diff options
508 files changed, 13992 insertions, 8885 deletions
@@ -227,6 +227,7 @@ MAIN_FILES = \ $(DIRECTORY)/include/GL/wglext.h \ $(DIRECTORY)/include/GL/wmesa.h \ $(DIRECTORY)/src/glsl/Makefile \ + $(DIRECTORY)/src/glsl/Makefile.template \ $(DIRECTORY)/src/glsl/*/Makefile \ $(DIRECTORY)/src/glsl/*/SConscript \ $(DIRECTORY)/src/glsl/*/*.[ch] \ diff --git a/SConstruct b/SConstruct index 787ff6e2d6..5f6933eadf 100644 --- a/SConstruct +++ b/SConstruct @@ -97,6 +97,9 @@ env.Append(CPPPATH = [ '#/src/gallium/drivers', ]) +if env['msvc']: + env.Append(CPPPATH = ['#include/c99']) + # Posix if platform in ('posix', 'linux', 'freebsd', 'darwin'): @@ -28,15 +28,26 @@ # Given a list of files, look for .a archives and unpack them. # Return the original list of files minus the .a files plus the unpacked files. expand_archives() { + DIR=$1 + shift FILES=$@ NEWFILES="" + ORIG_DIR=`pwd` + mkdir -p "$DIR" + cd "$DIR" for FILE in $FILES ; do case $FILE in *.a) # extract the .o files from this .a archive + case $FILE in + /*) ;; + *) FILE="$ORIG_DIR/$FILE" ;; + esac MEMBERS=`ar t $FILE` ar x $FILE - NEWFILES="$NEWFILES $MEMBERS" + for MEMBER in $MEMBERS ; do + NEWFILES="$NEWFILES $DIR/$MEMBER" + done ;; *) # other file type, just add to list @@ -44,6 +55,7 @@ expand_archives() { ;; esac done + cd "$ORIG_DIR" echo $NEWFILES } @@ -360,13 +372,13 @@ case $ARCH in fi # expand .a into .o files - NEW_OBJECTS=`expand_archives $OBJECTS` + NEW_OBJECTS=`expand_archives ${LIBNAME}.obj $OBJECTS` # make static lib FINAL_LIBS=`make_ar_static_lib ${OPTS} 1 ${LIBNAME} ${NEW_OBJECTS}` # remove temporary extracted .o files - rm -f `contents_of_archives $OBJECTS` + rm -rf ${LIBNAME}.obj else # make dynamic library LIBNAME="lib${LIBNAME}" # prefix with "lib" @@ -553,12 +565,12 @@ case $ARCH in echo "mklib: Making FreeBSD static library: " ${STLIB} # expand .a into .o files - NEW_OBJECTS=`expand_archives $OBJECTS` + NEW_OBJECTS=`expand_archives ${STLIB}.obj $OBJECTS` FINAL_LIBS=`make_ar_static_lib cq 1 ${STLIB} ${NEW_OBJECTS}` # remove temporary extracted .o files - rm -f `contents_of_archives $OBJECTS` + rm -rf ${STLIB}.obj else # make dynamic library SHLIB="lib${LIBNAME}.so.${MAJOR}" diff --git a/configs/autoconf.in b/configs/autoconf.in index b94d9bce46..49c009052b 100644 --- a/configs/autoconf.in +++ b/configs/autoconf.in @@ -22,6 +22,8 @@ LDFLAGS = @LDFLAGS@ EXTRA_LIB_PATH = @EXTRA_LIB_PATH@ RADEON_CFLAGS = @RADEON_CFLAGS@ RADEON_LDFLAGS = @RADEON_LDFLAGS@ +INTEL_LIBS = @INTEL_LIBS@ +INTEL_CFLAGS = @INTEL_CFLAGS@ # Assembler MESA_ASM_SOURCES = @MESA_ASM_SOURCES@ @@ -52,6 +54,7 @@ GLU_LIB_NAME = @GLU_LIB_NAME@ GLUT_LIB_NAME = @GLUT_LIB_NAME@ GLW_LIB_NAME = @GLW_LIB_NAME@ OSMESA_LIB_NAME = @OSMESA_LIB_NAME@ +EGL_LIB_NAME = @EGL_LIB_NAME@ # Globs used to install the lib and all symlinks GL_LIB_GLOB = @GL_LIB_GLOB@ @@ -59,12 +62,14 @@ GLU_LIB_GLOB = @GLU_LIB_GLOB@ GLUT_LIB_GLOB = @GLUT_LIB_GLOB@ GLW_LIB_GLOB = @GLW_LIB_GLOB@ OSMESA_LIB_GLOB = @OSMESA_LIB_GLOB@ +EGL_LIB_GLOB = @EGL_LIB_GLOB@ # Directories to build LIB_DIR = @LIB_DIR@ SRC_DIRS = @SRC_DIRS@ GLU_DIRS = @GLU_DIRS@ DRIVER_DIRS = @DRIVER_DIRS@ +EGL_DRIVERS_DIRS = @EGL_DRIVERS_DIRS@ GALLIUM_DIRS = @GALLIUM_DIRS@ GALLIUM_DRIVERS_DIRS = @GALLIUM_DRIVERS_DIRS@ GALLIUM_WINSYS_DIRS = @GALLIUM_WINSYS_DIRS@ diff --git a/configs/default b/configs/default index 94beca4fa6..f5a4bc195f 100644 --- a/configs/default +++ b/configs/default @@ -55,6 +55,7 @@ GLUT_LIB = glut GLEW_LIB = GLEW GLW_LIB = GLw OSMESA_LIB = OSMesa +EGL_LIB = EGL # Library names (actual file names) @@ -64,6 +65,7 @@ GLUT_LIB_NAME = lib$(GLUT_LIB).so GLEW_LIB_NAME = lib$(GLEW_LIB).a GLW_LIB_NAME = lib$(GLW_LIB).so OSMESA_LIB_NAME = lib$(OSMESA_LIB).so +EGL_LIB_NAME = lib$(EGL_LIB).so # globs used to install the lib and all symlinks GL_LIB_GLOB = $(GL_LIB_NAME)* @@ -71,6 +73,7 @@ GLU_LIB_GLOB = $(GLU_LIB_NAME)* GLUT_LIB_GLOB = $(GLUT_LIB_NAME)* GLW_LIB_GLOB = $(GLW_LIB_NAME)* OSMESA_LIB_GLOB = $(OSMESA_LIB_NAME)* +EGL_LIB_GLOB = $(EGL_LIB_NAME)* # Optional assembly language optimization files for libGL MESA_ASM_SOURCES = @@ -89,7 +92,7 @@ DRIVER_DIRS = x11 osmesa # Which subdirs under $(TOP)/progs/ to enter: PROGRAM_DIRS = demos redbook samples glsl objviewer xdemos -# EGL directories +# EGL drivers to build EGL_DRIVERS_DIRS = demo # Gallium directories and diff --git a/configs/linux-dri b/configs/linux-dri index cf1f4e1983..ff9bcc9396 100644 --- a/configs/linux-dri +++ b/configs/linux-dri @@ -65,3 +65,9 @@ GALLIUM_STATE_TRACKERS_DIRS = egl DRI_DIRS = i810 i915 i965 mach64 mga r128 r200 r300 radeon \ savage sis tdfx unichrome ffb swrast + +INTEL_LIBS = `pkg-config --libs libdrm_intel` +INTEL_CFLAGS = `pkg-config --cflags libdrm_intel` + +RADEON_LIBS = `pkg-config --libs libdrm_radeon` +RADEON_CFLAGS = `pkg-config --cflags libdrm_radeon` diff --git a/configure.ac b/configure.ac index fd300504bf..33437f54f8 100644 --- a/configure.ac +++ b/configure.ac @@ -243,24 +243,28 @@ GLU_LIB_NAME='lib$(GLU_LIB).'${LIB_EXTENSION} GLUT_LIB_NAME='lib$(GLUT_LIB).'${LIB_EXTENSION} GLW_LIB_NAME='lib$(GLW_LIB).'${LIB_EXTENSION} OSMESA_LIB_NAME='lib$(OSMESA_LIB).'${LIB_EXTENSION} +EGL_LIB_NAME='lib$(EGL_LIB).'${LIB_EXTENSION} GL_LIB_GLOB='lib$(GL_LIB).*'${LIB_EXTENSION}'*' GLU_LIB_GLOB='lib$(GLU_LIB).*'${LIB_EXTENSION}'*' GLUT_LIB_GLOB='lib$(GLUT_LIB).*'${LIB_EXTENSION}'*' GLW_LIB_GLOB='lib$(GLW_LIB).*'${LIB_EXTENSION}'*' OSMESA_LIB_GLOB='lib$(OSMESA_LIB).*'${LIB_EXTENSION}'*' +EGL_LIB_GLOB='lib$(EGL_LIB).*'${LIB_EXTENSION}'*' AC_SUBST([GL_LIB_NAME]) AC_SUBST([GLU_LIB_NAME]) AC_SUBST([GLUT_LIB_NAME]) AC_SUBST([GLW_LIB_NAME]) AC_SUBST([OSMESA_LIB_NAME]) +AC_SUBST([EGL_LIB_NAME]) AC_SUBST([GL_LIB_GLOB]) AC_SUBST([GLU_LIB_GLOB]) AC_SUBST([GLUT_LIB_GLOB]) AC_SUBST([GLW_LIB_GLOB]) AC_SUBST([OSMESA_LIB_GLOB]) +AC_SUBST([EGL_LIB_GLOB]) dnl dnl Arch/platform-specific settings @@ -447,8 +451,6 @@ AC_SUBST([GALLIUM_WINSYS_DIRS]) AC_SUBST([GALLIUM_WINSYS_DRM_DIRS]) AC_SUBST([GALLIUM_DRIVERS_DIRS]) AC_SUBST([GALLIUM_STATE_TRACKERS_DIRS]) -AC_SUBST([RADEON_CFLAGS]) -AC_SUBST([RADEON_LDFLAGS]) dnl dnl User supplied program configuration @@ -576,13 +578,6 @@ dri) GL_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED dri2proto >= $DRI2PROTO_REQUIRED" DRI_PC_REQ_PRIV="libdrm >= $LIBDRM_REQUIRED" - PKG_CHECK_MODULES([LIBDRM_RADEON], [libdrm_radeon libdrm >= $LIBDRM_RADEON_REQUIRED], HAVE_LIBDRM_RADEON=yes, HAVE_LIBDRM_RADEON=no) - - if test "$HAVE_LIBDRM_RADEON" = yes; then - RADEON_CFLAGS="-DHAVE_LIBDRM_RADEON=1 $LIBDRM_RADEON_CFLAGS" - RADEON_LDFLAGS=$LIBDRM_RADEON_LIBS - fi - # find the DRI deps for libGL if test "$x11_pkgconfig" = yes; then # add xcb modules if necessary @@ -802,6 +797,29 @@ AC_SUBST([DRI_DIRS]) AC_SUBST([EXPAT_INCLUDES]) AC_SUBST([DRI_LIB_DEPS]) +case $DRI_DIRS in +*i915*|*i965*) + PKG_CHECK_MODULES([INTEL], [libdrm_intel]) + ;; +esac + +case $DRI_DIRS in +*radeon*|*r200*|*r300*|*r600*) + PKG_CHECK_MODULES([LIBDRM_RADEON], + [libdrm_radeon libdrm >= $LIBDRM_RADEON_REQUIRED], + HAVE_LIBDRM_RADEON=yes, + HAVE_LIBDRM_RADEON=no) + + if test "$HAVE_LIBDRM_RADEON" = yes; then + RADEON_CFLAGS="-DHAVE_LIBDRM_RADEON=1 $LIBDRM_RADEON_CFLAGS" + RADEON_LDFLAGS=$LIBDRM_RADEON_LIBS + fi + ;; +esac +AC_SUBST([RADEON_CFLAGS]) +AC_SUBST([RADEON_LDFLAGS]) + + dnl dnl OSMesa configuration dnl @@ -886,17 +904,15 @@ AC_ARG_ENABLE([egl], [enable_egl=yes]) if test "x$enable_egl" = xyes; then SRC_DIRS="$SRC_DIRS egl" - - if test "$x11_pkgconfig" = yes; then - PKG_CHECK_MODULES([EGL], [x11]) - EGL_LIB_DEPS="$EGL_LIBS" - else - # should check these... - EGL_LIB_DEPS="$X_LIBS -lX11" + EGL_LIB_DEPS="$DLOPEN_LIBS -lpthread" + EGL_DRIVERS_DIRS="" + if test "$enable_static" != yes && test "$mesa_driver" != osmesa; then + # build egl_glx when libGL is built + EGL_DRIVERS_DIRS="glx" fi - EGL_LIB_DEPS="$EGL_LIB_DEPS $DLOPEN_LIBS" fi AC_SUBST([EGL_LIB_DEPS]) +AC_SUBST([EGL_DRIVERS_DIRS]) dnl dnl GLU configuration diff --git a/docs/GL3.txt b/docs/GL3.txt index f25459db48..df3fd74549 100644 --- a/docs/GL3.txt +++ b/docs/GL3.txt @@ -13,7 +13,7 @@ Feature Status GL 3.0: GLSL changes (GL_EXT_gpu_shader4, etc) not started -Conditional rendering (GL_NV_conditional_render) DONE (swrast only) +Conditional rendering (GL_NV_conditional_render) DONE (swrast & softpipe) Map buffer subranges (GL_APPLE_flush_buffer_range) not started Float textures, renderbuffers some infrastructure done Framebuffer objects (GL_EXT_framebuffer_object) DONE @@ -30,6 +30,10 @@ Vertex array objects (GL_APPLE_vertex_array_object) DONE sRGB framebuffer format (GL_EXT_framebuffer_sRGB) not started glClearBuffer commands DONE, except for dispatch glGetStringi command DONE, except for dispatch +glTexParameterI, glGetTexParameterI commands DONE, except for dispatch +glVertexAttribI commands not started +glBindFragDataLocation, glGetFragDataLocation cmds not started +glBindBufferRange, glBindBufferBase commands not started GL 3.1: @@ -60,3 +64,6 @@ Frag depth clamp (GL_ARB_depth_clamp) DONE Fence objects (GL_ARB_sync) DONE + +More info about these features and the work involved can be found at +http://dri.freedesktop.org/wiki/MissingFunctionality diff --git a/docs/relnotes-7.7.1.html b/docs/relnotes-7.7.1.html new file mode 100644 index 0000000000..b20c8a7724 --- /dev/null +++ b/docs/relnotes-7.7.1.html @@ -0,0 +1,50 @@ +<HTML> + +<TITLE>Mesa Release Notes</TITLE> + +<head><link rel="stylesheet" type="text/css" href="mesa.css"></head> + +<BODY> + +<body bgcolor="#eeeeee"> + +<H1>Mesa 7.7.1 Release Notes / date tbd</H1> + +<p> +Mesa 7.7.1 is a bug-fix release. +</p> +<p> +Mesa 7.7.1 implements the OpenGL 2.1 API, but the version reported by +glGetString(GL_VERSION) depends on the particular driver being used. +Some drivers don't support all the features required in OpenGL 2.1. +</p> +<p> +See the <a href="install.html">Compiling/Installing page</a> for prerequisites +for DRI hardware acceleration. +</p> + + +<h2>MD5 checksums</h2> +<pre> +tbd +</pre> + + +<h2>New features</h2> +<ul> +<li>tbd +</ul> + + +<h2>Bug fixes</h2> +<ul> +<li>Assorted fixes to VMware SVGA gallium driver. +<li>Fixed broken blending to multiple color buffers in swrast driver. +<li>Allocate constants more tightly in GL_ARB_vertex/fragment parser. +<li>Fixed mipmap generation bug caused by invalid viewport state. +<li>Gallium SSE codegen for XPD didn't always work. +</ul> + + +</body> +</html> diff --git a/docs/relnotes.html b/docs/relnotes.html index d0d9b6e5b9..f1f95c5d3c 100644 --- a/docs/relnotes.html +++ b/docs/relnotes.html @@ -13,7 +13,9 @@ The release notes summarize what's new or changed in each Mesa release. </p> <UL> +<<<<<<< HEAD:docs/relnotes.html <LI><A HREF="relnotes-7.8.html">7.8 release notes</A> +<LI><A HREF="relnotes-7.7.1.html">7.7.1 release notes</A> <LI><A HREF="relnotes-7.7.html">7.7 release notes</A> <LI><A HREF="relnotes-7.6.1.html">7.6.1 release notes</A> <LI><A HREF="relnotes-7.6.html">7.6 release notes</A> diff --git a/include/EGL/eglplatform.h b/include/EGL/eglplatform.h index 9e83b60003..09abb5d844 100644 --- a/include/EGL/eglplatform.h +++ b/include/EGL/eglplatform.h @@ -18,6 +18,11 @@ #include <stdint.h> #endif +#if defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303 +# define EGLAPI __attribute__((visibility("default"))) +# define EGLAPIENTRY +#endif + /* Macros used in EGL function prototype declarations. * * EGLAPI return-type EGLAPIENTRY eglFunction(arguments); diff --git a/include/GL/glew.h b/include/GL/glew.h index 7932a1ce19..04b8f7ed21 100644 --- a/include/GL/glew.h +++ b/include/GL/glew.h @@ -80,7 +80,7 @@ #define __glew_h__ #define __GLEW_H__ -#if defined(__gl_h_) || defined(__GL_H__) +#if defined(__gl_h_) || defined(__GL_H__) || defined(__X_GL_H) #error gl.h included before glew.h #endif #if defined(__glext_h_) || defined(__GLEXT_H_) @@ -92,6 +92,7 @@ #define __gl_h_ #define __GL_H__ +#define __X_GL_H #define __glext_h_ #define __GLEXT_H_ #define __gl_ATI_h_ @@ -106,7 +107,7 @@ /* <windef.h> */ #ifndef APIENTRY #define GLEW_APIENTRY_DEFINED -# if defined(__MINGW32__) +# if defined(__MINGW32__) || defined(__CYGWIN__) # define APIENTRY __stdcall # elif (_MSC_VER >= 800) || defined(_STDCALL_SUPPORTED) || defined(__BORLANDC__) # define APIENTRY __stdcall @@ -115,14 +116,14 @@ # endif #endif #ifndef GLAPI -# if defined(__MINGW32__) +# if defined(__MINGW32__) || defined(__CYGWIN__) # define GLAPI extern # endif #endif /* <winnt.h> */ #ifndef CALLBACK #define GLEW_CALLBACK_DEFINED -# if defined(__MINGW32__) +# if defined(__MINGW32__) || defined(__CYGWIN__) # define CALLBACK __attribute__ ((__stdcall__)) # elif (defined(_M_MRX000) || defined(_M_IX86) || defined(_M_ALPHA) || defined(_M_PPC)) && !defined(MIDL_PASS) # define