leak during context destruction. +
                      • Fixed a state validation bug in glCopyTex[Sub]Image() +
                      • Fixed some i965 GLSL bugs. +
                      • Fixed an R300 driver texture object bad memory reference. +
                      + + + +

                      Driver Status

                      + +
                      +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
                      + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 298352038c..ca808af64c 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -10,8 +10,8 @@

                      Mesa uses an even/odd version number scheme like the Linux kernel. -Odd numbered versions (such as 7.5) designate new developmental releases. -Even numbered versions (such as 7.4) designate stable releases. +Odd numbered versions (such as 6.5) designate new developmental releases. +Even numbered versions (such as 6.4) designate stable releases.

                      @@ -20,7 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

                        -
                      • 7.5 release notes +
                      • 7.4.2 release notes
                      • 7.4.1 release notes
                      • 7.4 release notes
                      • 7.3 release notes -- cgit v1.2.3 From da0d4e1db67d7641a535218de2db5f7bb00a6bb8 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 18 May 2009 07:17:36 -0600 Subject: docs: emphasize the incomplete status of the nouveau/R300 gallium drivers --- docs/relnotes-7.5.html | 8 +++++--- 1 file changed, 5 insertions(+), 3 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 3de243d1b2..d47b21d827 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -46,7 +46,7 @@ tbd

                        New features

                          -
                        • Gallium - this is the new architecture for OS-independent and +
                        • Gallium3D - this is the new architecture for OS-independent and API-independent 3D drivers. Gallium3D is intended for GPUs that fully support vertex/fragment shaders. The Gallium3D drivers currently included are: @@ -54,8 +54,10 @@ tbd
                        • softpipe - a software/reference driver
                        • i915 - Intel 915/945 driver
                        • Cell - IBM/Sony/Toshiba Cell processor driver -
                        • nouveau - preliminary driver for NVIDIA GPUs (still under development) -
                        • r300 - preliminary driver for R300 (still under development) +
                        • nouveau (for NVIDIA GPUs) and R300 for (AMD/ATI R300). + PLEASE NOTE: these drivers are incomplete and still under development. + It's probably NOT worthwhile to report any bugs unless you have patches. +
                      • GL_ARB_framebuffer_object extension (software drivers, i965 driver)
                      • Reworked two-sided stencil support. -- cgit v1.2.3 From 6e61700541f229b55d78102a534c022caee1319c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 18 May 2009 07:17:46 -0600 Subject: docs: link to 7.5 relnotes --- docs/relnotes.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes.html b/docs/relnotes.html index ca808af64c..45746268af 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -20,6 +20,7 @@ The release notes summarize what's new or changed in each Mesa release.

                          +
                        • 7.5 release notes
                        • 7.4.2 release notes
                        • 7.4.1 release notes
                        • 7.4 release notes -- cgit v1.2.3 From 2ecc2ece9c2740958f303e0426fdc9037c40eb3a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 1 Jun 2009 20:45:08 -0600 Subject: docs: implemented GL_EXT_provoking_vertex --- docs/relnotes-7.6.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 82c0c2e947..bd3c678aef 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -44,6 +44,8 @@ tbd
                        • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics.
                        • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers. +
                        • GL_EXT_provoking_vertex extension - only supported in some drivers +(swrast at this time)
                        -- cgit v1.2.3 From 2e708fa9094a2eb54f7399060183118652ef1825 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 2 Jun 2009 20:33:09 -0600 Subject: docs: added GL_ARB_copy_buffer extension --- docs/relnotes-7.6.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 82c0c2e947..c552b43457 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -44,6 +44,7 @@ tbd
                      • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics.
                      • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers. +
                      • GL_ARB_copy_buffer extension
                      -- cgit v1.2.3 From 8086352fef94c52c4174257e91e5d45b68410fae Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 2 Jun 2009 21:30:22 -0600 Subject: docs: clarify GL_ARB_copy_buffer driver support --- docs/relnotes-7.6.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index c552b43457..be8da998a8 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -44,7 +44,7 @@ tbd
                    • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics.
                    • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers. -
                    • GL_ARB_copy_buffer extension +
                    • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers)
                    -- cgit v1.2.3 From 5cd47e0361ed0fc8ddd6c4cee12a274173c9b25b Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 2 Jun 2009 21:41:03 -0600 Subject: docs: remove version info carried over from 7.5 --- docs/relnotes-7.6.html | 7 ------- 1 file changed, 7 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index be8da998a8..f0e15f5024 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -24,13 +24,6 @@ Some drivers don't support all the features required in OpenGL 2.1. See the Compiling/Installing page for prerequisites for DRI hardware acceleration.

                    -

                    -Note that the Mesa project is no longer using odd/even version numbers -to indicate development/stable releases. -The so-called development releases have been fairly stable. -If you're especially concerned with stability you should probably look for -"point" releases such as 7.5.1 which will be a bug-fix release. -

                    MD5 checksums

                    -- cgit v1.2.3 From cc26e2774615d5e18a0e19270a40b7dd1e4e99df Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 8 Jun 2009 10:56:51 -0600 Subject: docs: document MESA_EXTENSION_OVERRIDE env var --- docs/envvars.html | 3 +++ 1 file changed, 3 insertions(+) (limited to 'docs') diff --git a/docs/envvars.html b/docs/envvars.html index 7fd9fe7c0a..6d7a321da9 100644 --- a/docs/envvars.html +++ b/docs/envvars.html @@ -25,6 +25,9 @@ fragment programs (intended for developers only)
                  • MESA_TNL_PROG - if set, implement conventional vertex transformation operations with vertex programs (intended for developers only). Setting this variable automatically sets the MESA_TEX_PROG variable as well. +
                  • MESA_EXTENSION_OVERRIDE - can be used to enable/disable extensions. +A value such as "GL_EXT_foo -GL_EXT_bar" will enable the GL_EXT_foo extension +and disable the GL_EXT_bar extension.

                  -- cgit v1.2.3 From e297569d653a69b2636581fbc5ab568849efc090 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 8 Jun 2009 17:06:13 -0600 Subject: docs: new feature: GL_ARB_map_buffer_range --- docs/relnotes-7.6.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index f0e15f5024..ff3ce6469b 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -38,6 +38,7 @@ tbd This was written by Zack Rusin at Tungsten Graphics.

                • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers.
                • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers) +
                • GL_ARB_map_buffer_range extension (supported in Gallium and software drivers)
                -- cgit v1.2.3 From 5450281ff75eab0cccdf7a926aed7e04132d3c95 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 9 Jun 2009 11:56:12 -0600 Subject: docs: document GLSL preprocessor fixes --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index d47b21d827..663626cb05 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -74,6 +74,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0

                Bug fixes

                • Lots of i965 driver bug fixes +
                • Fixed some GLSL preprocessor bugs
                -- cgit v1.2.3 From c4a5754a8c88c3777313e4aeb678966fb67b375b Mon Sep 17 00:00:00 2001 From: Dave Airlie Date: Sat, 13 Jun 2009 07:43:04 +1000 Subject: add some info to relnotes on radeon --- docs/relnotes-7.6.html | 3 +++ 1 file changed, 3 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index f0e15f5024..f53428fe9f 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -38,6 +38,9 @@ tbd This was written by Zack Rusin at Tungsten Graphics.
              • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers.
              • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers) +
              • rewritten radeon/r200/r300 driver using a buffer manager +
              • radeon/r200/r300 EXT_framebuffer_object support when used with kernel memory manager +
              • r300 - support for EXT_vertex_array_bgra/EXT_texture_sRGB
              -- cgit v1.2.3 From 1510c3cae1d840a065a22c891ad6db794dfe7a00 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 15 Jun 2009 16:44:26 -0600 Subject: docs: minor relnotes clean-up --- docs/relnotes-7.6.html | 7 ++++--- 1 file changed, 4 insertions(+), 3 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 3086dd0567..82a924c586 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -38,9 +38,10 @@ tbd This was written by Zack Rusin at Tungsten Graphics.
            • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers.
            • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers) -
            • rewritten radeon/r200/r300 driver using a buffer manager -
            • radeon/r200/r300 EXT_framebuffer_object support when used with kernel memory manager -
            • r300 - support for EXT_vertex_array_bgra/EXT_texture_sRGB +
            • Rewritten radeon/r200/r300 driver using a buffer manager +
            • radeon/r200/r300 GL_EXT_framebuffer_object support when used with + kernel memory manager +
            • r300 driver support for GL_EXT_vertex_array_bgra, GL_EXT_texture_sRGB
            • GL_ARB_map_buffer_range extension (supported in Gallium and software drivers)
            -- cgit v1.2.3 From b2a1ca4fcf1cd16f85404fc582cec14e28b79e07 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 22 Jun 2009 17:54:16 -0600 Subject: docs: document GL_ARB_vertex_array_object --- docs/relnotes-7.6.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 3c4ff4fbea..1e7ccf88bf 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -37,6 +37,8 @@ tbd
          • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics.
          • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers. +
          • GL_ARB_vertex_array_object for Gallium drivers, software drivers and + Intel DRI drivers.
          • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers)
          • GL_ARB_map_buffer_range extension (supported in Gallium and software drivers)
          • GL_EXT_provoking_vertex extension (supported in Gallium and software drivers) -- cgit v1.2.3 From ebe0796ba2d314202c30a1c9291a7e725c64b16a Mon Sep 17 00:00:00 2001 From: José Fonseca Date: Wed, 17 Jun 2009 10:12:11 +0100 Subject: docs: Document building with SCons. --- docs/install.html | 52 ++++++++++++++++++++++++++++++++++++++++++++++++++-- 1 file changed, 50 insertions(+), 2 deletions(-) (limited to 'docs') diff --git a/docs/install.html b/docs/install.html index be61ef3043..953d2094d5 100644 --- a/docs/install.html +++ b/docs/install.html @@ -21,6 +21,7 @@
          • Building OpenGL programs with pkg-config
        • Windows +
        • SCons
        • Other
          @@ -328,13 +329,60 @@ For example, compiling and linking a GLUT application can be done with:

          2. Windows Compilation and Installation

          -Please see the README.WIN32 file. +Please see the instructions on building with SCons. +Alternatively see README.WIN32 file.

          + +

          3. Building with SCons

          + +

          +To build Mesa with SCons on Linux or Windows do +

          +
          +    scons
+
          +

          +The build output will be placed in +build/platform-machine-debug/..., where platform is for +example linux or windows, machine is x86 or x86_64, optionally followed +by -debug for debug builds. +

          + +

          +The sample programs are built seperately. To build them do +

          +    scons -C progs
+
          +And the build output will be placed in progs/build/... +

          + +

          +To build Mesa with SCons for Windows on Linux using the MinGW crosscompiler toolchain do +

          +
          +    scons platform=windows toolchain=crossmingw machine=x86 statetrackers=mesa drivers=softpipe,trace winsys=gdi
+    scons -C progs platform=windows toolchain=crossmingw machine=x86 -k
+
          +

          +This will create: +

          +
            +
          • build/windows-x86-debug/gallium/winsys/gdi/opengl32.dll — Mesa + Gallium + softpipe, binary compatible with Windows's opengl32.dll +
          • build/windows-x86-debug/glut/glx/glut32.dll +
          • progs/build/windows-x86-debug/wgl/wglinfo.exe +
          • progs/build/windows-x86-debug/trivial/tri.exe +
          • and many other samples in progs/build/windows-x86-debug/... +
          +

          +Put them all in the same directory to test them. +

          + +           -

          3. Other systems

          +

          4. Other systems

          Documentation for other environments (some may be very out of date): -- cgit v1.2.3 From 84c5e4805b9e4d2f87137af64de8418b29c7a8f6 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 23 Jun 2009 19:21:04 -0600 Subject: docs: updated Mesa release instructions --- docs/devinfo.html | 40 +++++++++++++++++++++++++--------------- 1 file changed, 25 insertions(+), 15 deletions(-) (limited to 'docs') diff --git a/docs/devinfo.html b/docs/devinfo.html index 3cebf5f36d..0fb816749e 100644 --- a/docs/devinfo.html +++ b/docs/devinfo.html @@ -123,48 +123,46 @@ These are the instructions for making a new Mesa release.

          Get latest source files

          -Use "cvs update -dAP " to get the latest Mesa files from CVS. +Use git to get the latest Mesa files from the git repository, from whatever +branch is relevant.

          Verify and update version info

          -Create/edit the docs/RELNOTES-X.Y file to document what's new in the release. -Add the new RELNOTES-X.Y file to relnotes.html. -Update the docs/VERSIONS file too. +Create/edit the docs/relnotes-x.y.html file to document what's new in the release. +Add the new relnotes-x.y.html file to relnotes.html.

          -Edit the MESA_MAJOR, MESA_MINOR and MESA_TINY version numbers in +Update the MESA_MAJOR, MESA_MINOR and MESA_TINY version numbers in configs/default. +Also update the VERSION line in the top-level Makefile.

          Make sure the values in src/mesa/main/version.h are correct.

          -

          -Edit the top-level Makefile and verify that DIRECTORY, LIB_NAME and -DEMO_NAME are correct. -

          -

          Update the docs/news.html file and docs/download.html files.

          -Check in all updates to CVS. +Check in all updates to git.

          -Tag the CVS files with the release name (in the form mesa_X_Y). +Tag the files with the release name (in the form mesa_X_Y) +with: git tag -a mesa_X_Y +Then: git push origin mesa_X_Y

          Make the tarballs

          Make a symbolic link from $(DIRECTORY) to 'Mesa'. For example, -ln -s Mesa Mesa-6.3 +ln -s Mesa Mesa-7.5 This is needed in order to make a correct tar file in the next step.

          @@ -177,7 +175,7 @@ Make the distribution files. From inside the Mesa directory:

          After the tarballs are created, the md5 checksums for the files will be computed. -Add them to the docs/news.html file. +Add them to the docs/relnotes-X.Y.html file.

          @@ -191,9 +189,21 @@ Follow the directions on SourceForge for creating a new "release" and uploading the tarballs.

          +

          +Basically, to upload the tarball files with: +
          + +rsync -avP ssh Mesa*-X.Y.* USERNAME@frs.sourceforge.net:uploads/ + +

          +

          Update the web site by copying the docs/ directory's files to -/home/users/b/br/brianp/mesa-www/htdocs/ +/home/users/b/br/brianp/mesa-www/htdocs/ with: +
          + +sftp USERNAME,mesa3d@web.sourceforge.net +

          -- cgit v1.2.3 From 62ad606065312cecb1e2dcad0ad2cadf402f0b5c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 13:15:17 -0600 Subject: docs: document for/continue bug fix --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 663626cb05..9aee030d09 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -75,6 +75,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0

          • Lots of i965 driver bug fixes
          • Fixed some GLSL preprocessor bugs +
          • GLSL: continue inside of a for-loop didn't work
          -- cgit v1.2.3 From dd585db687f700de465fe78f9937eb785805e756 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 16:41:54 -0600 Subject: docs: increase max varying vars to 16 --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 9aee030d09..d0dba30528 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -68,6 +68,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
        • GL_EXT_texture_swizzle extension (software drivers, i965 driver)
        • Updated SPARC assembly optimizations (David S. Miller)
        • Initial support for separate compilation units in GLSL compiler. +
        • Increased max number of generic GLSL varying variables to 16 (formerly 8).
        -- cgit v1.2.3 From 318122b60a2af704086f719d1d9d36bede6f4e69 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 16:45:54 -0600 Subject: docs: bring in 7.4.3 and 7.4.4 release notes, news --- docs/relnotes-7.4.3.html | 79 ++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes-7.4.4.html | 68 +++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 2 ++ 3 files changed, 149 insertions(+) create mode 100644 docs/relnotes-7.4.3.html create mode 100644 docs/relnotes-7.4.4.html (limited to 'docs') diff --git a/docs/relnotes-7.4.3.html b/docs/relnotes-7.4.3.html new file mode 100644 index 0000000000..35b5dccbb0 --- /dev/null +++ b/docs/relnotes-7.4.3.html @@ -0,0 +1,79 @@ + + +Mesa Release Notes + + + + + + + +

        Mesa 7.4.3 Release Notes / 19 June 2009

        + +

        +Mesa 7.4.3 is a stable development release fixing bugs since the 7.4.2 release. +

        +

        +Mesa 7.4.3 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

        +

        +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

        + + +

        MD5 checksums

        +
        +34c5a6c47ed51f31c4fa36e269831352  MesaLib-7.4.3.tar.gz
+70a983ba3deaa8bd63b18bbab283f698  MesaLib-7.4.3.tar.bz2
+34f21b3205b271d575030aa98a2dda51  MesaLib-7.4.3.zip
+56752b7adede212e6097afb10d0c0d59  MesaDemos-7.4.3.tar.gz
+8ffa51c4833b1e298300a005e2d7ca2a  MesaDemos-7.4.3.tar.bz2
+0037d24d41400d6fb9800ae55b8c863f  MesaDemos-7.4.3.zip
+20e24f6692c0c90e7e3b220f79c4108d  MesaGLUT-7.4.3.tar.gz
+03a4beeef74fc5ef0b1d6d04710e5a8a  MesaGLUT-7.4.3.tar.bz2
+273788230adbdb9d57371309adedcf5f  MesaGLUT-7.4.3.zip
+
        + + +

        Bug fixes

        +
          +
        • Fixed texture object reference counting bug (bug 21756) +
        • Allow depth/stencil textures to be attached to GL_STENCIL_ATTACHMENT point + (SF bug 2793846) +
        • Added missing glGet case for GL_VERTEX_ARRAY_BINDING_APPLE +
        • Fixed some OSMesa build issues +
        • Fixed a vertex buffer object crash +
        • Fixed broken glTexImage3D() when image type = GL_BITMAP +
        • Fixed some GLSL preprocessor bugs +
        • Fixed framebuffer mem leak in i945/i965 DRI drivers +
        • Fixed texture coordinate repeat bug in swrast (bug 21872) +
        • Fixed incorrect viewport clamping (lower bound is zero, not one) +
        • GLX fix for glean's makeCurrent test case +
        + + + +

        Driver Status

        + +
        +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
        + + + diff --git a/docs/relnotes-7.4.4.html b/docs/relnotes-7.4.4.html new file mode 100644 index 0000000000..2a34568a7e --- /dev/null +++ b/docs/relnotes-7.4.4.html @@ -0,0 +1,68 @@ + + +Mesa Release Notes + + + + + + + +

        Mesa 7.4.4 Release Notes / 23 June 2009

        + +

        +Mesa 7.4.4 is a stable development release fixing bugs since the 7.4.3 release. +

        +

        +Mesa 7.4.4 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

        +

        +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

        + + +

        MD5 checksums

        +
        +0b56fe5a88ab0c3c5b2da5068f63f416  MesaLib-7.4.4.tar.gz
+b66528d314c574dccbe0ed963cac5e93  MesaLib-7.4.4.tar.bz2
+2818076f3ba23fa87fdfe4602a637a18  MesaLib-7.4.4.zip
+3e77b208386c47b18165bce5ae317e2c  MesaDemos-7.4.4.tar.gz
+628142ec9a54cd28cc027e6ce26cff47  MesaDemos-7.4.4.tar.bz2
+d08a30d30ab7174859aa709cba6c726d  MesaDemos-7.4.4.zip
+e6e91ba16e274d40cf3a97ad3218af01  MesaGLUT-7.4.4.tar.gz
+e14bbb52517e8121b31f1387515365ab  MesaGLUT-7.4.4.tar.bz2
+f10ed20469753c2b3d68c99854f80fd4  MesaGLUT-7.4.4.zip
+
        + + +

        Bug fixes

        +
          +
        • Fixed i965/i915 segfault in screen destruction (bug 22408) +
        + + + +

        Driver Status

        + +
        +Driver			Status
+----------------------	----------------------
+DRI drivers		varies with the driver
+XMesa/GLX (on Xlib)	implements OpenGL 2.1
+OSMesa (off-screen)	implements OpenGL 2.1
+Windows/Win32		implements OpenGL 2.1
+Glide (3dfx Voodoo1/2)	implements OpenGL 1.3
+SVGA			unsupported
+Wind River UGL		unsupported
+DJGPP			unsupported
+GGI			unsupported
+BeOS			unsupported
+Allegro			unsupported
+D3D			unsupported
+
        + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 45746268af..a52c4a7985 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -21,6 +21,8 @@ The release notes summarize what's new or changed in each Mesa release.
        • 7.5 release notes +
        • 7.4.2 release notes +
        • 7.4.2 release notes
        • 7.4.2 release notes
        • 7.4.1 release notes
        • 7.4 release notes -- cgit v1.2.3 From 2a41df86a3580f4d3e8379955492b886056c8b36 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 16:46:21 -0600 Subject: docs: bring over news updates from 7.4 branch --- docs/news.html | 15 +++++++++++++++ 1 file changed, 15 insertions(+) (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index 8cf2f91dd0..ee4a86c2a2 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,21 @@

          News

          +

          June 23, 2009

          +

          +Mesa 7.4.4 is released. +This is a stable release that fixes a regression in the i915/i965 drivers +that slipped into the 7.4.3 release. +

          + + +

          June 19, 2009

          +

          +Mesa 7.4.3 is released. +This is a stable release fixing bugs since the 7.4.2 release. +

          + +

          May 15, 2009

          Mesa 7.4.2 is released. -- cgit v1.2.3 From 4181a107cba1dfcb362084fc98be0c5e7e2aedde Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 16:47:57 -0600 Subject: docs: fix typos, remove old text from relnotes file --- docs/relnotes.html | 11 ++--------- 1 file changed, 2 insertions(+), 9 deletions(-) (limited to 'docs') diff --git a/docs/relnotes.html b/docs/relnotes.html index a52c4a7985..4764eb689d 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -8,21 +8,14 @@

          Release Notes

          -

          -Mesa uses an even/odd version number scheme like the Linux kernel. -Odd numbered versions (such as 6.5) designate new developmental releases. -Even numbered versions (such as 6.4) designate stable releases. -

          - -

          The release notes summarize what's new or changed in each Mesa release.