CALLBACK __stdcall @@ -159,7 +160,7 @@ typedef _W64 int ptrdiff_t; #endif #ifndef GLAPI -# if defined(__MINGW32__) +# if defined(__MINGW32__) || defined(__CYGWIN__) # define GLAPI extern # else # define GLAPI WINGDIAPI @@ -246,12 +247,15 @@ typedef signed long long GLint64EXT; typedef unsigned long long GLuint64EXT; # endif #else -# if defined(__MINGW32__) +# if defined(__MINGW32__) || defined(__CYGWIN__) #include <inttypes.h> # endif typedef int64_t GLint64EXT; typedef uint64_t GLuint64EXT; #endif +typedef GLint64EXT GLint64; +typedef GLuint64EXT GLuint64; +typedef struct __GLsync *GLsync; #define GL_ACCUM 0x0100 #define GL_LOAD 0x0101 @@ -2094,8 +2098,6 @@ typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei typedef void (GLAPIENTRY * PFNGLBEGINCONDITIONALRENDERPROC) (GLuint, GLenum); typedef void (GLAPIENTRY * PFNGLBEGINTRANSFORMFEEDBACKPROC) (GLenum); -typedef void (GLAPIENTRY * PFNGLBINDBUFFERBASEPROC) (GLenum, GLuint, GLuint); -typedef void (GLAPIENTRY * PFNGLBINDBUFFERRANGEPROC) (GLenum, GLuint, GLuint, GLintptr, GLsizeiptr); typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONPROC) (GLuint, GLuint, const GLchar*); typedef void (GLAPIENTRY * PFNGLCLAMPCOLORPROC) (GLenum, GLenum); typedef void (GLAPIENTRY * PFNGLCLEARBUFFERFIPROC) (GLenum, GLint, GLfloat, GLint); @@ -2109,7 +2111,6 @@ typedef void (GLAPIENTRY * PFNGLENDCONDITIONALRENDERPROC) (void); typedef void (GLAPIENTRY * PFNGLENDTRANSFORMFEEDBACKPROC) (void); typedef void (GLAPIENTRY * PFNGLGETBOOLEANI_VPROC) (GLenum, GLuint, GLboolean*); typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATALOCATIONPROC) (GLuint, const GLchar*); -typedef void (GLAPIENTRY * PFNGLGETINTEGERI_VPROC) (GLenum, GLuint, GLint*); typedef const GLubyte* (GLAPIENTRY * PFNGLGETSTRINGIPROC) (GLenum, GLuint); typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIIVPROC) (GLenum, GLenum, GLint*); typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERIUIVPROC) (GLenum, GLenum, GLuint*); @@ -2120,7 +2121,7 @@ typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint, GLenum, GLuint typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDIPROC) (GLenum, GLuint); typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIIVPROC) (GLenum, GLenum, const GLint*); typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIUIVPROC) (GLenum, GLenum, const GLuint*); -typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint, GLsizei, const GLint*, GLenum); +typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint, GLsizei, const GLchar **, GLenum); typedef void (GLAPIENTRY * PFNGLUNIFORM1UIPROC) (GLint, GLuint); typedef void (GLAPIENTRY * PFNGLUNIFORM1UIVPROC) (GLint, GLsizei, const GLuint*); typedef void (GLAPIENTRY * PFNGLUNIFORM2UIPROC) (GLint, GLuint, GLuint); @@ -2153,8 +2154,6 @@ typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint, GLint, GLenum #define glBeginConditionalRender GLEW_GET_FUN(__glewBeginConditionalRender) #define glBeginTransformFeedback GLEW_GET_FUN(__glewBeginTransformFeedback) -#define glBindBufferBase GLEW_GET_FUN(__glewBindBufferBase) -#define glBindBufferRange GLEW_GET_FUN(__glewBindBufferRange) #define glBindFragDataLocation GLEW_GET_FUN(__glewBindFragDataLocation) #define glClampColor GLEW_GET_FUN(__glewClampColor) #define glClearBufferfi GLEW_GET_FUN(__glewClearBufferfi) @@ -2168,7 +2167,6 @@ typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint, GLint, GLenum #define glEndTransformFeedback GLEW_GET_FUN(__glewEndTransformFeedback) #define glGetBooleani_v GLEW_GET_FUN(__glewGetBooleani_v) #define glGetFragDataLocation GLEW_GET_FUN(__glewGetFragDataLocation) -#define glGetIntegeri_v GLEW_GET_FUN(__glewGetIntegeri_v) #define glGetStringi GLEW_GET_FUN(__glewGetStringi) #define glGetTexParameterIiv GLEW_GET_FUN(__glewGetTexParameterIiv) #define glGetTexParameterIuiv GLEW_GET_FUN(__glewGetTexParameterIuiv) @@ -2214,6 +2212,97 @@ typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint, GLint, GLenum #endif /* GL_VERSION_3_0 */ +/* ----------------------------- GL_VERSION_3_1 ---------------------------- */ + +#ifndef GL_VERSION_3_1 +#define GL_VERSION_3_1 1 + +#define GL_TEXTURE_RECTANGLE 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE 0x84F8 +#define GL_SAMPLER_2D_RECT 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW 0x8B64 +#define GL_TEXTURE_BUFFER 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT 0x8C2E +#define GL_SAMPLER_BUFFER 0x8DC2 +#define GL_INT_SAMPLER_2D_RECT 0x8DCD +#define GL_INT_SAMPLER_BUFFER 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER 0x8DD8 +#define GL_RED_SNORM 0x8F90 +#define GL_RG_SNORM 0x8F91 +#define GL_RGB_SNORM 0x8F92 +#define GL_RGBA_SNORM 0x8F93 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGB8_SNORM 0x8F96 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM 0x8F98 +#define GL_RG16_SNORM 0x8F99 +#define GL_RGB16_SNORM 0x8F9A +#define GL_RGBA16_SNORM 0x8F9B +#define GL_SIGNED_NORMALIZED 0x8F9C +#define GL_PRIMITIVE_RESTART 0x8F9D +#define GL_PRIMITIVE_RESTART_INDEX 0x8F9E + +typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum, GLint, GLsizei, GLsizei); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum, GLsizei, GLenum, const GLvoid*, GLsizei); +typedef void (GLAPIENTRY * PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint); +typedef void (GLAPIENTRY * PFNGLTEXBUFFERPROC) (GLenum, GLenum, GLuint); + +#define glDrawArraysInstanced GLEW_GET_FUN(__glewDrawArraysInstanced) +#define glDrawElementsInstanced GLEW_GET_FUN(__glewDrawElementsInstanced) +#define glPrimitiveRestartIndex GLEW_GET_FUN(__glewPrimitiveRestartIndex) +#define glTexBuffer GLEW_GET_FUN(__glewTexBuffer) + +#define GLEW_VERSION_3_1 GLEW_GET_VAR(__GLEW_VERSION_3_1) + +#endif /* GL_VERSION_3_1 */ + +/* ----------------------------- GL_VERSION_3_2 ---------------------------- */ + +#ifndef GL_VERSION_3_2 +#define GL_VERSION_3_2 1 + +#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 +#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 +#define GL_LINES_ADJACENCY 0x000A +#define GL_LINE_STRIP_ADJACENCY 0x000B +#define GL_TRIANGLES_ADJACENCY 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY 0x000D +#define GL_PROGRAM_POINT_SIZE 0x8642 +#define GL_GEOMETRY_VERTICES_OUT 0x8916 +#define GL_GEOMETRY_INPUT_TYPE 0x8917 +#define GL_GEOMETRY_OUTPUT_TYPE 0x8918 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS 0x8DA8 +#define GL_GEOMETRY_SHADER 0x8DD9 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS 0x8DE1 +#define GL_MAX_VERTEX_OUTPUT_COMPONENTS 0x9122 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS 0x9124 +#define GL_MAX_FRAGMENT_INPUT_COMPONENTS 0x9125 +#define GL_CONTEXT_PROFILE_MASK 0x9126 + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum, GLenum, GLuint, GLint); +typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum, GLenum, GLint64 *); +typedef void (GLAPIENTRY * PFNGLGETINTEGER64I_VPROC) (GLenum, GLuint, GLint64 *); + +#define glFramebufferTexture GLEW_GET_FUN(__glewFramebufferTexture) +#define glGetBufferParameteri64v GLEW_GET_FUN(__glewGetBufferParameteri64v) +#define glGetInteger64i_v GLEW_GET_FUN(__glewGetInteger64i_v) + +#define GLEW_VERSION_3_2 GLEW_GET_VAR(__GLEW_VERSION_3_2) + +#endif /* GL_VERSION_3_2 */ + /* -------------------------- GL_3DFX_multisample -------------------------- */ #ifndef GL_3DFX_multisample @@ -2253,6 +2342,111 @@ typedef void (GLAPIENTRY * PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); #endif /* GL_3DFX_texture_compression_FXT1 */ +/* ----------------------- GL_AMD_draw_buffers_blend ----------------------- */ + +#ifndef GL_AMD_draw_buffers_blend +#define GL_AMD_draw_buffers_blend 1 + +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONINDEXEDAMDPROC) (GLuint buf, GLenum mode); +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCINDEXEDAMDPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); + +#define glBlendEquationIndexedAMD GLEW_GET_FUN(__glewBlendEquationIndexedAMD) +#define glBlendEquationSeparateIndexedAMD GLEW_GET_FUN(__glewBlendEquationSeparateIndexedAMD) +#define glBlendFuncIndexedAMD GLEW_GET_FUN(__glewBlendFuncIndexedAMD) +#define glBlendFuncSeparateIndexedAMD GLEW_GET_FUN(__glewBlendFuncSeparateIndexedAMD) + +#define GLEW_AMD_draw_buffers_blend GLEW_GET_VAR(__GLEW_AMD_draw_buffers_blend) + +#endif /* GL_AMD_draw_buffers_blend */ + +/* ----------------------- GL_AMD_performance_monitor ---------------------- */ + +#ifndef GL_AMD_performance_monitor +#define GL_AMD_performance_monitor 1 + +#define GL_UNSIGNED_INT 0x1405 +#define GL_FLOAT 0x1406 +#define GL_COUNTER_TYPE_AMD 0x8BC0 +#define GL_COUNTER_RANGE_AMD 0x8BC1 +#define GL_UNSIGNED_INT64_AMD 0x8BC2 +#define GL_PERCENTAGE_AMD 0x8BC3 +#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 +#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 +#define GL_PERFMON_RESULT_AMD 0x8BC6 + +typedef void (GLAPIENTRY * PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); +typedef void (GLAPIENTRY * PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors); +typedef void (GLAPIENTRY * PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); +typedef void (GLAPIENTRY * PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint* monitors); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint* data, GLint *bytesWritten); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void* data); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei* length, char *counterString); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint* numCounters, GLint *maxActiveCounters, GLsizei countersSize, GLuint *counters); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei* length, char *groupString); +typedef void (GLAPIENTRY * PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint* numGroups, GLsizei groupsSize, GLuint *groups); +typedef void (GLAPIENTRY * PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint* counterList); + +#define glBeginPerfMonitorAMD GLEW_GET_FUN(__glewBeginPerfMonitorAMD) +#define glDeletePerfMonitorsAMD GLEW_GET_FUN(__glewDeletePerfMonitorsAMD) +#define glEndPerfMonitorAMD GLEW_GET_FUN(__glewEndPerfMonitorAMD) +#define glGenPerfMonitorsAMD GLEW_GET_FUN(__glewGenPerfMonitorsAMD) +#define glGetPerfMonitorCounterDataAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterDataAMD) +#define glGetPerfMonitorCounterInfoAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterInfoAMD) +#define glGetPerfMonitorCounterStringAMD GLEW_GET_FUN(__glewGetPerfMonitorCounterStringAMD) +#define glGetPerfMonitorCountersAMD GLEW_GET_FUN(__glewGetPerfMonitorCountersAMD) +#define glGetPerfMonitorGroupStringAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupStringAMD) +#define glGetPerfMonitorGroupsAMD GLEW_GET_FUN(__glewGetPerfMonitorGroupsAMD) +#define glSelectPerfMonitorCountersAMD GLEW_GET_FUN(__glewSelectPerfMonitorCountersAMD) + +#define GLEW_AMD_performance_monitor GLEW_GET_VAR(__GLEW_AMD_performance_monitor) + +#endif /* GL_AMD_performance_monitor */ + +/* ------------------------ GL_AMD_texture_texture4 ------------------------ */ + +#ifndef GL_AMD_texture_texture4 +#define GL_AMD_texture_texture4 1 + +#define GLEW_AMD_texture_texture4 GLEW_GET_VAR(__GLEW_AMD_texture_texture4) + +#endif /* GL_AMD_texture_texture4 */ + +/* -------------------- GL_AMD_vertex_shader_tessellator ------------------- */ + +#ifndef GL_AMD_vertex_shader_tessellator +#define GL_AMD_vertex_shader_tessellator 1 + +#define GL_SAMPLER_BUFFER_AMD 0x9001 +#define GL_INT_SAMPLER_BUFFER_AMD 0x9002 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_AMD 0x9003 +#define GL_TESSELLATION_MODE_AMD 0x9004 +#define GL_TESSELLATION_FACTOR_AMD 0x9005 +#define GL_DISCRETE_AMD 0x9006 +#define GL_CONTINUOUS_AMD 0x9007 + +typedef void (GLAPIENTRY * PFNGLTESSELLATIONFACTORAMDPROC) (GLfloat factor); +typedef void (GLAPIENTRY * PFNGLTESSELLATIONMODEAMDPROC) (GLenum mode); + +#define glTessellationFactorAMD GLEW_GET_FUN(__glewTessellationFactorAMD) +#define glTessellationModeAMD GLEW_GET_FUN(__glewTessellationModeAMD) + +#define GLEW_AMD_vertex_shader_tessellator GLEW_GET_VAR(__GLEW_AMD_vertex_shader_tessellator) + +#endif /* GL_AMD_vertex_shader_tessellator */ + +/* ----------------------- GL_APPLE_aux_depth_stencil ---------------------- */ + +#ifndef GL_APPLE_aux_depth_stencil +#define GL_APPLE_aux_depth_stencil 1 + +#define GL_AUX_DEPTH_STENCIL_APPLE 0x8A14 + +#define GLEW_APPLE_aux_depth_stencil GLEW_GET_VAR(__GLEW_APPLE_aux_depth_stencil) + +#endif /* GL_APPLE_aux_depth_stencil */ + /* ------------------------ GL_APPLE_client_storage ------------------------ */ #ifndef GL_APPLE_client_storage @@ -2361,6 +2555,30 @@ typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, #endif /* GL_APPLE_flush_buffer_range */ +/* ----------------------- GL_APPLE_object_purgeable ----------------------- */ + +#ifndef GL_APPLE_object_purgeable +#define GL_APPLE_object_purgeable 1 + +#define GL_BUFFER_OBJECT_APPLE 0x85B3 +#define GL_RELEASED_APPLE 0x8A19 +#define GL_VOLATILE_APPLE 0x8A1A +#define GL_RETAINED_APPLE 0x8A1B +#define GL_UNDEFINED_APPLE 0x8A1C +#define GL_PURGEABLE_APPLE 0x8A1D + +typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVAPPLEPROC) (GLenum objectType, GLuint name, GLenum pname, GLint* params); +typedef GLenum (GLAPIENTRY * PFNGLOBJECTPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); +typedef GLenum (GLAPIENTRY * PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); + +#define glGetObjectParameterivAPPLE GLEW_GET_FUN(__glewGetObjectParameterivAPPLE) +#define glObjectPurgeableAPPLE GLEW_GET_FUN(__glewObjectPurgeableAPPLE) +#define glObjectUnpurgeableAPPLE GLEW_GET_FUN(__glewObjectUnpurgeableAPPLE) + +#define GLEW_APPLE_object_purgeable GLEW_GET_VAR(__GLEW_APPLE_object_purgeable) + +#endif /* GL_APPLE_object_purgeable */ + /* ------------------------- GL_APPLE_pixel_buffer ------------------------- */ #ifndef GL_APPLE_pixel_buffer @@ -2372,6 +2590,31 @@ typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, #endif /* GL_APPLE_pixel_buffer */ +/* ---------------------------- GL_APPLE_rgb_422 --------------------------- */ + +#ifndef GL_APPLE_rgb_422 +#define GL_APPLE_rgb_422 1 + +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_422_APPLE 0x8A1F + +#define GLEW_APPLE_rgb_422 GLEW_GET_VAR(__GLEW_APPLE_rgb_422) + +#endif /* GL_APPLE_rgb_422 */ + +/* --------------------------- GL_APPLE_row_bytes -------------------------- */ + +#ifndef GL_APPLE_row_bytes +#define GL_APPLE_row_bytes 1 + +#define GL_PACK_ROW_BYTES_APPLE 0x8A15 +#define GL_UNPACK_ROW_BYTES_APPLE 0x8A16 + +#define GLEW_APPLE_row_bytes GLEW_GET_VAR(__GLEW_APPLE_row_bytes) + +#endif /* GL_APPLE_row_bytes */ + /* ------------------------ GL_APPLE_specular_vector ----------------------- */ #ifndef GL_APPLE_specular_vector @@ -2462,6 +2705,42 @@ typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void #endif /* GL_APPLE_vertex_array_range */ +/* ------------------- GL_APPLE_vertex_program_evaluators ------------------ */ + +#ifndef GL_APPLE_vertex_program_evaluators +#define GL_APPLE_vertex_program_evaluators 1 + +#define GL_VERTEX_ATTRIB_MAP1_APPLE 0x8A00 +#define GL_VERTEX_ATTRIB_MAP2_APPLE 0x8A01 +#define GL_VERTEX_ATTRIB_MAP1_SIZE_APPLE 0x8A02 +#define GL_VERTEX_ATTRIB_MAP1_COEFF_APPLE 0x8A03 +#define GL_VERTEX_ATTRIB_MAP1_ORDER_APPLE 0x8A04 +#define GL_VERTEX_ATTRIB_MAP1_DOMAIN_APPLE 0x8A05 +#define GL_VERTEX_ATTRIB_MAP2_SIZE_APPLE 0x8A06 +#define GL_VERTEX_ATTRIB_MAP2_COEFF_APPLE 0x8A07 +#define GL_VERTEX_ATTRIB_MAP2_ORDER_APPLE 0x8A08 +#define GL_VERTEX_ATTRIB_MAP2_DOMAIN_APPLE 0x8A09 + +typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef void (GLAPIENTRY * PFNGLENABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef GLboolean (GLAPIENTRY * PFNGLISVERTEXATTRIBENABLEDAPPLEPROC) (GLuint index, GLenum pname); +typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble* points); +typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB1FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat* points); +typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble* points); +typedef void (GLAPIENTRY * PFNGLMAPVERTEXATTRIB2FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat* points); + +#define glDisableVertexAttribAPPLE GLEW_GET_FUN(__glewDisableVertexAttribAPPLE) +#define glEnableVertexAttribAPPLE GLEW_GET_FUN(__glewEnableVertexAttribAPPLE) +#define glIsVertexAttribEnabledAPPLE GLEW_GET_FUN(__glewIsVertexAttribEnabledAPPLE) +#define glMapVertexAttrib1dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1dAPPLE) +#define glMapVertexAttrib1fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib1fAPPLE) +#define glMapVertexAttrib2dAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2dAPPLE) +#define glMapVertexAttrib2fAPPLE GLEW_GET_FUN(__glewMapVertexAttrib2fAPPLE) + +#define GLEW_APPLE_vertex_program_evaluators GLEW_GET_VAR(__GLEW_APPLE_vertex_program_evaluators) + +#endif /* GL_APPLE_vertex_program_evaluators */ + /* --------------------------- GL_APPLE_ycbcr_422 -------------------------- */ #ifndef GL_APPLE_ycbcr_422 @@ -2494,6 +2773,31 @@ typedef void (GLAPIENTRY * PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp) #endif /* GL_ARB_color_buffer_float */ +/* -------------------------- GL_ARB_compatibility ------------------------- */ + +#ifndef GL_ARB_compatibility +#define GL_ARB_compatibility 1 + +#define GLEW_ARB_compatibility GLEW_GET_VAR(__GLEW_ARB_compatibility) + +#endif /* GL_ARB_compatibility */ + +/* --------------------------- GL_ARB_copy_buffer -------------------------- */ + +#ifndef GL_ARB_copy_buffer +#define GL_ARB_copy_buffer 1 + +#define GL_COPY_READ_BUFFER 0x8F36 +#define GL_COPY_WRITE_BUFFER 0x8F37 + +typedef void (GLAPIENTRY * PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readtarget, GLenum writetarget, GLintptr readoffset, GLintptr writeoffset, GLsizeiptr size); + +#define glCopyBufferSubData GLEW_GET_FUN(__glewCopyBufferSubData) + +#define GLEW_ARB_copy_buffer GLEW_GET_VAR(__GLEW_ARB_copy_buffer) + +#endif /* GL_ARB_copy_buffer */ + /* ----------------------- GL_ARB_depth_buffer_float ----------------------- */ #ifndef GL_ARB_depth_buffer_float @@ -2507,6 +2811,17 @@ typedef void (GLAPIENTRY * PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp) #endif /* GL_ARB_depth_buffer_float */ +/* --------------------------- GL_ARB_depth_clamp -------------------------- */ + +#ifndef GL_ARB_depth_clamp +#define GL_ARB_depth_clamp 1 + +#define GL_DEPTH_CLAMP 0x864F + +#define GLEW_ARB_depth_clamp GLEW_GET_VAR(__GLEW_ARB_depth_clamp) + +#endif /* GL_ARB_depth_clamp */ + /* -------------------------- GL_ARB_depth_texture ------------------------- */ #ifndef GL_ARB_depth_texture @@ -2553,6 +2868,44 @@ typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum* bu #endif /* GL_ARB_draw_buffers */ +/* ----------------------- GL_ARB_draw_buffers_blend ----------------------- */ + +#ifndef GL_ARB_draw_buffers_blend +#define GL_ARB_draw_buffers_blend 1 + +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst); + +#define glBlendEquationSeparateiARB GLEW_GET_FUN(__glewBlendEquationSeparateiARB) +#define glBlendEquationiARB GLEW_GET_FUN(__glewBlendEquationiARB) +#define glBlendFuncSeparateiARB GLEW_GET_FUN(__glewBlendFuncSeparateiARB) +#define glBlendFunciARB GLEW_GET_FUN(__glewBlendFunciARB) + +#define GLEW_ARB_draw_buffers_blend GLEW_GET_VAR(__GLEW_ARB_draw_buffers_blend) + +#endif /* GL_ARB_draw_buffers_blend */ + +/* -------------------- GL_ARB_draw_elements_base_vertex ------------------- */ + +#ifndef GL_ARB_draw_elements_base_vertex +#define GL_ARB_draw_elements_base_vertex 1 + +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, void* indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void* indices, GLsizei primcount, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, void* indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei* count, GLenum type, GLvoid**indices, GLsizei primcount, GLint *basevertex); + +#define glDrawElementsBaseVertex GLEW_GET_FUN(__glewDrawElementsBaseVertex) +#define glDrawElementsInstancedBaseVertex GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertex) +#define glDrawRangeElementsBaseVertex GLEW_GET_FUN(__glewDrawRangeElementsBaseVertex) +#define glMultiDrawElementsBaseVertex GLEW_GET_FUN(__glewMultiDrawElementsBaseVertex) + +#define GLEW_ARB_draw_elements_base_vertex GLEW_GET_VAR(__GLEW_ARB_draw_elements_base_vertex) + +#endif /* GL_ARB_draw_elements_base_vertex */ + /* ------------------------- GL_ARB_draw_instanced ------------------------- */ #ifndef GL_ARB_draw_instanced @@ -2568,6 +2921,15 @@ typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsi #endif /* GL_ARB_draw_instanced */ +/* ------------------- GL_ARB_fragment_coord_conventions ------------------- */ + +#ifndef GL_ARB_fragment_coord_conventions +#define GL_ARB_fragment_coord_conventions 1 + +#define GLEW_ARB_fragment_coord_conventions GLEW_GET_VAR(__GLEW_ARB_fragment_coord_conventions) + +#endif /* GL_ARB_fragment_coord_conventions */ + /* ------------------------ GL_ARB_fragment_program ------------------------ */ #ifndef GL_ARB_fragment_program @@ -2702,10 +3064,10 @@ typedef GLenum (GLAPIENTRY * PFNGLCHECKFRAMEBUFFERSTATUSPROC) (GLenum target); typedef void (GLAPIENTRY * PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint* framebuffers); typedef void (GLAPIENTRY * PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint* renderbuffers); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); -typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target,GLenum attachment, GLuint texture,GLint level,GLint layer); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint layer); +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target,GLenum attachment, GLuint texture,GLint level,GLint layer); typedef void (GLAPIENTRY * PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint* framebuffers); typedef void (GLAPIENTRY * PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint* renderbuffers); typedef void (GLAPIENTRY * PFNGLGENERATEMIPMAPPROC) (GLenum target); @@ -2723,10 +3085,10 @@ typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum targ #define glDeleteFramebuffers GLEW_GET_FUN(__glewDeleteFramebuffers) #define glDeleteRenderbuffers GLEW_GET_FUN(__glewDeleteRenderbuffers) #define glFramebufferRenderbuffer GLEW_GET_FUN(__glewFramebufferRenderbuffer) -#define glFramebufferTextureLayer GLEW_GET_FUN(__glewFramebufferTextureLayer) #define glFramebufferTexture1D GLEW_GET_FUN(__glewFramebufferTexture1D) #define glFramebufferTexture2D GLEW_GET_FUN(__glewFramebufferTexture2D) #define glFramebufferTexture3D GLEW_GET_FUN(__glewFramebufferTexture3D) +#define glFramebufferTextureLayer GLEW_GET_FUN(__glewFramebufferTextureLayer) #define glGenFramebuffers GLEW_GET_FUN(__glewGenFramebuffers) #define glGenRenderbuffers GLEW_GET_FUN(__glewGenRenderbuffers) #define glGenerateMipmap GLEW_GET_FUN(__glewGenerateMipmap) @@ -3252,6 +3614,51 @@ typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, GLfloat* #endif /* GL_ARB_point_sprite */ +/* ------------------------ GL_ARB_provoking_vertex ------------------------ */ + +#ifndef GL_ARB_provoking_vertex +#define GL_ARB_provoking_vertex 1 + +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION 0x8E4D +#define GL_LAST_VERTEX_CONVENTION 0x8E4E +#define GL_PROVOKING_VERTEX 0x8E4F + +typedef void (GLAPIENTRY * PFNGLPROVOKINGVERTEXPROC) (GLenum mode); + +#define glProvokingVertex GLEW_GET_FUN(__glewProvokingVertex) + +#define GLEW_ARB_provoking_vertex GLEW_GET_VAR(__GLEW_ARB_provoking_vertex) + +#endif /* GL_ARB_provoking_vertex */ + +/* ------------------------- GL_ARB_sample_shading ------------------------- */ + +#ifndef GL_ARB_sample_shading +#define GL_ARB_sample_shading 1 + +#define GL_SAMPLE_SHADING_ARB 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE_ARB 0x8C37 + +typedef void (GLAPIENTRY * PFNGLMINSAMPLESHADINGARBPROC) (GLclampf value); + +#define glMinSampleShadingARB GLEW_GET_FUN(__glewMinSampleShadingARB) + +#define GLEW_ARB_sample_shading GLEW_GET_VAR(__GLEW_ARB_sample_shading) + +#endif /* GL_ARB_sample_shading */ + +/* ------------------------ GL_ARB_seamless_cube_map ----------------------- */ + +#ifndef GL_ARB_seamless_cube_map +#define GL_ARB_seamless_cube_map 1 + +#define GL_TEXTURE_CUBE_MAP_SEAMLESS 0x884F + +#define GLEW_ARB_seamless_cube_map GLEW_GET_VAR(__GLEW_ARB_seamless_cube_map) + +#endif /* GL_ARB_seamless_cube_map */ + /* ------------------------- GL_ARB_shader_objects ------------------------- */ #ifndef GL_ARB_shader_objects @@ -3379,6 +3786,15 @@ typedef void (GLAPIENTRY * PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj) #endif /* GL_ARB_shader_objects */ +/* ----------------------- GL_ARB_shader_texture_lod ----------------------- */ + +#ifndef GL_ARB_shader_texture_lod +#define GL_ARB_shader_texture_lod 1 + +#define GLEW_ARB_shader_texture_lod GLEW_GET_VAR(__GLEW_ARB_shader_texture_lod) + +#endif /* GL_ARB_shader_texture_lod */ + /* ---------------------- GL_ARB_shading_language_100 ---------------------- */ #ifndef GL_ARB_shading_language_100 @@ -3414,6 +3830,47 @@ typedef void (GLAPIENTRY * PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj) #endif /* GL_ARB_shadow_ambient */ +/* ------------------------------ GL_ARB_sync ------------------------------ */ + +#ifndef GL_ARB_sync +#define GL_ARB_sync 1 + +#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001 +#define GL_MAX_SERVER_WAIT_TIMEOUT 0x9111 +#define GL_OBJECT_TYPE 0x9112 +#define GL_SYNC_CONDITION 0x9113 +#define GL_SYNC_STATUS 0x9114 +#define GL_SYNC_FLAGS 0x9115 +#define GL_SYNC_FENCE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE 0x9117 +#define GL_UNSIGNALED 0x9118 +#define GL_SIGNALED 0x9119 +#define GL_ALREADY_SIGNALED 0x911A +#define GL_TIMEOUT_EXPIRED 0x911B +#define GL_CONDITION_SATISFIED 0x911C +#define GL_WAIT_FAILED 0x911D +#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFF + +typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout); +typedef void (GLAPIENTRY * PFNGLDELETESYNCPROC) (GLsync GLsync); +typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCPROC) (GLenum condition,GLbitfield flags); +typedef void (GLAPIENTRY * PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64* params); +typedef void (GLAPIENTRY * PFNGLGETSYNCIVPROC) (GLsync GLsync,GLenum pname,GLsizei bufSize,GLsizei* length, GLint *values); +typedef GLboolean (GLAPIENTRY * PFNGLISSYNCPROC) (GLsync GLsync); +typedef void (GLAPIENTRY * PFNGLWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout); + +#define glClientWaitSync GLEW_GET_FUN(__glewClientWaitSync) +#define glDeleteSync GLEW_GET_FUN(__glewDeleteSync) +#define glFenceSync GLEW_GET_FUN(__glewFenceSync) +#define glGetInteger64v GLEW_GET_FUN(__glewGetInteger64v) +#define glGetSynciv GLEW_GET_FUN(__glewGetSynciv) +#define glIsSync GLEW_GET_FUN(__glewIsSync) +#define glWaitSync GLEW_GET_FUN(__glewWaitSync) + +#define GLEW_ARB_sync GLEW_GET_VAR(__GLEW_ARB_sync) + +#endif /* GL_ARB_sync */ + /* ---------------------- GL_ARB_texture_border_clamp ---------------------- */ #ifndef GL_ARB_texture_border_clamp @@ -3517,6 +3974,23 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #endif /* GL_ARB_texture_cube_map */ +/* --------------------- GL_ARB_texture_cube_map_array --------------------- */ + +#ifndef GL_ARB_texture_cube_map_array +#define GL_ARB_texture_cube_map_array 1 + +#define GL_TEXTURE_CUBE_MAP_ARRAY_ARB 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_ARB 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY_ARB 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_ARB 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900F + +#define GLEW_ARB_texture_cube_map_array GLEW_GET_VAR(__GLEW_ARB_texture_cube_map_array) + +#endif /* GL_ARB_texture_cube_map_array */ + /* ------------------------- GL_ARB_texture_env_add ------------------------ */ #ifndef GL_ARB_texture_env_add @@ -3609,6 +4083,19 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #endif /* GL_ARB_texture_float */ +/* ------------------------- GL_ARB_texture_gather ------------------------- */ + +#ifndef GL_ARB_texture_gather +#define GL_ARB_texture_gather 1 + +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5F +#define GL_MAX_PROGRAM_TEXTURE_GATHER_COMPONENTS_ARB 0x8F9F + +#define GLEW_ARB_texture_gather GLEW_GET_VAR(__GLEW_ARB_texture_gather) + +#endif /* GL_ARB_texture_gather */ + /* --------------------- GL_ARB_texture_mirrored_repeat -------------------- */ #ifndef GL_ARB_texture_mirrored_repeat @@ -3620,6 +4107,47 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #endif /* GL_ARB_texture_mirrored_repeat */ +/* ----------------------- GL_ARB_texture_multisample ---------------------- */ + +#ifndef GL_ARB_texture_multisample +#define GL_ARB_texture_multisample 1 + +#define GL_SAMPLE_POSITION 0x8E50 +#define GL_SAMPLE_MASK 0x8E51 +#define GL_SAMPLE_MASK_VALUE 0x8E52 +#define GL_MAX_SAMPLE_MASK_WORDS 0x8E59 +#define GL_TEXTURE_2D_MULTISAMPLE 0x9100 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE 0x9101 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9102 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9103 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE 0x9104 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY 0x9105 +#define GL_TEXTURE_SAMPLES 0x9106 +#define GL_TEXTURE_FIXED_SAMPLE_LOCATIONS 0x9107 +#define GL_SAMPLER_2D_MULTISAMPLE 0x9108 +#define GL_INT_SAMPLER_2D_MULTISAMPLE 0x9109 +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE 0x910A +#define GL_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910B +#define GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910C +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910D +#define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E +#define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F +#define GL_MAX_INTEGER_SAMPLES 0x9110 + +typedef void (GLAPIENTRY * PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat* val); +typedef void (GLAPIENTRY * PFNGLSAMPLEMASKIPROC) (GLuint index, GLbitfield mask); +typedef void (GLAPIENTRY * PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); + +#define glGetMultisamplefv GLEW_GET_FUN(__glewGetMultisamplefv) +#define glSampleMaski GLEW_GET_FUN(__glewSampleMaski) +#define glTexImage2DMultisample GLEW_GET_FUN(__glewTexImage2DMultisample) +#define glTexImage3DMultisample GLEW_GET_FUN(__glewTexImage3DMultisample) + +#define GLEW_ARB_texture_multisample GLEW_GET_VAR(__GLEW_ARB_texture_multisample) + +#endif /* GL_ARB_texture_multisample */ + /* -------------------- GL_ARB_texture_non_power_of_two -------------------- */ #ifndef GL_ARB_texture_non_power_of_two @@ -3629,6 +4157,15 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #endif /* GL_ARB_texture_non_power_of_two */ +/* ------------------------ GL_ARB_texture_query_lod ----------------------- */ + +#ifndef GL_ARB_texture_query_lod +#define GL_ARB_texture_query_lod 1 + +#define GLEW_ARB_texture_query_lod GLEW_GET_VAR(__GLEW_ARB_texture_query_lod) + +#endif /* GL_ARB_texture_query_lod */ + /* ------------------------ GL_ARB_texture_rectangle ----------------------- */ #ifndef GL_ARB_texture_rectangle @@ -3651,6 +4188,8 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #define GL_ARB_texture_rg 1 #define GL_RED 0x1903 +#define GL_COMPRESSED_RED 0x8225 +#define GL_COMPRESSED_RG 0x8226 #define GL_RG 0x8227 #define GL_RG_INTEGER 0x8228 #define GL_R8 0x8229 @@ -3702,6 +4241,82 @@ typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXFARBPROC) (GLfloat m[16]); #endif /* GL_ARB_transpose_matrix */ +/* ---------------------- GL_ARB_uniform_buffer_object --------------------- */ + +#ifndef GL_ARB_uniform_buffer_object +#define GL_ARB_uniform_buffer_object 1 + +#define GL_UNIFORM_BUFFER 0x8A11 +#define GL_UNIFORM_BUFFER_BINDING 0x8A28 +#define GL_UNIFORM_BUFFER_START 0x8A29 +#define GL_UNIFORM_BUFFER_SIZE 0x8A2A +#define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C +#define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D +#define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E +#define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F +#define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 +#define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 +#define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 +#define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 +#define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 +#define GL_ACTIVE_UNIFORM_BLOCKS 0x8A36 +#define GL_UNIFORM_TYPE 0x8A37 +#define GL_UNIFORM_SIZE 0x8A38 +#define GL_UNIFORM_NAME_LENGTH 0x8A39 +#define GL_UNIFORM_BLOCK_INDEX 0x8A3A +#define GL_UNIFORM_OFFSET 0x8A3B +#define GL_UNIFORM_ARRAY_STRIDE 0x8A3C +#define GL_UNIFORM_MATRIX_STRIDE 0x8A3D +#define GL_UNIFORM_IS_ROW_MAJOR 0x8A3E +#define GL_UNIFORM_BLOCK_BINDING 0x8A3F +#define GL_UNIFORM_BLOCK_DATA_SIZE 0x8A40 +#define GL_UNIFORM_BLOCK_NAME_LENGTH 0x8A41 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 +#define GL_INVALID_INDEX 0xFFFFFFFF + +typedef void (GLAPIENTRY * PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (GLAPIENTRY * PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei* length, char* uniformBlockName); +typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMBLOCKIVPROC) (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMNAMEPROC) (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei* length, char* uniformName); +typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMSIVPROC) (GLuint program, GLsizei uniformCount, const GLuint* uniformIndices, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLGETINTEGERI_VPROC) (GLenum target, GLuint index, GLint* data); +typedef GLuint (GLAPIENTRY * PFNGLGETUNIFORMBLOCKINDEXPROC) (GLuint program, const char* uniformBlockName); +typedef void (GLAPIENTRY * PFNGLGETUNIFORMINDICESPROC) (GLuint program, GLsizei uniformCount, const char** uniformNames, GLuint* uniformIndices); +typedef void (GLAPIENTRY * PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); + +#define glBindBufferBase GLEW_GET_FUN(__glewBindBufferBase) +#define glBindBufferRange GLEW_GET_FUN(__glewBindBufferRange) +#define glGetActiveUniformBlockName GLEW_GET_FUN(__glewGetActiveUniformBlockName) +#define glGetActiveUniformBlockiv GLEW_GET_FUN(__glewGetActiveUniformBlockiv) +#define glGetActiveUniformName GLEW_GET_FUN(__glewGetActiveUniformName) +#define glGetActiveUniformsiv GLEW_GET_FUN(__glewGetActiveUniformsiv) +#define glGetIntegeri_v GLEW_GET_FUN(__glewGetIntegeri_v) +#define glGetUniformBlockIndex GLEW_GET_FUN(__glewGetUniformBlockIndex) +#define glGetUniformIndices GLEW_GET_FUN(__glewGetUniformIndices) +#define glUniformBlockBinding GLEW_GET_FUN(__glewUniformBlockBinding) + +#define GLEW_ARB_uniform_buffer_object GLEW_GET_VAR(__GLEW_ARB_uniform_buffer_object) + +#endif /* GL_ARB_uniform_buffer_object */ + +/* ------------------------ GL_ARB_vertex_array_bgra ----------------------- */ + +#ifndef GL_ARB_vertex_array_bgra +#define GL_ARB_vertex_array_bgra 1 + +#define GL_BGRA 0x80E1 + +#define GLEW_ARB_vertex_array_bgra GLEW_GET_VAR(__GLEW_ARB_vertex_array_bgra) + +#endif /* GL_ARB_vertex_array_bgra */ + /* ----------------------- GL_ARB_vertex_array_object ---------------------- */ #ifndef GL_ARB_vertex_array_object @@ -4390,6 +5005,19 @@ typedef void (GLAPIENTRY * PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); #endif /* GL_ATI_map_object_buffer */ +/* ----------------------------- GL_ATI_meminfo ---------------------------- */ + +#ifndef GL_ATI_meminfo +#define GL_ATI_meminfo 1 + +#define GL_VBO_FREE_MEMORY_ATI 0x87FB +#define GL_TEXTURE_FREE_MEMORY_ATI 0x87FC +#define GL_RENDERBUFFER_FREE_MEMORY_ATI 0x87FD + +#define GLEW_ATI_meminfo GLEW_GET_VAR(__GLEW_ATI_meminfo) + +#endif /* GL_ATI_meminfo */ + /* -------------------------- GL_ATI_pn_triangles -------------------------- */ #ifndef GL_ATI_pn_triangles @@ -5068,7 +5696,14 @@ typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, G typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (GLAPIENTRY * PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (GLAPIENTRY * PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (GLAPIENTRY * PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); typedef void (GLAPIENTRY * PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); +typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC) (GLuint framebuffer, GLsizei n, const GLenum* bufs); typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERREADBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); @@ -5076,8 +5711,10 @@ typedef void (GLAPIENTRY * PFNGLGENERATEMULTITEXMIPMAPEXTPROC) (GLenum texunit, typedef void (GLAPIENTRY * PFNGLGENERATETEXTUREMIPMAPEXTPROC) (GLuint texture, GLenum target); typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, void* img); typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, void* img); -typedef void (GLAPIENTRY * PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum pname, GLuint index, GLdouble* params); -typedef void (GLAPIENTRY * PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum pname, GLuint index, GLfloat* params); +typedef void (GLAPIENTRY * PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble* params); +typedef void (GLAPIENTRY * PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble* params); +typedef void (GLAPIENTRY * PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat* params); +typedef void (GLAPIENTRY * PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat* params); typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint* param); typedef void (GLAPIENTRY * PFNGLGETMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat* params); typedef void (GLAPIENTRY * PFNGLGETMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint* params); @@ -5102,7 +5739,8 @@ typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void* string); typedef void (GLAPIENTRY * PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint* params); typedef void (GLAPIENTRY * PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint* params); -typedef void (GLAPIENTRY * PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum pname, GLuint index, GLvoid** params); +typedef void (GLAPIENTRY * PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLvoid** params); +typedef void (GLAPIENTRY * PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, GLvoid** params); typedef void (GLAPIENTRY * PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void* pixels); typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat* params); typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint* params); @@ -5110,7 +5748,12 @@ typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLuint* params); typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat* params); typedef void (GLAPIENTRY * PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint* param); +typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint* param); +typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLvoid** param); +typedef void (GLAPIENTRY * PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, GLvoid** param); typedef GLvoid * (GLAPIENTRY * PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); +typedef GLvoid * (GLAPIENTRY * PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); typedef void (GLAPIENTRY * PFNGLMATRIXFRUSTUMEXTPROC) (GLenum matrixMode, GLdouble l, GLdouble r, GLdouble b, GLdouble t, GLdouble n, GLdouble f); typedef void (GLAPIENTRY * PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum matrixMode); typedef void (GLAPIENTRY * PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum matrixMode, const GLdouble* m); @@ -5157,6 +5800,7 @@ typedef void (GLAPIENTRY * PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLen typedef void (GLAPIENTRY * PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void* pixels); typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void* data, GLenum usage); typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void* data); +typedef void (GLAPIENTRY * PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); @@ -5228,6 +5872,17 @@ typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenu typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void* pixels); typedef void (GLAPIENTRY * PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void* pixels); typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYINDEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYNORMALOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); #define glBindMultiTextureEXT GLEW_GET_FUN(__glewBindMultiTextureEXT) #define glCheckNamedFramebufferStatusEXT GLEW_GET_FUN(__glewCheckNamedFramebufferStatusEXT) @@ -5255,7 +5910,14 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glCopyTextureSubImage2DEXT GLEW_GET_FUN(__glewCopyTextureSubImage2DEXT) #define glCopyTextureSubImage3DEXT GLEW_GET_FUN(__glewCopyTextureSubImage3DEXT) #define glDisableClientStateIndexedEXT GLEW_GET_FUN(__glewDisableClientStateIndexedEXT) +#define glDisableClientStateiEXT GLEW_GET_FUN(__glewDisableClientStateiEXT) +#define glDisableVertexArrayAttribEXT GLEW_GET_FUN(__glewDisableVertexArrayAttribEXT) +#define glDisableVertexArrayEXT GLEW_GET_FUN(__glewDisableVertexArrayEXT) #define glEnableClientStateIndexedEXT GLEW_GET_FUN(__glewEnableClientStateIndexedEXT) +#define glEnableClientStateiEXT GLEW_GET_FUN(__glewEnableClientStateiEXT) +#define glEnableVertexArrayAttribEXT GLEW_GET_FUN(__glewEnableVertexArrayAttribEXT) +#define glEnableVertexArrayEXT GLEW_GET_FUN(__glewEnableVertexArrayEXT) +#define glFlushMappedNamedBufferRangeEXT GLEW_GET_FUN(__glewFlushMappedNamedBufferRangeEXT) #define glFramebufferDrawBufferEXT GLEW_GET_FUN(__glewFramebufferDrawBufferEXT) #define glFramebufferDrawBuffersEXT GLEW_GET_FUN(__glewFramebufferDrawBuffersEXT) #define glFramebufferReadBufferEXT GLEW_GET_FUN(__glewFramebufferReadBufferEXT) @@ -5264,7 +5926,9 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glGetCompressedMultiTexImageEXT GLEW_GET_FUN(__glewGetCompressedMultiTexImageEXT) #define glGetCompressedTextureImageEXT GLEW_GET_FUN(__glewGetCompressedTextureImageEXT) #define glGetDoubleIndexedvEXT GLEW_GET_FUN(__glewGetDoubleIndexedvEXT) +#define glGetDoublei_vEXT GLEW_GET_FUN(__glewGetDoublei_vEXT) #define glGetFloatIndexedvEXT GLEW_GET_FUN(__glewGetFloatIndexedvEXT) +#define glGetFloati_vEXT GLEW_GET_FUN(__glewGetFloati_vEXT) #define glGetFramebufferParameterivEXT GLEW_GET_FUN(__glewGetFramebufferParameterivEXT) #define glGetMultiTexEnvfvEXT GLEW_GET_FUN(__glewGetMultiTexEnvfvEXT) #define glGetMultiTexEnvivEXT GLEW_GET_FUN(__glewGetMultiTexEnvivEXT) @@ -5290,6 +5954,7 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glGetNamedProgramivEXT GLEW_GET_FUN(__glewGetNamedProgramivEXT) #define glGetNamedRenderbufferParameterivEXT GLEW_GET_FUN(__glewGetNamedRenderbufferParameterivEXT) #define glGetPointerIndexedvEXT GLEW_GET_FUN(__glewGetPointerIndexedvEXT) +#define glGetPointeri_vEXT GLEW_GET_FUN(__glewGetPointeri_vEXT) #define glGetTextureImageEXT GLEW_GET_FUN(__glewGetTextureImageEXT) #define glGetTextureLevelParameterfvEXT GLEW_GET_FUN(__glewGetTextureLevelParameterfvEXT) #define glGetTextureLevelParameterivEXT GLEW_GET_FUN(__glewGetTextureLevelParameterivEXT) @@ -5297,7 +5962,12 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glGetTextureParameterIuivEXT GLEW_GET_FUN(__glewGetTextureParameterIuivEXT) #define glGetTextureParameterfvEXT GLEW_GET_FUN(__glewGetTextureParameterfvEXT) #define glGetTextureParameterivEXT GLEW_GET_FUN(__glewGetTextureParameterivEXT) +#define glGetVertexArrayIntegeri_vEXT GLEW_GET_FUN(__glewGetVertexArrayIntegeri_vEXT) +#define glGetVertexArrayIntegervEXT GLEW_GET_FUN(__glewGetVertexArrayIntegervEXT) +#define glGetVertexArrayPointeri_vEXT GLEW_GET_FUN(__glewGetVertexArrayPointeri_vEXT) +#define glGetVertexArrayPointervEXT GLEW_GET_FUN(__glewGetVertexArrayPointervEXT) #define glMapNamedBufferEXT GLEW_GET_FUN(__glewMapNamedBufferEXT) +#define glMapNamedBufferRangeEXT GLEW_GET_FUN(__glewMapNamedBufferRangeEXT) #define glMatrixFrustumEXT GLEW_GET_FUN(__glewMatrixFrustumEXT) #define glMatrixLoadIdentityEXT GLEW_GET_FUN(__glewMatrixLoadIdentityEXT) #define glMatrixLoadTransposedEXT GLEW_GET_FUN(__glewMatrixLoadTransposedEXT) @@ -5344,6 +6014,7 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glMultiTexSubImage3DEXT GLEW_GET_FUN(__glewMultiTexSubImage3DEXT) #define glNamedBufferDataEXT GLEW_GET_FUN(__glewNamedBufferDataEXT) #define glNamedBufferSubDataEXT GLEW_GET_FUN(__glewNamedBufferSubDataEXT) +#define glNamedCopyBufferSubDataEXT GLEW_GET_FUN(__glewNamedCopyBufferSubDataEXT) #define glNamedFramebufferRenderbufferEXT GLEW_GET_FUN(__glewNamedFramebufferRenderbufferEXT) #define glNamedFramebufferTexture1DEXT GLEW_GET_FUN(__glewNamedFramebufferTexture1DEXT) #define glNamedFramebufferTexture2DEXT GLEW_GET_FUN(__glewNamedFramebufferTexture2DEXT) @@ -5415,6 +6086,17 @@ typedef GLboolean (GLAPIENTRY * PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); #define glTextureSubImage2DEXT GLEW_GET_FUN(__glewTextureSubImage2DEXT) #define glTextureSubImage3DEXT GLEW_GET_FUN(__glewTextureSubImage3DEXT) #define glUnmapNamedBufferEXT GLEW_GET_FUN(__glewUnmapNamedBufferEXT) +#define glVertexArrayColorOffsetEXT GLEW_GET_FUN(__glewVertexArrayColorOffsetEXT) +#define glVertexArrayEdgeFlagOffsetEXT GLEW_GET_FUN(__glewVertexArrayEdgeFlagOffsetEXT) +#define glVertexArrayFogCoordOffsetEXT GLEW_GET_FUN(__glewVertexArrayFogCoordOffsetEXT) +#define glVertexArrayIndexOffsetEXT GLEW_GET_FUN(__glewVertexArrayIndexOffsetEXT) +#define glVertexArrayMultiTexCoordOffsetEXT GLEW_GET_FUN(__glewVertexArrayMultiTexCoordOffsetEXT) +#define glVertexArrayNormalOffsetEXT GLEW_GET_FUN(__glewVertexArrayNormalOffsetEXT) +#define glVertexArraySecondaryColorOffsetEXT GLEW_GET_FUN(__glewVertexArraySecondaryColorOffsetEXT) +#define glVertexArrayTexCoordOffsetEXT GLEW_GET_FUN(__glewVertexArrayTexCoordOffsetEXT) +#define glVertexArrayVertexAttribIOffsetEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribIOffsetEXT) +#define glVertexArrayVertexAttribOffsetEXT GLEW_GET_FUN(__glewVertexArrayVertexAttribOffsetEXT) +#define glVertexArrayVertexOffsetEXT GLEW_GET_FUN(__glewVertexArrayVertexOffsetEXT) #define GLEW_EXT_direct_state_access GLEW_GET_VAR(__GLEW_EXT_direct_state_access) @@ -6223,6 +6905,24 @@ typedef void (GLAPIENTRY * PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat b #endif /* GL_EXT_polygon_offset */ +/* ------------------------ GL_EXT_provoking_vertex ------------------------ */ + +#ifndef GL_EXT_provoking_vertex +#define GL_EXT_provoking_vertex 1 + +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_PROVOKING_VERTEX_EXT 0x8E4F + +typedef void (GLAPIENTRY * PFNGLPROVOKINGVERTEXEXTPROC) (GLenum mode); + +#define glProvokingVertexEXT GLEW_GET_FUN(__glewProvokingVertexEXT) + +#define GLEW_EXT_provoking_vertex GLEW_GET_VAR(__GLEW_EXT_provoking_vertex) + +#endif /* GL_EXT_provoking_vertex */ + /* ------------------------- GL_EXT_rescale_normal ------------------------- */ #ifndef GL_EXT_rescale_normal @@ -6302,6 +7002,25 @@ typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenu #endif /* GL_EXT_secondary_color */ +/* --------------------- GL_EXT_separate_shader_objects -------------------- */ + +#ifndef GL_EXT_separate_shader_objects +#define GL_EXT_separate_shader_objects 1 + +#define GL_ACTIVE_PROGRAM_EXT 0x8B8D + +typedef void (GLAPIENTRY * PFNGLACTIVEPROGRAMEXTPROC) (GLuint program); +typedef GLuint (GLAPIENTRY * PFNGLCREATESHADERPROGRAMEXTPROC) (GLenum type, const char* string); +typedef void (GLAPIENTRY * PFNGLUSESHADERPROGRAMEXTPROC) (GLenum type, GLuint program); + +#define glActiveProgramEXT GLEW_GET_FUN(__glewActiveProgramEXT) +#define glCreateShaderProgramEXT GLEW_GET_FUN(__glewCreateShaderProgramEXT) +#define glUseShaderProgramEXT GLEW_GET_FUN(__glewUseShaderProgramEXT) + +#define GLEW_EXT_separate_shader_objects GLEW_GET_VAR(__GLEW_EXT_separate_shader_objects) + +#endif /* GL_EXT_separate_shader_objects */ + /* --------------------- GL_EXT_separate_specular_color -------------------- */ #ifndef GL_EXT_separate_specular_color @@ -6871,6 +7590,41 @@ typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #endif /* GL_EXT_texture_shared_exponent */ +/* -------------------------- GL_EXT_texture_snorm ------------------------- */ + +#ifndef GL_EXT_texture_snorm +#define GL_EXT_texture_snorm 1 + +#define GL_RED_SNORM 0x8F90 +#define GL_RG_SNORM 0x8F91 +#define GL_RGB_SNORM 0x8F92 +#define GL_RGBA_SNORM 0x8F93 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGB8_SNORM 0x8F96 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM 0x8F98 +#define GL_RG16_SNORM 0x8F99 +#define GL_RGB16_SNORM 0x8F9A +#define GL_RGBA16_SNORM 0x8F9B +#define GL_SIGNED_NORMALIZED 0x8F9C +#define GL_ALPHA_SNORM 0x9010 +#define GL_LUMINANCE_SNORM 0x9011 +#define GL_LUMINANCE_ALPHA_SNORM 0x9012 +#define GL_INTENSITY_SNORM 0x9013 +#define GL_ALPHA8_SNORM 0x9014 +#define GL_LUMINANCE8_SNORM 0x9015 +#define GL_LUMINANCE8_ALPHA8_SNORM 0x9016 +#define GL_INTENSITY8_SNORM 0x9017 +#define GL_ALPHA16_SNORM 0x9018 +#define GL_LUMINANCE16_SNORM 0x9019 +#define GL_LUMINANCE16_ALPHA16_SNORM 0x901A +#define GL_INTENSITY16_SNORM 0x901B + +#define GLEW_EXT_texture_snorm GLEW_GET_VAR(__GLEW_EXT_texture_snorm) + +#endif /* GL_EXT_texture_snorm */ + /* ------------------------- GL_EXT_texture_swizzle ------------------------ */ #ifndef GL_EXT_texture_swizzle @@ -7686,6 +8440,19 @@ typedef void (GLAPIENTRY * PFNGLENDCONDITIONALRENDERNVPROC) (void); #endif /* GL_NV_copy_depth_to_color */ +/* ---------------------------- GL_NV_copy_image --------------------------- */ + +#ifndef GL_NV_copy_image +#define GL_NV_copy_image 1 + +typedef void (GLAPIENTRY * PFNGLCOPYIMAGESUBDATANVPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); + +#define glCopyImageSubDataNV GLEW_GET_FUN(__glewCopyImageSubDataNV) + +#define GLEW_NV_copy_image GLEW_GET_VAR(__GLEW_NV_copy_image) + +#endif /* GL_NV_copy_image */ + /* ------------------------ GL_NV_depth_buffer_float ----------------------- */ #ifndef GL_NV_depth_buffer_float @@ -8229,6 +8996,15 @@ typedef void (GLAPIENTRY * PFNGLPROGRAMBUFFERPARAMETERSFVNVPROC) (GLenum target, #endif /* GL_NV_parameter_buffer_object */ +/* --------------------- GL_NV_parameter_buffer_object2 -------------------- */ + +#ifndef GL_NV_parameter_buffer_object2 +#define GL_NV_parameter_buffer_object2 1 + +#define GLEW_NV_parameter_buffer_object2 GLEW_GET_VAR(__GLEW_NV_parameter_buffer_object2) + +#endif /* GL_NV_parameter_buffer_object2 */ + /* ------------------------- GL_NV_pixel_data_range ------------------------ */ #ifndef GL_NV_pixel_data_range @@ -8288,7 +9064,6 @@ typedef void (GLAPIENTRY * PFNGLGETVIDEOUI64VNVPROC) (GLuint video_slot, GLenum typedef void (GLAPIENTRY * PFNGLGETVIDEOUIVNVPROC) (GLuint video_slot, GLenum pname, GLuint* params); typedef void (GLAPIENTRY * PFNGLPRESENTFRAMEDUALFILLNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLenum target1, GLuint fill1, GLenum target2, GLuint fill2, GLenum target3, GLuint fill3); typedef void (GLAPIENTRY * PFNGLPRESENTFRAMEKEYEDNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLuint key0, GLenum target1, GLuint fill1, GLuint key1); -typedef void (GLAPIENTRY * PFNGLVIDEOPARAMETERIVNVPROC) (GLuint video_slot, GLenum pname, const GLint* params); #define glGetVideoi64vNV GLEW_GET_FUN(__glewGetVideoi64vNV) #define glGetVideoivNV GLEW_GET_FUN(__glewGetVideoivNV) @@ -8296,7 +9071,6 @@ typedef void (GLAPIENTRY * PFNGLVIDEOPARAMETERIVNVPROC) (GLuint video_slot, GLen #define glGetVideouivNV GLEW_GET_FUN(__glewGetVideouivNV) #define glPresentFrameDualFillNV GLEW_GET_FUN(__glewPresentFrameDualFillNV) #define glPresentFrameKeyedNV GLEW_GET_FUN(__glewPresentFrameKeyedNV) -#define glVideoParameterivNV GLEW_GET_FUN(__glewVideoParameterivNV) #define GLEW_NV_present_video GLEW_GET_VAR(__GLEW_NV_present_video) @@ -8426,6 +9200,49 @@ typedef void (GLAPIENTRY * PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage #endif /* GL_NV_register_combiners2 */ +/* ------------------------ GL_NV_shader_buffer_load ----------------------- */ + +#ifndef GL_NV_shader_buffer_load +#define GL_NV_shader_buffer_load 1 + +#define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D +#define GL_GPU_ADDRESS_NV 0x8F34 +#define GL_MAX_SHADER_BUFFER_ADDRESS_NV 0x8F35 + +typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERUI64VNVPROC) (GLenum target, GLenum pname, GLuint64EXT* params); +typedef void (GLAPIENTRY * PFNGLGETINTEGERUI64VNVPROC) (GLenum value, GLuint64EXT* result); +typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC) (GLuint buffer, GLenum pname, GLuint64EXT* params); +typedef void (GLAPIENTRY * PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT* params); +typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERRESIDENTNVPROC) (GLenum target); +typedef GLboolean (GLAPIENTRY * PFNGLISNAMEDBUFFERRESIDENTNVPROC) (GLuint buffer); +typedef void (GLAPIENTRY * PFNGLMAKEBUFFERNONRESIDENTNVPROC) (GLenum target); +typedef void (GLAPIENTRY * PFNGLMAKEBUFFERRESIDENTNVPROC) (GLenum target, GLenum access); +typedef void (GLAPIENTRY * PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC) (GLuint buffer); +typedef void (GLAPIENTRY * PFNGLMAKENAMEDBUFFERRESIDENTNVPROC) (GLuint buffer, GLenum access); +typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMUI64NVPROC) (GLuint program, GLint location, GLuint64EXT value); +typedef void (GLAPIENTRY * PFNGLPROGRAMUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMUI64NVPROC) (GLint location, GLuint64EXT value); +typedef void (GLAPIENTRY * PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT* value); + +#define glGetBufferParameterui64vNV GLEW_GET_FUN(__glewGetBufferParameterui64vNV) +#define glGetIntegerui64vNV GLEW_GET_FUN(__glewGetIntegerui64vNV) +#define glGetNamedBufferParameterui64vNV GLEW_GET_FUN(__glewGetNamedBufferParameterui64vNV) +#define glGetUniformui64vNV GLEW_GET_FUN(__glewGetUniformui64vNV) +#define glIsBufferResidentNV GLEW_GET_FUN(__glewIsBufferResidentNV) +#define glIsNamedBufferResidentNV GLEW_GET_FUN(__glewIsNamedBufferResidentNV) +#define glMakeBufferNonResidentNV GLEW_GET_FUN(__glewMakeBufferNonResidentNV) +#define glMakeBufferResidentNV GLEW_GET_FUN(__glewMakeBufferResidentNV) +#define glMakeNamedBufferNonResidentNV GLEW_GET_FUN(__glewMakeNamedBufferNonResidentNV) +#define glMakeNamedBufferResidentNV GLEW_GET_FUN(__glewMakeNamedBufferResidentNV) +#define glProgramUniformui64NV GLEW_GET_FUN(__glewProgramUniformui64NV) +#define glProgramUniformui64vNV GLEW_GET_FUN(__glewProgramUniformui64vNV) +#define glUniformui64NV GLEW_GET_FUN(__glewUniformui64NV) +#define glUniformui64vNV GLEW_GET_FUN(__glewUniformui64vNV) + +#define GLEW_NV_shader_buffer_load GLEW_GET_VAR(__GLEW_NV_shader_buffer_load) + +#endif /* GL_NV_shader_buffer_load */ + /* -------------------------- GL_NV_texgen_emboss -------------------------- */ #ifndef GL_NV_texgen_emboss @@ -8451,6 +9268,19 @@ typedef void (GLAPIENTRY * PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage #endif /* GL_NV_texgen_reflection */ +/* ------------------------- GL_NV_texture_barrier ------------------------- */ + +#ifndef GL_NV_texture_barrier +#define GL_NV_texture_barrier 1 + +typedef void (GLAPIENTRY * PFNGLTEXTUREBARRIERNVPROC) (void); + +#define glTextureBarrierNV GLEW_GET_FUN(__glewTextureBarrierNV) + +#define GLEW_NV_texture_barrier GLEW_GET_VAR(__GLEW_NV_texture_barrier) + +#endif /* GL_NV_texture_barrier */ + /* --------------------- GL_NV_texture_compression_vtc --------------------- */ #ifndef GL_NV_texture_compression_vtc @@ -8707,6 +9537,36 @@ typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC) (GLuint program #endif /* GL_NV_transform_feedback */ +/* ----------------------- GL_NV_transform_feedback2 ----------------------- */ + +#ifndef GL_NV_transform_feedback2 +#define GL_NV_transform_feedback2 1 + +#define GL_TRANSFORM_FEEDBACK_NV 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED_NV 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE_NV 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING_NV 0x8E25 + +typedef void (GLAPIENTRY * PFNGLBINDTRANSFORMFEEDBACKNVPROC) (GLenum target, GLuint id); +typedef void (GLAPIENTRY * PFNGLDELETETRANSFORMFEEDBACKSNVPROC) (GLsizei n, const GLuint* ids); +typedef void (GLAPIENTRY * PFNGLDRAWTRANSFORMFEEDBACKNVPROC) (GLenum mode, GLuint id); +typedef void (GLAPIENTRY * PFNGLGENTRANSFORMFEEDBACKSNVPROC) (GLsizei n, GLuint* ids); +typedef GLboolean (GLAPIENTRY * PFNGLISTRANSFORMFEEDBACKNVPROC) (GLuint id); +typedef void (GLAPIENTRY * PFNGLPAUSETRANSFORMFEEDBACKNVPROC) (void); +typedef void (GLAPIENTRY * PFNGLRESUMETRANSFORMFEEDBACKNVPROC) (void); + +#define glBindTransformFeedbackNV GLEW_GET_FUN(__glewBindTransformFeedbackNV) +#define glDeleteTransformFeedbacksNV GLEW_GET_FUN(__glewDeleteTransformFeedbacksNV) +#define glDrawTransformFeedbackNV GLEW_GET_FUN(__glewDrawTransformFeedbackNV) +#define glGenTransformFeedbacksNV GLEW_GET_FUN(__glewGenTransformFeedbacksNV) +#define glIsTransformFeedbackNV GLEW_GET_FUN(__glewIsTransformFeedbackNV) +#define glPauseTransformFeedbackNV GLEW_GET_FUN(__glewPauseTransformFeedbackNV) +#define glResumeTransformFeedbackNV GLEW_GET_FUN(__glewResumeTransformFeedbackNV) + +#define GLEW_NV_transform_feedback2 GLEW_GET_VAR(__GLEW_NV_transform_feedback2) + +#endif /* GL_NV_transform_feedback2 */ + /* ------------------------ GL_NV_vertex_array_range ----------------------- */ #ifndef GL_NV_vertex_array_range @@ -8739,6 +9599,64 @@ typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, void* p #endif /* GL_NV_vertex_array_range2 */ +/* ------------------- GL_NV_vertex_buffer_unified_memory ------------------ */ + +#ifndef GL_NV_vertex_buffer_unified_memory +#define GL_NV_vertex_buffer_unified_memory 1 + +#define GL_VERTEX_ATTRIB_ARRAY_UNIFIED_NV 0x8F1E +#define GL_ELEMENT_ARRAY_UNIFIED_NV 0x8F1F +#define GL_VERTEX_ATTRIB_ARRAY_ADDRESS_NV 0x8F20 +#define GL_VERTEX_ARRAY_ADDRESS_NV 0x8F21 +#define GL_NORMAL_ARRAY_ADDRESS_NV 0x8F22 +#define GL_COLOR_ARRAY_ADDRESS_NV 0x8F23 +#define GL_INDEX_ARRAY_ADDRESS_NV 0x8F24 +#define GL_TEXTURE_COORD_ARRAY_ADDRESS_NV 0x8F25 +#define GL_EDGE_FLAG_ARRAY_ADDRESS_NV 0x8F26 +#define GL_SECONDARY_COLOR_ARRAY_ADDRESS_NV 0x8F27 +#define GL_FOG_COORD_ARRAY_ADDRESS_NV 0x8F28 +#define GL_ELEMENT_ARRAY_ADDRESS_NV 0x8F29 +#define GL_VERTEX_ATTRIB_ARRAY_LENGTH_NV 0x8F2A +#define GL_VERTEX_ARRAY_LENGTH_NV 0x8F2B +#define GL_NORMAL_ARRAY_LENGTH_NV 0x8F2C +#define GL_COLOR_ARRAY_LENGTH_NV 0x8F2D +#define GL_INDEX_ARRAY_LENGTH_NV 0x8F2E +#define GL_TEXTURE_COORD_ARRAY_LENGTH_NV 0x8F2F +#define GL_EDGE_FLAG_ARRAY_LENGTH_NV 0x8F30 +#define GL_SECONDARY_COLOR_ARRAY_LENGTH_NV 0x8F31 +#define GL_FOG_COORD_ARRAY_LENGTH_NV 0x8F32 +#define GL_ELEMENT_ARRAY_LENGTH_NV 0x8F33 + +typedef void (GLAPIENTRY * PFNGLBUFFERADDRESSRANGENVPROC) (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +typedef void (GLAPIENTRY * PFNGLCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLEDGEFLAGFORMATNVPROC) (GLsizei stride); +typedef void (GLAPIENTRY * PFNGLFOGCOORDFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLGETINTEGERUI64I_VNVPROC) (GLenum value, GLuint index, GLuint64EXT result[]); +typedef void (GLAPIENTRY * PFNGLINDEXFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLNORMALFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLTEXCOORDFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLVERTEXFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); + +#define glBufferAddressRangeNV GLEW_GET_FUN(__glewBufferAddressRangeNV) +#define glColorFormatNV GLEW_GET_FUN(__glewColorFormatNV) +#define glEdgeFlagFormatNV GLEW_GET_FUN(__glewEdgeFlagFormatNV) +#define glFogCoordFormatNV GLEW_GET_FUN(__glewFogCoordFormatNV) +#define glGetIntegerui64i_vNV GLEW_GET_FUN(__glewGetIntegerui64i_vNV) +#define glIndexFormatNV GLEW_GET_FUN(__glewIndexFormatNV) +#define glNormalFormatNV GLEW_GET_FUN(__glewNormalFormatNV) +#define glSecondaryColorFormatNV GLEW_GET_FUN(__glewSecondaryColorFormatNV) +#define glTexCoordFormatNV GLEW_GET_FUN(__glewTexCoordFormatNV) +#define glVertexAttribFormatNV GLEW_GET_FUN(__glewVertexAttribFormatNV) +#define glVertexAttribIFormatNV GLEW_GET_FUN(__glewVertexAttribIFormatNV) +#define glVertexFormatNV GLEW_GET_FUN(__glewVertexFormatNV) + +#define GLEW_NV_vertex_buffer_unified_memory GLEW_GET_VAR(__GLEW_NV_vertex_buffer_unified_memory) + +#endif /* GL_NV_vertex_buffer_unified_memory */ + /* -------------------------- GL_NV_vertex_program ------------------------- */ #ifndef GL_NV_vertex_program @@ -10460,8 +11378,6 @@ GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX4X3FVPROC __glewUniformMatrix4x3fv; GLEW_FUN_EXPORT PFNGLBEGINCONDITIONALRENDERPROC __glewBeginConditionalRender; GLEW_FUN_EXPORT PFNGLBEGINTRANSFORMFEEDBACKPROC __glewBeginTransformFeedback; -GLEW_FUN_EXPORT PFNGLBINDBUFFERBASEPROC __glewBindBufferBase; -GLEW_FUN_EXPORT PFNGLBINDBUFFERRANGEPROC __glewBindBufferRange; GLEW_FUN_EXPORT PFNGLBINDFRAGDATALOCATIONPROC __glewBindFragDataLocation; GLEW_FUN_EXPORT PFNGLCLAMPCOLORPROC __glewClampColor; GLEW_FUN_EXPORT PFNGLCLEARBUFFERFIPROC __glewClearBufferfi; @@ -10475,7 +11391,6 @@ GLEW_FUN_EXPORT PFNGLENDCONDITIONALRENDERPROC __glewEndConditionalRender; GLEW_FUN_EXPORT PFNGLENDTRANSFORMFEEDBACKPROC __glewEndTransformFeedback; GLEW_FUN_EXPORT PFNGLGETBOOLEANI_VPROC __glewGetBooleani_v; GLEW_FUN_EXPORT PFNGLGETFRAGDATALOCATIONPROC __glewGetFragDataLocation; -GLEW_FUN_EXPORT PFNGLGETINTEGERI_VPROC __glewGetIntegeri_v; GLEW_FUN_EXPORT PFNGLGETSTRINGIPROC __glewGetStringi; GLEW_FUN_EXPORT PFNGLGETTEXPARAMETERIIVPROC __glewGetTexParameterIiv; GLEW_FUN_EXPORT PFNGLGETTEXPARAMETERIUIVPROC __glewGetTexParameterIuiv; @@ -10517,8 +11432,37 @@ GLEW_FUN_EXPORT PFNGLVERTEXATTRIBI4UIVPROC __glewVertexAttribI4uiv; GLEW_FUN_EXPORT PFNGLVERTEXATTRIBI4USVPROC __glewVertexAttribI4usv; GLEW_FUN_EXPORT PFNGLVERTEXATTRIBIPOINTERPROC __glewVertexAttribIPointer; +GLEW_FUN_EXPORT PFNGLDRAWARRAYSINSTANCEDPROC __glewDrawArraysInstanced; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDPROC __glewDrawElementsInstanced; +GLEW_FUN_EXPORT PFNGLPRIMITIVERESTARTINDEXPROC __glewPrimitiveRestartIndex; +GLEW_FUN_EXPORT PFNGLTEXBUFFERPROC __glewTexBuffer; + +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTUREPROC __glewFramebufferTexture; +GLEW_FUN_EXPORT PFNGLGETBUFFERPARAMETERI64VPROC __glewGetBufferParameteri64v; +GLEW_FUN_EXPORT PFNGLGETINTEGER64I_VPROC __glewGetInteger64i_v; + GLEW_FUN_EXPORT PFNGLTBUFFERMASK3DFXPROC __glewTbufferMask3DFX; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONINDEXEDAMDPROC __glewBlendEquationIndexedAMD; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC __glewBlendEquationSeparateIndexedAMD; +GLEW_FUN_EXPORT PFNGLBLENDFUNCINDEXEDAMDPROC __glewBlendFuncIndexedAMD; +GLEW_FUN_EXPORT PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC __glewBlendFuncSeparateIndexedAMD; + +GLEW_FUN_EXPORT PFNGLBEGINPERFMONITORAMDPROC __glewBeginPerfMonitorAMD; +GLEW_FUN_EXPORT PFNGLDELETEPERFMONITORSAMDPROC __glewDeletePerfMonitorsAMD; +GLEW_FUN_EXPORT PFNGLENDPERFMONITORAMDPROC __glewEndPerfMonitorAMD; +GLEW_FUN_EXPORT