          • 7.5 release notes -
          • 7.4.2 release notes -
          • 7.4.2 release notes +
          • 7.4.4 release notes +
          • 7.4.3 release notes
          • 7.4.2 release notes
          • 7.4.1 release notes
          • 7.4 release notes -- cgit v1.2.3 From 418987ff05f892d3c33ed4ddbe856c496b05ea14 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 26 Jun 2009 16:54:44 -0600 Subject: docs: detect when too many varying vars are used --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index d0dba30528..045692113d 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -69,6 +69,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
          • Updated SPARC assembly optimizations (David S. Miller)
          • Initial support for separate compilation units in GLSL compiler.
          • Increased max number of generic GLSL varying variables to 16 (formerly 8). +
          • GLSL linker now detects when too many varying variables are used.
          -- cgit v1.2.3 From 36e906aad6d0520db00cc5112fd015497465bc87 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 8 Jul 2009 14:14:03 -0600 Subject: docs: document glMaterial/glShadeModel display list optimization --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 045692113d..541a0f802a 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -70,6 +70,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
        • Initial support for separate compilation units in GLSL compiler.
        • Increased max number of generic GLSL varying variables to 16 (formerly 8).
        • GLSL linker now detects when too many varying variables are used. +
        • Optimize-out redundant glMaterial and glShadeModel calls in display lists
        -- cgit v1.2.3 From 78af70be3727945d2d81a07b99d5a794f1114c05 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 9 Jul 2009 08:04:07 -0600 Subject: docs: document gl_TextureMatrix[i][j] array indexing bug fix --- docs/relnotes-7.5.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 541a0f802a..5a67d3fb52 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -71,6 +71,7 @@ including GL_ATI_separate_stencil, GL_EXT_stencil_two_side and OpenGL 2.0
      • Increased max number of generic GLSL varying variables to 16 (formerly 8).
      • GLSL linker now detects when too many varying variables are used.
      • Optimize-out redundant glMaterial and glShadeModel calls in display lists +
      • Fixed gl_TextureMatrix[i][j] array indexing bug in GLSL compiler.
      -- cgit v1.2.3 From 8c6e81f97dba8c4a108f63a2236915443db6c3cd Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 17 Jul 2009 09:40:28 -0600 Subject: docs: update links to Gallium wiki page on freedesktop.org --- docs/cell.html | 2 +- docs/news.html | 2 +- docs/relnotes-7.5.html | 2 +- 3 files changed, 3 insertions(+), 3 deletions(-) (limited to 'docs') diff --git a/docs/cell.html b/docs/cell.html index ada903cf8a..30626b60b4 100644 --- a/docs/cell.html +++ b/docs/cell.html @@ -12,7 +12,7 @@ The Mesa Cell driver is part of the -Gallium3D +Gallium3D architecture. Tungsten Graphics did the original implementation of the Cell driver.

      diff --git a/docs/news.html b/docs/news.html index ee4a86c2a2..f29f95419f 100644 --- a/docs/news.html +++ b/docs/news.html @@ -99,7 +99,7 @@ Added a new page describing the Mesa Cell driver.

      Gallium3D is the codename for the new Mesa device driver architecture which is currently under development. -A summary of the architecture can be found on the Tungsten Graphics website.

      diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 5a67d3fb52..42b9168548 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -17,7 +17,7 @@ with the 7.4.x branch or wait for Mesa 7.5.1.

      The main new feature of Mesa 7.5 is the -Gallium3D infrastructure.

      -- cgit v1.2.3 From 27587f46e5377dcc7718e80b5bcbedb03e6d7ee3 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 17 Jul 2009 09:40:45 -0600 Subject: docs: news entry for 7.5 release --- docs/news.html | 8 ++++++++ 1 file changed, 8 insertions(+) (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index f29f95419f..712ecedc10 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,14 @@

      News

      +

      July 17, 2009

      +

      +Mesa 7.5 is released. +This is a new features release. People especially concerned about +stability may want to wait for the follow-on 7.5.1 bug-fix release. +

      + +

      June 23, 2009

      Mesa 7.4.4 is released. -- cgit v1.2.3 From 7fd367467273382aeca5952b12111932766279fb Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 17 Jul 2009 12:40:24 -0600 Subject: docs: set date for 7.5 release --- docs/relnotes-7.5.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 42b9168548..8bcacd62e1 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -8,7 +8,7 @@ -

      Mesa 7.5 Release Notes / date TBD

      +

      Mesa 7.5 Release Notes / 17 July 2009

      Mesa 7.5 is a new development release. -- cgit v1.2.3 From b4ba6a66b70b89e9c049f6ce9b65c1edda118651 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 22 Jul 2009 12:49:34 -0600 Subject: docs: initial release notes for 7.5.1 --- docs/relnotes-7.5.1.html | 54 ++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 55 insertions(+) create mode 100644 docs/relnotes-7.5.1.html (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html new file mode 100644 index 0000000000..0f475ad2b4 --- /dev/null +++ b/docs/relnotes-7.5.1.html @@ -0,0 +1,54 @@ + + +Mesa Release Notes + + + + + + + +

      Mesa 7.5.1 Release Notes / (date TBD)

      + +

      +Mesa 7.5.1 is a bug-fix release fixing issues found since the 7.5 release. +

      +

      +The main new feature of Mesa 7.5.x is the +Gallium3D infrastructure. +

      +

      +Mesa 7.5.1 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

      +

      +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

      + + +

      MD5 checksums

      +
      +tbd
+
      + + +

      New features

      +
        +
      + + +

      Bug fixes

      +
        +
      • Added missing GLEW library to MesaDemos tarballs. +
      + + +

      Changes

      +
        +
      + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 4764eb689d..7b91a3dc5e 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -13,6 +13,7 @@ The release notes summarize what's new or changed in each Mesa release.

        +
      • 7.5.1 release notes
      • 7.5 release notes
      • 7.4.4 release notes
      • 7.4.3 release notes -- cgit v1.2.3 From 25e371fb7bd68ca9aba258a89d0d339b5901e1d3 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 17 Jul 2009 16:58:27 -0600 Subject: docs: 7.5 tarball md5sums --- docs/relnotes-7.5.html | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.html b/docs/relnotes-7.5.html index 8bcacd62e1..56deca6a86 100644 --- a/docs/relnotes-7.5.html +++ b/docs/relnotes-7.5.html @@ -40,7 +40,15 @@ If you're especially concerned with stability you should probably look for

        MD5 checksums

        -tbd
+553fd956e544727f30fbe249619b6286  MesaLib-7.5.tar.gz
+459f332551f6ebb86f384d21dd15e1f0  MesaLib-7.5.tar.bz2
+8c02c0e17a9025250d20424ae32f5163  MesaLib-7.5.zip
+a188da2886fa5496ea0c2cda602b2eeb  MesaDemos-7.5.tar.gz
+398ee8801814a00e47f6c2314e3dfddc  MesaDemos-7.5.tar.bz2
+15a0c8ae013c54335a26335e1a98d609  MesaDemos-7.5.zip
+81010147def5a644ba14f9bbb7a49a2a  MesaGLUT-7.5.tar.gz
+baa7a1e850b6e39bae58868fd0684004  MesaGLUT-7.5.tar.bz2
+265228418e4423fa328f2f5b7970cf08  MesaGLUT-7.5.zip
        -- cgit v1.2.3 From 27e55588e0f6c8fb570d3ae601319ed001b7e02a Mon Sep 17 00:00:00 2001 From: "RALOVICH, Kristóf" Date: Thu, 23 Jul 2009 17:57:48 +0200 Subject: docs: do not mentions xthreads any more --- docs/dispatch.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/dispatch.html b/docs/dispatch.html index b9ea8822e6..bcab74c707 100644 --- a/docs/dispatch.html +++ b/docs/dispatch.html @@ -198,7 +198,7 @@ few preprocessor defines.

        • If GLX_USE_TLS is defined, method #4 is used.
        • If PTHREADS is defined, method #3 is used.
          • -
        • If any of PTHREADS, USE_XTHREADS, +
        • If any of PTHREADS, SOLARIS_THREADS, WIN32_THREADS, or BEOS_THREADS is defined, method #2 is used.
        • If none of the preceeding are defined, method #1 is used.
          • -- cgit v1.2.3 From aefaeba54a3ad7104a83ffdaf81ad9d654b990ee Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 30 Jul 2009 08:22:26 -0600 Subject: docs: document new i915/945 extensions --- docs/relnotes-7.6.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 1e7ccf88bf..560d50d0d6 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -46,6 +46,8 @@ This was written by Zack Rusin at Tungsten Graphics.
        • radeon/r200/r300 GL_EXT_framebuffer_object support when used with kernel memory manager
        • r300 driver support for GL_EXT_vertex_array_bgra, GL_EXT_texture_sRGB +
        • i915/945 driver support for GL_ARB_point_sprite, GL_EXT_stencil_two_side + and GL_ATI_separate_stencil extensions
        -- cgit v1.2.3 From 3a221a9018f5166f249671ba41e8d44fe6b3301f Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Tue, 4 Aug 2009 09:27:49 -0600 Subject: docs: 7.5.1 bug fixes --- docs/relnotes-7.5.1.html | 4 ++++ 1 file changed, 4 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 0f475ad2b4..7442decd64 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -43,6 +43,10 @@ tbd

        Bug fixes

        • Added missing GLEW library to MesaDemos tarballs. +
        • Fixed swapbuffers jerkiness in Doom3/etc in Intel drivers. +
        • Fixed front buffer rendering bug in Intel drivers. +
        • Fixed minor GLX memory leaks. +
        • Fixed some texture env / fragment program state bugs.
        -- cgit v1.2.3 From 5b3428d7453eec8e8a5344e22113774dea1dc456 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 5 Aug 2009 13:50:21 -0600 Subject: docs:fix glBlitFramebuffer() for Gallium --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 7442decd64..2a7661f601 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -47,6 +47,7 @@ tbd
      • Fixed front buffer rendering bug in Intel drivers.
      • Fixed minor GLX memory leaks.
      • Fixed some texture env / fragment program state bugs. +
      • Fixed some Gallium glBlitFramebuffer() bugs
      -- cgit v1.2.3 From 9a8781bd24730374e14568f67f7db8a9cc444bb4 Mon Sep 17 00:00:00 2001 From: Tom Fogal Date: Thu, 13 Aug 2009 19:51:57 -0600 Subject: Add a FAQ about internal buffer sizes. --- docs/faq.html | 13 +++++++++++++ 1 file changed, 13 insertions(+) (limited to 'docs') diff --git a/docs/faq.html b/docs/faq.html index 11b5d43255..65e279aac5 100644 --- a/docs/faq.html +++ b/docs/faq.html @@ -316,6 +316,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates will fix the problem.

      +

      3.6 How can I change the maximum framebuffer size in Mesa's +swrast backend?

      +

      +These can be overridden by using the --with-max-width and +--with-max-height options. The two need not be equal. +

      +Do note that Mesa uses these values to size some internal buffers, +so increasing these sizes will cause Mesa to require additional +memory. Furthermore, increasing these limits beyond 4096 +may introduce rasterization artifacts; see the leading comments in +src/mesa/swrast/s_tritemp.h. +

      +

      -- cgit v1.2.3 From c3f9c2eb75f6f07f8b2b98a96b0ddac24a6fa612 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 14 Aug 2009 09:00:15 -0600 Subject: docs: document new --with-max-width/height config options --- docs/relnotes-7.6.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 560d50d0d6..691c0f04ca 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -48,6 +48,8 @@ This was written by Zack Rusin at Tungsten Graphics.
    • r300 driver support for GL_EXT_vertex_array_bgra, GL_EXT_texture_sRGB
    • i915/945 driver support for GL_ARB_point_sprite, GL_EXT_stencil_two_side and GL_ATI_separate_stencil extensions +
    • Added configure --with-max-width=W, --with-max-height=H options to specify + max framebuffer, viewport size.
    -- cgit v1.2.3 From a7ca80ff6af8d3b28b981b518ca39baba20a2d89 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 14 Aug 2009 11:23:18 -0600 Subject: Add a FAQ about internal buffer sizes. (cherry picked from master, commit 9a8781bd24730374e14568f67f7db8a9cc444bb4) --- docs/faq.html | 13 +++++++++++++ 1 file changed, 13 insertions(+) (limited to 'docs') diff --git a/docs/faq.html b/docs/faq.html index 11b5d43255..65e279aac5 100644 --- a/docs/faq.html +++ b/docs/faq.html @@ -316,6 +316,19 @@ Basically, applying a translation of (0.375, 0.375, 0.0) to your coordinates will fix the problem.

    +

    3.6 How can I change the maximum framebuffer size in Mesa's +swrast backend?

    +

    +These can be overridden by using the --with-max-width and +--with-max-height options. The two need not be equal. +

    +Do note that Mesa uses these values to size some internal buffers, +so increasing these sizes will cause Mesa to require additional +memory. Furthermore, increasing these limits beyond 4096 +may introduce rasterization artifacts; see the leading comments in +src/mesa/swrast/s_tritemp.h. +

    +

    -- cgit v1.2.3 From 1574b05189fee1b5802024b505ba93fff345e95c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Fri, 14 Aug 2009 11:24:20 -0600 Subject: docs: docs: document new --with-max-width/height config options --- docs/relnotes-7.5.1.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 2a7661f601..1da086de3b 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -37,6 +37,8 @@ tbd

    New features

      +
    • Added configure --with-max-width=W, --with-max-height=H options to specify + max framebuffer, viewport size.
    -- cgit v1.2.3 From 96f7b422426f8f13f4cedbe280e5dede6b358f2a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 24 Aug 2009 13:02:33 -0600 Subject: docs: recent 7.5.1 bug fixes --- docs/relnotes-7.5.1.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 1da086de3b..77f2dd29b3 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -50,6 +50,8 @@ tbd
  • Fixed minor GLX memory leaks.
  • Fixed some texture env / fragment program state bugs.
  • Fixed some Gallium glBlitFramebuffer() bugs +
  • Empty glBegin/glEnd() pair could cause divide by zero (bug 23489) +
  • Fixed Gallium glBitmap() Z position bug -- cgit v1.2.3 From b879316d4d4b9cea9760ac90882597ba0e2609ab Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 24 Aug 2009 13:02:33 -0600 Subject: docs: recent 7.5.1 bug fixes --- docs/relnotes-7.5.1.html | 2 ++ 1 file changed, 2 insertions(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 1da086de3b..77f2dd29b3 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -50,6 +50,8 @@ tbd
  • Fixed minor GLX memory leaks.
  • Fixed some texture env / fragment program state bugs.
  • Fixed some Gallium glBlitFramebuffer() bugs +
  • Empty glBegin/glEnd() pair could cause divide by zero (bug 23489) +
  • Fixed Gallium glBitmap() Z position bug -- cgit v1.2.3 From d09d03aa42586dd3332863b9b159c497b0cb529b Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Wed, 26 Aug 2009 12:04:35 -0600 Subject: docs: document sampler array bug fix --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 77f2dd29b3..1a327577ba 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -52,6 +52,7 @@ tbd
  • Fixed some Gallium glBlitFramebuffer() bugs
  • Empty glBegin/glEnd() pair could cause divide by zero (bug 23489)
  • Fixed Gallium glBitmap() Z position bug +
  • Setting arrays of sampler uniforms did not work -- cgit v1.2.3 From 0d7bed9f8973547b675c35c0083996e946d7cecb Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 27 Aug 2009 16:50:44 -0600 Subject: docs: fix selection/feedback culling bug --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 1a327577ba..df06302624 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -53,6 +53,7 @@ tbd
  • Empty glBegin/glEnd() pair could cause divide by zero (bug 23489)
  • Fixed Gallium glBitmap() Z position bug
  • Setting arrays of sampler uniforms did not work +
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866) -- cgit v1.2.3 From f7654faf16431d9749fa9f3a8720b4b7fc5c8445 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 31 Aug 2009 10:31:45 -0600 Subject: docs/: document cross-compile fix --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index df06302624..8ac2e632b2 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -54,6 +54,7 @@ tbd
  • Fixed Gallium glBitmap() Z position bug
  • Setting arrays of sampler uniforms did not work
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866) +
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c -- cgit v1.2.3 From 6bf86681f5903a06f98cc32ddf5715706de97c4a Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 31 Aug 2009 10:32:56 -0600 Subject: docs: fixed glXCreateGLXPixmap() for direct rendering --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 8ac2e632b2..320e531e6d 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -55,6 +55,7 @@ tbd
  • Setting arrays of sampler uniforms did not work
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866)
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c +
  • Fixed glXCreateGLXPixmap() for direct rendering. -- cgit v1.2.3 From 1d64a4ceb309949a4ce71f93f86a37ef2d2943c6 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 31 Aug 2009 10:31:45 -0600 Subject: docs/: document cross-compile fix --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index df06302624..8ac2e632b2 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -54,6 +54,7 @@ tbd
  • Fixed Gallium glBitmap() Z position bug
  • Setting arrays of sampler uniforms did not work
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866) +
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c -- cgit v1.2.3 From aca8dbcaa692c5903ae73aacd6fe7272d23f0f03 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 31 Aug 2009 10:32:56 -0600 Subject: docs: fixed glXCreateGLXPixmap() for direct rendering --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 8ac2e632b2..320e531e6d 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -55,6 +55,7 @@ tbd
  • Setting arrays of sampler uniforms did not work
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866)
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c +
  • Fixed glXCreateGLXPixmap() for direct rendering. -- cgit v1.2.3 From 446a71d1f81bc802b5b796d114a4bfa5cc44eaca Mon Sep 17 00:00:00 2001 From: Ian Romanick Date: Thu, 3 Sep 2009 11:22:05 -0700 Subject: docs: Document new extension support for 7.6 release. --- docs/relnotes-7.6.html | 19 +++++++++++++------ 1 file changed, 13 insertions(+), 6 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.6.html b/docs/relnotes-7.6.html index 691c0f04ca..8a476378e8 100644 --- a/docs/relnotes-7.6.html +++ b/docs/relnotes-7.6.html @@ -36,18 +36,25 @@ tbd
    • OpenVG front-end (state tracker for Gallium). This was written by Zack Rusin at Tungsten Graphics. -
    • GL_APPLE_vertex_array_object for Gallium drivers and Intel DRI drivers. -
    • GL_ARB_vertex_array_object for Gallium drivers, software drivers and - Intel DRI drivers. -
    • GL_ARB_copy_buffer extension (supported in Gallium and swrast drivers) -
    • GL_ARB_map_buffer_range extension (supported in Gallium and software drivers) -
    • GL_EXT_provoking_vertex extension (supported in Gallium and software drivers) +
    • GL_ARB_vertex_array_object and GL_APPLE_vertex_array_object extensions + (supported in Gallium drivers, Intel DRI drivers, and software drivers)
      • +
    • GL_ARB_copy_buffer extension + (supported in Gallium drivers, Intel DRI drivers, and software drivers)
      • +
    • GL_ARB_map_buffer_range extension + (supported in Gallium drivers, Intel DRI drivers, and software drivers)
      • +
    • GL_ARB_seamless_cube_map extension + (supported in software drivers and i965 drivers)
      • +
    • GL_ARB_vertex_array_bgra (ARB synonym for GL_EXT_vertex_array_bgra)
      • +
    • GL_ARB_sync (supported in software drivers and Intel DRI drivers)
      • +
    • GL_EXT_provoking_vertex extension (supported in Gallium, i915, i965, and software drivers)
    • Rewritten radeon/r200/r300 driver using a buffer manager
    • radeon/r200/r300 GL_EXT_framebuffer_object support when used with kernel memory manager
    • r300 driver support for GL_EXT_vertex_array_bgra, GL_EXT_texture_sRGB
    • i915/945 driver support for GL_ARB_point_sprite, GL_EXT_stencil_two_side and GL_ATI_separate_stencil extensions +
    • Rewritten assembler for GL_ARB_vertex_program / + GL_ARB_fragment_program.
    • Added configure --with-max-width=W, --with-max-height=H options to specify max framebuffer, viewport size.
    -- cgit v1.2.3 From 47df7900fd37f71bca0f3c4ae19d98866023a6c3 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:56:50 -0600 Subject: docs: move SGI GLU link --- docs/contents.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/contents.html b/docs/contents.html index 1dca3a228d..d15e6c1e33 100644 --- a/docs/contents.html +++ b/docs/contents.html @@ -39,7 +39,6 @@ a:visited { @@ -68,6 +67,7 @@ a:visited {
  • Source Code Repository
  • DRI Memory Management
  • Shading Language +
  • SGI's GLU
  • Utilities
  • Help Wanted
  • Development Notes -- cgit v1.2.3 From ccb081414ba46a6e2d29bcc3c675e875717a8165 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:04 -0600 Subject: docs: update precompiled libs info --- docs/precompiled.html | 12 +++--------- 1 file changed, 3 insertions(+), 9 deletions(-) (limited to 'docs') diff --git a/docs/precompiled.html b/docs/precompiled.html index 166d33d828..50cb2af60d 100644 --- a/docs/precompiled.html +++ b/docs/precompiled.html @@ -9,17 +9,11 @@

    Precompiled Libraries

    -In general, precompiled libraries are not available. -However, people occasionally prepare packages of precompiled libraries -for some systems. +In general, precompiled Mesa libraries are not available.

    - -

    Mesa-6.0 for Solaris

    -

    -Steve Christensen has submitted precompiled Mesa-6.0 libraries for -Solaris at -sunfreeware.com. +However, some Linux distros (such as Ubuntu) seem to closely track +Mesa and often have the latest Mesa release available as an update.

    -- cgit v1.2.3 From 08575509e4d3ac152ebf18a6dc944f233d9a62b0 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:16 -0600 Subject: docs: added news entry for 7.5.1 --- docs/news.html | 7 +++++++ 1 file changed, 7 insertions(+) (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index 712ecedc10..07ad42ed49 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,13 @@

    News

    +

    September 3, 2009

    +

    +Mesa 7.5.1 is released. +This is a bug-fix release which fixes bugs found in version 7.5. +

    + +

    July 17, 2009

    Mesa 7.5 is released. -- cgit v1.2.3 From 0b4e835b13fb240f9c8f9fdc994cb80b99265845 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:30 -0600 Subject: docs: prep for 7.5.1 release --- docs/relnotes-7.5.1.html | 7 ++----- 1 file changed, 2 insertions(+), 5 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 320e531e6d..c65fb85e27 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -8,7 +8,7 @@ -

    Mesa 7.5.1 Release Notes / (date TBD)

    +

    Mesa 7.5.1 Release Notes, 3 September 2009

    Mesa 7.5.1 is a bug-fix release fixing issues found since the 7.5 release. @@ -56,12 +56,9 @@ tbd

  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866)
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c
  • Fixed glXCreateGLXPixmap() for direct rendering. +
  • Fixed Gallium glCopyPixels(GL_STENCIL_INDEX) mispositioned image bug. -

    Changes

    -
      -
    - -- cgit v1.2.3 From 7d3af894d692e1b4c39eb6b24210bd53993723d7 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 15:44:49 -0600 Subject: docs: point to fd.o for downloads instead of SourceForge --- docs/download.html | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) (limited to 'docs') diff --git a/docs/download.html b/docs/download.html index cf1cc21d37..3cb9423dd9 100644 --- a/docs/download.html +++ b/docs/download.html @@ -9,14 +9,14 @@

    Downloading

    -Primary download site: -SourceForge +Primary Mesa download site: +freedesktop.org (FTP)

    -When a new release is coming, release candidates (betas) can be found -here. +When a new release is coming, release candidates (betas) may be found +here.

    -- cgit v1.2.3 From 1960da2e099e3899af3f668e5914162f9293cd6c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 15:49:10 -0600 Subject: docs: 7.5.1 md5 sums --- docs/relnotes-7.5.1.html | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index c65fb85e27..1a4f608b7c 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -31,7 +31,15 @@ for DRI hardware acceleration.

    MD5 checksums

    -tbd
+d7269e93bc7484430637d54ced250876  MesaLib-7.5.1.tar.gz
+877d6a4b24efc2b1d02aa553f262cba8  MesaLib-7.5.1.tar.bz2
+23f4fb757a05c8396425681234ae20e5  MesaLib-7.5.1.zip
+5af4bd113652108f5cec5113dad813f2  MesaDemos-7.5.1.tar.gz
+785402e3b9f0e335538fcc6bf19f6987  MesaDemos-7.5.1.tar.bz2
+950058cc6d6106e9c7d5876a03789fe9  MesaDemos-7.5.1.zip
+cb52ce2c93389c2711cbe8d857ec5303  MesaGLUT-7.5.1.tar.gz
+e3a9892e056d625c5353617a7c5b7e9c  MesaGLUT-7.5.1.tar.bz2
+da1de364df148c94b4994006191a1e69  MesaGLUT-7.5.1.zip
    -- cgit v1.2.3 From 3b96db337d1ffd51f514dd7099ea04c515dc0e45 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Mon, 31 Aug 2009 10:31:45 -0600 Subject: docs/: document cross-compile fix --- docs/relnotes-7.5.1.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index 320e531e6d..d35839db6f 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -56,6 +56,7 @@ tbd
  • Selection/Feedback mode didn't handle polygon culling correctly (bug 16866)
  • Fixed 32/64-bit cross compilation issue in gen_matypes.c
  • Fixed glXCreateGLXPixmap() for direct rendering. +
  • Fixed Gallium glCopyPixels(GL_STENCIL_INDEX) mispositioned image bug. -- cgit v1.2.3 From 7e2f01e0f18d909a1743fe10d7eca10f277baee9 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:56:50 -0600 Subject: docs: move SGI GLU link --- docs/contents.html | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/contents.html b/docs/contents.html index 1dca3a228d..d15e6c1e33 100644 --- a/docs/contents.html +++ b/docs/contents.html @@ -39,7 +39,6 @@ a:visited { @@ -68,6 +67,7 @@ a:visited {
  • Source Code Repository
  • DRI Memory Management
  • Shading Language +
  • SGI's GLU
  • Utilities
  • Help Wanted
  • Development Notes -- cgit v1.2.3 From 4aee0dbf81b273cde57a58b44d613044dc4fdaf4 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:04 -0600 Subject: docs: update precompiled libs info --- docs/precompiled.html | 12 +++--------- 1 file changed, 3 insertions(+), 9 deletions(-) (limited to 'docs') diff --git a/docs/precompiled.html b/docs/precompiled.html index 166d33d828..50cb2af60d 100644 --- a/docs/precompiled.html +++ b/docs/precompiled.html @@ -9,17 +9,11 @@

    Precompiled Libraries

    -In general, precompiled libraries are not available. -However, people occasionally prepare packages of precompiled libraries -for some systems. +In general, precompiled Mesa libraries are not available.

    - -

    Mesa-6.0 for Solaris

    -

    -Steve Christensen has submitted precompiled Mesa-6.0 libraries for -Solaris at -sunfreeware.com. +However, some Linux distros (such as Ubuntu) seem to closely track +Mesa and often have the latest Mesa release available as an update.

    -- cgit v1.2.3 From a04e83ba156c193514db4ddacf85926fa8fad237 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:16 -0600 Subject: docs: added news entry for 7.5.1 --- docs/news.html | 7 +++++++ 1 file changed, 7 insertions(+) (limited to 'docs') diff --git a/docs/news.html b/docs/news.html index 712ecedc10..07ad42ed49 100644 --- a/docs/news.html +++ b/docs/news.html @@ -11,6 +11,13 @@

    News

    +

    September 3, 2009

    +

    +Mesa 7.5.1 is released. +This is a bug-fix release which fixes bugs found in version 7.5. +

    + +

    July 17, 2009

    Mesa 7.5 is released. -- cgit v1.2.3 From f1ae72e9f2cb5e444a45a066f700d71cea4640e5 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 14:57:30 -0600 Subject: docs: prep for 7.5.1 release --- docs/relnotes-7.5.1.html | 6 +----- 1 file changed, 1 insertion(+), 5 deletions(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index d35839db6f..c65fb85e27 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -8,7 +8,7 @@ -

    Mesa 7.5.1 Release Notes / (date TBD)

    +

    Mesa 7.5.1 Release Notes, 3 September 2009

    Mesa 7.5.1 is a bug-fix release fixing issues found since the 7.5 release. @@ -60,9 +60,5 @@ tbd -

    Changes

    -
      -
    - -- cgit v1.2.3 From 5d56e31e1d0bbb595a797548c67f1b567ca6441c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 15:44:49 -0600 Subject: docs: point to fd.o for downloads instead of SourceForge --- docs/download.html | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) (limited to 'docs') diff --git a/docs/download.html b/docs/download.html index cf1cc21d37..3cb9423dd9 100644 --- a/docs/download.html +++ b/docs/download.html @@ -9,14 +9,14 @@

    Downloading

    -Primary download site: -SourceForge +Primary Mesa download site: +freedesktop.org (FTP)

    -When a new release is coming, release candidates (betas) can be found -here. +When a new release is coming, release candidates (betas) may be found +here.

    -- cgit v1.2.3 From f6dff92c9b6dd478d6486865bdc57dd284531f57 Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 3 Sep 2009 15:49:10 -0600 Subject: docs: 7.5.1 md5 sums --- docs/relnotes-7.5.1.html | 10 +++++++++- 1 file changed, 9 insertions(+), 1 deletion(-) (limited to 'docs') diff --git a/docs/relnotes-7.5.1.html b/docs/relnotes-7.5.1.html index c65fb85e27..1a4f608b7c 100644 --- a/docs/relnotes-7.5.1.html +++ b/docs/relnotes-7.5.1.html @@ -31,7 +31,15 @@ for DRI hardware acceleration.

    MD5 checksums

    -tbd
+d7269e93bc7484430637d54ced250876  MesaLib-7.5.1.tar.gz
+877d6a4b24efc2b1d02aa553f262cba8  MesaLib-7.5.1.tar.bz2
+23f4fb757a05c8396425681234ae20e5  MesaLib-7.5.1.zip
+5af4bd113652108f5cec5113dad813f2  MesaDemos-7.5.1.tar.gz
+785402e3b9f0e335538fcc6bf19f6987  MesaDemos-7.5.1.tar.bz2
+950058cc6d6106e9c7d5876a03789fe9  MesaDemos-7.5.1.zip
+cb52ce2c93389c2711cbe8d857ec5303  MesaGLUT-7.5.1.tar.gz
+e3a9892e056d625c5353617a7c5b7e9c  MesaGLUT-7.5.1.tar.bz2
+da1de364df148c94b4994006191a1e69  MesaGLUT-7.5.1.zip
    -- cgit v1.2.3 From 9fff4b46d3c042db65ad3511a0437d5ceef217c7 Mon Sep 17 00:00:00 2001 From: Eric Anholt Date: Tue, 8 Sep 2009 15:00:41 -0700 Subject: docs: Add basic 7.7 relnotes. --- docs/relnotes-7.7.html | 53 ++++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 54 insertions(+) create mode 100644 docs/relnotes-7.7.html (limited to 'docs') diff --git a/docs/relnotes-7.7.html b/docs/relnotes-7.7.html new file mode 100644 index 0000000000..755e8ac520 --- /dev/null +++ b/docs/relnotes-7.7.html @@ -0,0 +1,53 @@ + + +Mesa Release Notes + + + + + + + +

    Mesa 7.7 Release Notes / date TBD

    + +

    +Mesa 7.7 is a new development release. +People who are concerned with stability and reliability should stick +with a previous release or wait for Mesa 7.7.1. +

    +

    +Mesa 7.7 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

    +

    +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

    + + +

    MD5 checksums

    +
    +tbd
+
    + + +

    New features

    +
      +
    • GL_ARB_draw_elements_base_vertex (supported in Intel i965 and software drivers)
      • +
    • GL_ARB_depth_clamp (supported in Intel i965 DRI and software drivers)
      • +
    • GL_NV_depth_clamp (supported in Intel i965 DRI and software drivers)
      • +
    + + +

    Bug fixes

    +
      +
    + + +

    Changes

    +
      +
    + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index ddd2e1cded..c18793c5c3 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -13,6 +13,7 @@ The release notes summarize what's new or changed in each Mesa release.

      +
    • 7.7 release notes
    • 7.6 release notes
    • 7.5.1 release notes
    • 7.5 release notes -- cgit v1.2.3 From 79a3e298c5396df416f655e44a7cad2de6b40aef Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 10 Sep 2009 12:50:08 -0600 Subject: docs: initial 7.5.2 release notes page --- docs/relnotes-7.5.2.html | 51 ++++++++++++++++++++++++++++++++++++++++++++++++ docs/relnotes.html | 1 + 2 files changed, 52 insertions(+) create mode 100644 docs/relnotes-7.5.2.html (limited to 'docs') diff --git a/docs/relnotes-7.5.2.html b/docs/relnotes-7.5.2.html new file mode 100644 index 0000000000..a96b3f0d38 --- /dev/null +++ b/docs/relnotes-7.5.2.html @@ -0,0 +1,51 @@ + + +Mesa Release Notes + + + + + + + +

      Mesa 7.5.2 Release Notes, (date tbd)

      + +

      +Mesa 7.5.2 is a bug-fix release fixing issues found since the 7.5.1 release. +

      +

      +The main new feature of Mesa 7.5.x is the +Gallium3D infrastructure. +

      +

      +Mesa 7.5.2 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +

      +

      +See the Compiling/Installing page for prerequisites +for DRI hardware acceleration. +

      + + +

      MD5 checksums

      +
      +tbd
+
      + + +

      New features

      +
        +
      • Detect B43 chipset in Intel driver +
      + + +

      Bug fixes

      +
        +
      • Assorted bug fixes for i965/i945 drivers +
      + + + + diff --git a/docs/relnotes.html b/docs/relnotes.html index 7b91a3dc5e..9026a28286 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -13,6 +13,7 @@ The release notes summarize what's new or changed in each Mesa release.

        +
      • 7.5.2 release notes
      • 7.5.1 release notes
      • 7.5 release notes
      • 7.4.4 release notes -- cgit v1.2.3 From 4d9bbabb8360a3de5b8659946c7c903356fd176c Mon Sep 17 00:00:00 2001 From: Brian Paul Date: Thu, 10 Sep 2009 14:15:07 -0600 Subject: docs: document Gallium glDrawPixels(GL_STENCIL_INDEX) fix --- docs/relnotes-7.5.2.html | 1 + 1 file changed, 1 insertion(+) (limited to 'docs') diff --git a/docs/relnotes-7.5.2.html b/docs/relnotes-7.5.2.html index a96b3f0d38..32100142c0 100644 --- a/docs/relnotes-7.5.2.html +++ b/docs/relnotes-7.5.2.html @@ -44,6 +44,7 @@ tbd

        Bug fixes

        • Assorted bug fixes for i965/i945 drivers +
        • Fixed Gallium glDrawPixels(GL_STENCIL_INDEX) failure.
        -- cgit v1.2.3