PFNGLGENPERFMONITORSAMDPROC __glewGenPerfMonitorsAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORCOUNTERDATAAMDPROC __glewGetPerfMonitorCounterDataAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORCOUNTERINFOAMDPROC __glewGetPerfMonitorCounterInfoAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC __glewGetPerfMonitorCounterStringAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORCOUNTERSAMDPROC __glewGetPerfMonitorCountersAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORGROUPSTRINGAMDPROC __glewGetPerfMonitorGroupStringAMD; +GLEW_FUN_EXPORT PFNGLGETPERFMONITORGROUPSAMDPROC __glewGetPerfMonitorGroupsAMD; +GLEW_FUN_EXPORT PFNGLSELECTPERFMONITORCOUNTERSAMDPROC __glewSelectPerfMonitorCountersAMD; + +GLEW_FUN_EXPORT PFNGLTESSELLATIONFACTORAMDPROC __glewTessellationFactorAMD; +GLEW_FUN_EXPORT PFNGLTESSELLATIONMODEAMDPROC __glewTessellationModeAMD; + GLEW_FUN_EXPORT PFNGLDRAWELEMENTARRAYAPPLEPROC __glewDrawElementArrayAPPLE; GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC __glewDrawRangeElementArrayAPPLE; GLEW_FUN_EXPORT PFNGLELEMENTPOINTERAPPLEPROC __glewElementPointerAPPLE; @@ -10537,6 +11481,10 @@ GLEW_FUN_EXPORT PFNGLTESTOBJECTAPPLEPROC __glewTestObjectAPPLE; GLEW_FUN_EXPORT PFNGLBUFFERPARAMETERIAPPLEPROC __glewBufferParameteriAPPLE; GLEW_FUN_EXPORT PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC __glewFlushMappedBufferRangeAPPLE; +GLEW_FUN_EXPORT PFNGLGETOBJECTPARAMETERIVAPPLEPROC __glewGetObjectParameterivAPPLE; +GLEW_FUN_EXPORT PFNGLOBJECTPURGEABLEAPPLEPROC __glewObjectPurgeableAPPLE; +GLEW_FUN_EXPORT PFNGLOBJECTUNPURGEABLEAPPLEPROC __glewObjectUnpurgeableAPPLE; + GLEW_FUN_EXPORT PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC __glewGetTexParameterPointervAPPLE; GLEW_FUN_EXPORT PFNGLTEXTURERANGEAPPLEPROC __glewTextureRangeAPPLE; @@ -10549,10 +11497,30 @@ GLEW_FUN_EXPORT PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC __glewFlushVertexArrayRangeA GLEW_FUN_EXPORT PFNGLVERTEXARRAYPARAMETERIAPPLEPROC __glewVertexArrayParameteriAPPLE; GLEW_FUN_EXPORT PFNGLVERTEXARRAYRANGEAPPLEPROC __glewVertexArrayRangeAPPLE; +GLEW_FUN_EXPORT PFNGLDISABLEVERTEXATTRIBAPPLEPROC __glewDisableVertexAttribAPPLE; +GLEW_FUN_EXPORT PFNGLENABLEVERTEXATTRIBAPPLEPROC __glewEnableVertexAttribAPPLE; +GLEW_FUN_EXPORT PFNGLISVERTEXATTRIBENABLEDAPPLEPROC __glewIsVertexAttribEnabledAPPLE; +GLEW_FUN_EXPORT PFNGLMAPVERTEXATTRIB1DAPPLEPROC __glewMapVertexAttrib1dAPPLE; +GLEW_FUN_EXPORT PFNGLMAPVERTEXATTRIB1FAPPLEPROC __glewMapVertexAttrib1fAPPLE; +GLEW_FUN_EXPORT PFNGLMAPVERTEXATTRIB2DAPPLEPROC __glewMapVertexAttrib2dAPPLE; +GLEW_FUN_EXPORT PFNGLMAPVERTEXATTRIB2FAPPLEPROC __glewMapVertexAttrib2fAPPLE; + GLEW_FUN_EXPORT PFNGLCLAMPCOLORARBPROC __glewClampColorARB; +GLEW_FUN_EXPORT PFNGLCOPYBUFFERSUBDATAPROC __glewCopyBufferSubData; + GLEW_FUN_EXPORT PFNGLDRAWBUFFERSARBPROC __glewDrawBuffersARB; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONSEPARATEIARBPROC __glewBlendEquationSeparateiARB; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONIARBPROC __glewBlendEquationiARB; +GLEW_FUN_EXPORT PFNGLBLENDFUNCSEPARATEIARBPROC __glewBlendFuncSeparateiARB; +GLEW_FUN_EXPORT PFNGLBLENDFUNCIARBPROC __glewBlendFunciARB; + +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSBASEVERTEXPROC __glewDrawElementsBaseVertex; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC __glewDrawElementsInstancedBaseVertex; +GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC __glewDrawRangeElementsBaseVertex; +GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC __glewMultiDrawElementsBaseVertex; + GLEW_FUN_EXPORT PFNGLDRAWARRAYSINSTANCEDARBPROC __glewDrawArraysInstancedARB; GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDARBPROC __glewDrawElementsInstancedARB; @@ -10563,10 +11531,10 @@ GLEW_FUN_EXPORT PFNGLCHECKFRAMEBUFFERSTATUSPROC __glewCheckFramebufferStatus; GLEW_FUN_EXPORT PFNGLDELETEFRAMEBUFFERSPROC __glewDeleteFramebuffers; GLEW_FUN_EXPORT PFNGLDELETERENDERBUFFERSPROC __glewDeleteRenderbuffers; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERRENDERBUFFERPROC __glewFramebufferRenderbuffer; -GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURELAYERPROC __glewFramebufferTextureLayer; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURE1DPROC __glewFramebufferTexture1D; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURE2DPROC __glewFramebufferTexture2D; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURE3DPROC __glewFramebufferTexture3D; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURELAYERPROC __glewFramebufferTextureLayer; GLEW_FUN_EXPORT PFNGLGENFRAMEBUFFERSPROC __glewGenFramebuffers; GLEW_FUN_EXPORT PFNGLGENRENDERBUFFERSPROC __glewGenRenderbuffers; GLEW_FUN_EXPORT PFNGLGENERATEMIPMAPPROC __glewGenerateMipmap; @@ -10675,6 +11643,10 @@ GLEW_FUN_EXPORT PFNGLISQUERYARBPROC __glewIsQueryARB; GLEW_FUN_EXPORT PFNGLPOINTPARAMETERFARBPROC __glewPointParameterfARB; GLEW_FUN_EXPORT PFNGLPOINTPARAMETERFVARBPROC __glewPointParameterfvARB; +GLEW_FUN_EXPORT PFNGLPROVOKINGVERTEXPROC __glewProvokingVertex; + +GLEW_FUN_EXPORT PFNGLMINSAMPLESHADINGARBPROC __glewMinSampleShadingARB; + GLEW_FUN_EXPORT PFNGLATTACHOBJECTARBPROC __glewAttachObjectARB; GLEW_FUN_EXPORT PFNGLCOMPILESHADERARBPROC __glewCompileShaderARB; GLEW_FUN_EXPORT PFNGLCREATEPROGRAMOBJECTARBPROC __glewCreateProgramObjectARB; @@ -10715,6 +11687,14 @@ GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX4FVARBPROC __glewUniformMatrix4fvARB; GLEW_FUN_EXPORT PFNGLUSEPROGRAMOBJECTARBPROC __glewUseProgramObjectARB; GLEW_FUN_EXPORT PFNGLVALIDATEPROGRAMARBPROC __glewValidateProgramARB; +GLEW_FUN_EXPORT PFNGLCLIENTWAITSYNCPROC __glewClientWaitSync; +GLEW_FUN_EXPORT PFNGLDELETESYNCPROC __glewDeleteSync; +GLEW_FUN_EXPORT PFNGLFENCESYNCPROC __glewFenceSync; +GLEW_FUN_EXPORT PFNGLGETINTEGER64VPROC __glewGetInteger64v; +GLEW_FUN_EXPORT PFNGLGETSYNCIVPROC __glewGetSynciv; +GLEW_FUN_EXPORT PFNGLISSYNCPROC __glewIsSync; +GLEW_FUN_EXPORT PFNGLWAITSYNCPROC __glewWaitSync; + GLEW_FUN_EXPORT PFNGLTEXBUFFERARBPROC __glewTexBufferARB; GLEW_FUN_EXPORT PFNGLCOMPRESSEDTEXIMAGE1DARBPROC __glewCompressedTexImage1DARB; @@ -10725,11 +11705,27 @@ GLEW_FUN_EXPORT PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC __glewCompressedTexSubImage2 GLEW_FUN_EXPORT PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC __glewCompressedTexSubImage3DARB; GLEW_FUN_EXPORT PFNGLGETCOMPRESSEDTEXIMAGEARBPROC __glewGetCompressedTexImageARB; +GLEW_FUN_EXPORT PFNGLGETMULTISAMPLEFVPROC __glewGetMultisamplefv; +GLEW_FUN_EXPORT PFNGLSAMPLEMASKIPROC __glewSampleMaski; +GLEW_FUN_EXPORT PFNGLTEXIMAGE2DMULTISAMPLEPROC __glewTexImage2DMultisample; +GLEW_FUN_EXPORT PFNGLTEXIMAGE3DMULTISAMPLEPROC __glewTexImage3DMultisample; + GLEW_FUN_EXPORT PFNGLLOADTRANSPOSEMATRIXDARBPROC __glewLoadTransposeMatrixdARB; GLEW_FUN_EXPORT PFNGLLOADTRANSPOSEMATRIXFARBPROC __glewLoadTransposeMatrixfARB; GLEW_FUN_EXPORT PFNGLMULTTRANSPOSEMATRIXDARBPROC __glewMultTransposeMatrixdARB; GLEW_FUN_EXPORT PFNGLMULTTRANSPOSEMATRIXFARBPROC __glewMultTransposeMatrixfARB; +GLEW_FUN_EXPORT PFNGLBINDBUFFERBASEPROC __glewBindBufferBase; +GLEW_FUN_EXPORT PFNGLBINDBUFFERRANGEPROC __glewBindBufferRange; +GLEW_FUN_EXPORT PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC __glewGetActiveUniformBlockName; +GLEW_FUN_EXPORT PFNGLGETACTIVEUNIFORMBLOCKIVPROC __glewGetActiveUniformBlockiv; +GLEW_FUN_EXPORT PFNGLGETACTIVEUNIFORMNAMEPROC __glewGetActiveUniformName; +GLEW_FUN_EXPORT PFNGLGETACTIVEUNIFORMSIVPROC __glewGetActiveUniformsiv; +GLEW_FUN_EXPORT PFNGLGETINTEGERI_VPROC __glewGetIntegeri_v; +GLEW_FUN_EXPORT PFNGLGETUNIFORMBLOCKINDEXPROC __glewGetUniformBlockIndex; +GLEW_FUN_EXPORT PFNGLGETUNIFORMINDICESPROC __glewGetUniformIndices; +GLEW_FUN_EXPORT PFNGLUNIFORMBLOCKBINDINGPROC __glewUniformBlockBinding; + GLEW_FUN_EXPORT PFNGLBINDVERTEXARRAYPROC __glewBindVertexArray; GLEW_FUN_EXPORT PFNGLDELETEVERTEXARRAYSPROC __glewDeleteVertexArrays; GLEW_FUN_EXPORT PFNGLGENVERTEXARRAYSPROC __glewGenVertexArrays; @@ -11004,7 +12000,14 @@ GLEW_FUN_EXPORT PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC __glewCopyTextureSubImage1DEXT GLEW_FUN_EXPORT PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC __glewCopyTextureSubImage2DEXT; GLEW_FUN_EXPORT PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC __glewCopyTextureSubImage3DEXT; GLEW_FUN_EXPORT PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC __glewDisableClientStateIndexedEXT; +GLEW_FUN_EXPORT PFNGLDISABLECLIENTSTATEIEXTPROC __glewDisableClientStateiEXT; +GLEW_FUN_EXPORT PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC __glewDisableVertexArrayAttribEXT; +GLEW_FUN_EXPORT PFNGLDISABLEVERTEXARRAYEXTPROC __glewDisableVertexArrayEXT; GLEW_FUN_EXPORT PFNGLENABLECLIENTSTATEINDEXEDEXTPROC __glewEnableClientStateIndexedEXT; +GLEW_FUN_EXPORT PFNGLENABLECLIENTSTATEIEXTPROC __glewEnableClientStateiEXT; +GLEW_FUN_EXPORT PFNGLENABLEVERTEXARRAYATTRIBEXTPROC __glewEnableVertexArrayAttribEXT; +GLEW_FUN_EXPORT PFNGLENABLEVERTEXARRAYEXTPROC __glewEnableVertexArrayEXT; +GLEW_FUN_EXPORT PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC __glewFlushMappedNamedBufferRangeEXT; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC __glewFramebufferDrawBufferEXT; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC __glewFramebufferDrawBuffersEXT; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERREADBUFFEREXTPROC __glewFramebufferReadBufferEXT; @@ -11013,7 +12016,9 @@ GLEW_FUN_EXPORT PFNGLGENERATETEXTUREMIPMAPEXTPROC __glewGenerateTextureMipmapEXT GLEW_FUN_EXPORT PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC __glewGetCompressedMultiTexImageEXT; GLEW_FUN_EXPORT PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC __glewGetCompressedTextureImageEXT; GLEW_FUN_EXPORT PFNGLGETDOUBLEINDEXEDVEXTPROC __glewGetDoubleIndexedvEXT; +GLEW_FUN_EXPORT PFNGLGETDOUBLEI_VEXTPROC __glewGetDoublei_vEXT; GLEW_FUN_EXPORT PFNGLGETFLOATINDEXEDVEXTPROC __glewGetFloatIndexedvEXT; +GLEW_FUN_EXPORT PFNGLGETFLOATI_VEXTPROC __glewGetFloati_vEXT; GLEW_FUN_EXPORT PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC __glewGetFramebufferParameterivEXT; GLEW_FUN_EXPORT PFNGLGETMULTITEXENVFVEXTPROC __glewGetMultiTexEnvfvEXT; GLEW_FUN_EXPORT PFNGLGETMULTITEXENVIVEXTPROC __glewGetMultiTexEnvivEXT; @@ -11039,6 +12044,7 @@ GLEW_FUN_EXPORT PFNGLGETNAMEDPROGRAMSTRINGEXTPROC __glewGetNamedProgramStringEXT GLEW_FUN_EXPORT PFNGLGETNAMEDPROGRAMIVEXTPROC __glewGetNamedProgramivEXT; GLEW_FUN_EXPORT PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC __glewGetNamedRenderbufferParameterivEXT; GLEW_FUN_EXPORT PFNGLGETPOINTERINDEXEDVEXTPROC __glewGetPointerIndexedvEXT; +GLEW_FUN_EXPORT PFNGLGETPOINTERI_VEXTPROC __glewGetPointeri_vEXT; GLEW_FUN_EXPORT PFNGLGETTEXTUREIMAGEEXTPROC __glewGetTextureImageEXT; GLEW_FUN_EXPORT PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC __glewGetTextureLevelParameterfvEXT; GLEW_FUN_EXPORT PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC __glewGetTextureLevelParameterivEXT; @@ -11046,7 +12052,12 @@ GLEW_FUN_EXPORT PFNGLGETTEXTUREPARAMETERIIVEXTPROC __glewGetTextureParameterIivE GLEW_FUN_EXPORT PFNGLGETTEXTUREPARAMETERIUIVEXTPROC __glewGetTextureParameterIuivEXT; GLEW_FUN_EXPORT PFNGLGETTEXTUREPARAMETERFVEXTPROC __glewGetTextureParameterfvEXT; GLEW_FUN_EXPORT PFNGLGETTEXTUREPARAMETERIVEXTPROC __glewGetTextureParameterivEXT; +GLEW_FUN_EXPORT PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC __glewGetVertexArrayIntegeri_vEXT; +GLEW_FUN_EXPORT PFNGLGETVERTEXARRAYINTEGERVEXTPROC __glewGetVertexArrayIntegervEXT; +GLEW_FUN_EXPORT PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC __glewGetVertexArrayPointeri_vEXT; +GLEW_FUN_EXPORT PFNGLGETVERTEXARRAYPOINTERVEXTPROC __glewGetVertexArrayPointervEXT; GLEW_FUN_EXPORT PFNGLMAPNAMEDBUFFEREXTPROC __glewMapNamedBufferEXT; +GLEW_FUN_EXPORT PFNGLMAPNAMEDBUFFERRANGEEXTPROC __glewMapNamedBufferRangeEXT; GLEW_FUN_EXPORT PFNGLMATRIXFRUSTUMEXTPROC __glewMatrixFrustumEXT; GLEW_FUN_EXPORT PFNGLMATRIXLOADIDENTITYEXTPROC __glewMatrixLoadIdentityEXT; GLEW_FUN_EXPORT PFNGLMATRIXLOADTRANSPOSEDEXTPROC __glewMatrixLoadTransposedEXT; @@ -11093,6 +12104,7 @@ GLEW_FUN_EXPORT PFNGLMULTITEXSUBIMAGE2DEXTPROC __glewMultiTexSubImage2DEXT; GLEW_FUN_EXPORT PFNGLMULTITEXSUBIMAGE3DEXTPROC __glewMultiTexSubImage3DEXT; GLEW_FUN_EXPORT PFNGLNAMEDBUFFERDATAEXTPROC __glewNamedBufferDataEXT; GLEW_FUN_EXPORT PFNGLNAMEDBUFFERSUBDATAEXTPROC __glewNamedBufferSubDataEXT; +GLEW_FUN_EXPORT PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC __glewNamedCopyBufferSubDataEXT; GLEW_FUN_EXPORT PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC __glewNamedFramebufferRenderbufferEXT; GLEW_FUN_EXPORT PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC __glewNamedFramebufferTexture1DEXT; GLEW_FUN_EXPORT PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC __glewNamedFramebufferTexture2DEXT; @@ -11164,6 +12176,17 @@ GLEW_FUN_EXPORT PFNGLTEXTURESUBIMAGE1DEXTPROC __glewTextureSubImage1DEXT; GLEW_FUN_EXPORT PFNGLTEXTURESUBIMAGE2DEXTPROC __glewTextureSubImage2DEXT; GLEW_FUN_EXPORT PFNGLTEXTURESUBIMAGE3DEXTPROC __glewTextureSubImage3DEXT; GLEW_FUN_EXPORT PFNGLUNMAPNAMEDBUFFEREXTPROC __glewUnmapNamedBufferEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYCOLOROFFSETEXTPROC __glewVertexArrayColorOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC __glewVertexArrayEdgeFlagOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC __glewVertexArrayFogCoordOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYINDEXOFFSETEXTPROC __glewVertexArrayIndexOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC __glewVertexArrayMultiTexCoordOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYNORMALOFFSETEXTPROC __glewVertexArrayNormalOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC __glewVertexArraySecondaryColorOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC __glewVertexArrayTexCoordOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC __glewVertexArrayVertexAttribIOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC __glewVertexArrayVertexAttribOffsetEXT; +GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC __glewVertexArrayVertexOffsetEXT; GLEW_FUN_EXPORT PFNGLCOLORMASKINDEXEDEXTPROC __glewColorMaskIndexedEXT; GLEW_FUN_EXPORT PFNGLDISABLEINDEXEDEXTPROC __glewDisableIndexedEXT; @@ -11309,6 +12332,8 @@ GLEW_FUN_EXPORT PFNGLPOINTPARAMETERFVEXTPROC __glewPointParameterfvEXT; GLEW_FUN_EXPORT PFNGLPOLYGONOFFSETEXTPROC __glewPolygonOffsetEXT; +GLEW_FUN_EXPORT PFNGLPROVOKINGVERTEXEXTPROC __glewProvokingVertexEXT; + GLEW_FUN_EXPORT PFNGLBEGINSCENEEXTPROC __glewBeginSceneEXT; GLEW_FUN_EXPORT PFNGLENDSCENEEXTPROC __glewEndSceneEXT; @@ -11330,6 +12355,10 @@ GLEW_FUN_EXPORT PFNGLSECONDARYCOLOR3USEXTPROC __glewSecondaryColor3usEXT; GLEW_FUN_EXPORT PFNGLSECONDARYCOLOR3USVEXTPROC __glewSecondaryColor3usvEXT; GLEW_FUN_EXPORT PFNGLSECONDARYCOLORPOINTEREXTPROC __glewSecondaryColorPointerEXT; +GLEW_FUN_EXPORT PFNGLACTIVEPROGRAMEXTPROC __glewActiveProgramEXT; +GLEW_FUN_EXPORT PFNGLCREATESHADERPROGRAMEXTPROC __glewCreateShaderProgramEXT; +GLEW_FUN_EXPORT PFNGLUSESHADERPROGRAMEXTPROC __glewUseShaderProgramEXT; + GLEW_FUN_EXPORT PFNGLACTIVESTENCILFACEEXTPROC __glewActiveStencilFaceEXT; GLEW_FUN_EXPORT PFNGLTEXSUBIMAGE1DEXTPROC __glewTexSubImage1DEXT; @@ -11491,6 +12520,8 @@ GLEW_FUN_EXPORT PFNGLWINDOWPOS4SVMESAPROC __glewWindowPos4svMESA; GLEW_FUN_EXPORT PFNGLBEGINCONDITIONALRENDERNVPROC __glewBeginConditionalRenderNV; GLEW_FUN_EXPORT PFNGLENDCONDITIONALRENDERNVPROC __glewEndConditionalRenderNV; +GLEW_FUN_EXPORT PFNGLCOPYIMAGESUBDATANVPROC __glewCopyImageSubDataNV; + GLEW_FUN_EXPORT PFNGLCLEARDEPTHDNVPROC __glewClearDepthdNV; GLEW_FUN_EXPORT PFNGLDEPTHBOUNDSDNVPROC __glewDepthBoundsdNV; GLEW_FUN_EXPORT PFNGLDEPTHRANGEDNVPROC __glewDepthRangedNV; @@ -11612,7 +12643,6 @@ GLEW_FUN_EXPORT PFNGLGETVIDEOUI64VNVPROC __glewGetVideoui64vNV; GLEW_FUN_EXPORT PFNGLGETVIDEOUIVNVPROC __glewGetVideouivNV; GLEW_FUN_EXPORT PFNGLPRESENTFRAMEDUALFILLNVPROC __glewPresentFrameDualFillNV; GLEW_FUN_EXPORT PFNGLPRESENTFRAMEKEYEDNVPROC __glewPresentFrameKeyedNV; -GLEW_FUN_EXPORT PFNGLVIDEOPARAMETERIVNVPROC __glewVideoParameterivNV; GLEW_FUN_EXPORT PFNGLPRIMITIVERESTARTINDEXNVPROC __glewPrimitiveRestartIndexNV; GLEW_FUN_EXPORT PFNGLPRIMITIVERESTARTNVPROC __glewPrimitiveRestartNV; @@ -11634,6 +12664,23 @@ GLEW_FUN_EXPORT PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC __glewGetFinalCombin GLEW_FUN_EXPORT PFNGLCOMBINERSTAGEPARAMETERFVNVPROC __glewCombinerStageParameterfvNV; GLEW_FUN_EXPORT PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC __glewGetCombinerStageParameterfvNV; +GLEW_FUN_EXPORT PFNGLGETBUFFERPARAMETERUI64VNVPROC __glewGetBufferParameterui64vNV; +GLEW_FUN_EXPORT PFNGLGETINTEGERUI64VNVPROC __glewGetIntegerui64vNV; +GLEW_FUN_EXPORT PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC __glewGetNamedBufferParameterui64vNV; +GLEW_FUN_EXPORT PFNGLGETUNIFORMUI64VNVPROC __glewGetUniformui64vNV; +GLEW_FUN_EXPORT PFNGLISBUFFERRESIDENTNVPROC __glewIsBufferResidentNV; +GLEW_FUN_EXPORT PFNGLISNAMEDBUFFERRESIDENTNVPROC __glewIsNamedBufferResidentNV; +GLEW_FUN_EXPORT PFNGLMAKEBUFFERNONRESIDENTNVPROC __glewMakeBufferNonResidentNV; +GLEW_FUN_EXPORT PFNGLMAKEBUFFERRESIDENTNVPROC __glewMakeBufferResidentNV; +GLEW_FUN_EXPORT PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC __glewMakeNamedBufferNonResidentNV; +GLEW_FUN_EXPORT PFNGLMAKENAMEDBUFFERRESIDENTNVPROC __glewMakeNamedBufferResidentNV; +GLEW_FUN_EXPORT PFNGLPROGRAMUNIFORMUI64NVPROC __glewProgramUniformui64NV; +GLEW_FUN_EXPORT PFNGLPROGRAMUNIFORMUI64VNVPROC __glewProgramUniformui64vNV; +GLEW_FUN_EXPORT PFNGLUNIFORMUI64NVPROC __glewUniformui64NV; +GLEW_FUN_EXPORT PFNGLUNIFORMUI64VNVPROC __glewUniformui64vNV; + +GLEW_FUN_EXPORT PFNGLTEXTUREBARRIERNVPROC __glewTextureBarrierNV; + GLEW_FUN_EXPORT PFNGLACTIVEVARYINGNVPROC __glewActiveVaryingNV; GLEW_FUN_EXPORT PFNGLBEGINTRANSFORMFEEDBACKNVPROC __glewBeginTransformFeedbackNV; GLEW_FUN_EXPORT PFNGLBINDBUFFERBASENVPROC __glewBindBufferBaseNV; @@ -11646,9 +12693,30 @@ GLEW_FUN_EXPORT PFNGLGETVARYINGLOCATIONNVPROC __glewGetVaryingLocationNV; GLEW_FUN_EXPORT PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC __glewTransformFeedbackAttribsNV; GLEW_FUN_EXPORT PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC __glewTransformFeedbackVaryingsNV; +GLEW_FUN_EXPORT PFNGLBINDTRANSFORMFEEDBACKNVPROC __glewBindTransformFeedbackNV; +GLEW_FUN_EXPORT PFNGLDELETETRANSFORMFEEDBACKSNVPROC __glewDeleteTransformFeedbacksNV; +GLEW_FUN_EXPORT PFNGLDRAWTRANSFORMFEEDBACKNVPROC __glewDrawTransformFeedbackNV; +GLEW_FUN_EXPORT PFNGLGENTRANSFORMFEEDBACKSNVPROC __glewGenTransformFeedbacksNV; +GLEW_FUN_EXPORT PFNGLISTRANSFORMFEEDBACKNVPROC __glewIsTransformFeedbackNV; +GLEW_FUN_EXPORT PFNGLPAUSETRANSFORMFEEDBACKNVPROC __glewPauseTransformFeedbackNV; +GLEW_FUN_EXPORT PFNGLRESUMETRANSFORMFEEDBACKNVPROC __glewResumeTransformFeedbackNV; + GLEW_FUN_EXPORT PFNGLFLUSHVERTEXARRAYRANGENVPROC __glewFlushVertexArrayRangeNV; GLEW_FUN_EXPORT PFNGLVERTEXARRAYRANGENVPROC __glewVertexArrayRangeNV; +GLEW_FUN_EXPORT PFNGLBUFFERADDRESSRANGENVPROC __glewBufferAddressRangeNV; +GLEW_FUN_EXPORT PFNGLCOLORFORMATNVPROC __glewColorFormatNV; +GLEW_FUN_EXPORT PFNGLEDGEFLAGFORMATNVPROC __glewEdgeFlagFormatNV; +GLEW_FUN_EXPORT PFNGLFOGCOORDFORMATNVPROC __glewFogCoordFormatNV; +GLEW_FUN_EXPORT PFNGLGETINTEGERUI64I_VNVPROC __glewGetIntegerui64i_vNV; +GLEW_FUN_EXPORT PFNGLINDEXFORMATNVPROC __glewIndexFormatNV; +GLEW_FUN_EXPORT PFNGLNORMALFORMATNVPROC __glewNormalFormatNV; +GLEW_FUN_EXPORT PFNGLSECONDARYCOLORFORMATNVPROC __glewSecondaryColorFormatNV; +GLEW_FUN_EXPORT PFNGLTEXCOORDFORMATNVPROC __glewTexCoordFormatNV; +GLEW_FUN_EXPORT PFNGLVERTEXATTRIBFORMATNVPROC __glewVertexAttribFormatNV; +GLEW_FUN_EXPORT PFNGLVERTEXATTRIBIFORMATNVPROC __glewVertexAttribIFormatNV; +GLEW_FUN_EXPORT PFNGLVERTEXFORMATNVPROC __glewVertexFormatNV; + GLEW_FUN_EXPORT PFNGLAREPROGRAMSRESIDENTNVPROC __glewAreProgramsResidentNV; GLEW_FUN_EXPORT PFNGLBINDPROGRAMNVPROC __glewBindProgramNV; GLEW_FUN_EXPORT PFNGLDELETEPROGRAMSNVPROC __glewDeleteProgramsNV; @@ -11866,26 +12934,43 @@ GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_1_5; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_2_0; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_2_1; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_3_0; +GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_3_1; +GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_3_2; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_tbuffer; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_texture_compression_FXT1; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_draw_buffers_blend; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_performance_monitor; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_texture_texture4; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_vertex_shader_tessellator; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_aux_depth_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_client_storage; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_element_array; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_fence; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_float_pixels; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_flush_buffer_range; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_object_purgeable; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_pixel_buffer; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_rgb_422; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_row_bytes; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_specular_vector; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_range; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_transform_hint; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_vertex_array_object; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_vertex_array_range; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_vertex_program_evaluators; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_ycbcr_422; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_color_buffer_float; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_compatibility; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_copy_buffer; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_depth_buffer_float; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_depth_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_depth_texture; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_draw_buffers; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_draw_buffers_blend; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_draw_elements_base_vertex; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_draw_instanced; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_fragment_coord_conventions; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_fragment_program; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_fragment_program_shadow; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_fragment_shader; @@ -11904,25 +12989,36 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_occlusion_query; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_pixel_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_point_parameters; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_point_sprite; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_provoking_vertex; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sample_shading; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_seamless_cube_map; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_shader_objects; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_shader_texture_lod; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_shading_language_100; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_shadow; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_shadow_ambient; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sync; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_border_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_compression; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_compression_rgtc; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_cube_map; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_cube_map_array; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_add; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_combine; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_crossbar; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_dot3; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_float; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_gather; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_mirrored_repeat; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_non_power_of_two; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_query_lod; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_rectangle; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_rg; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_transpose_matrix; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_uniform_buffer_object; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_array_bgra; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_array_object; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_blend; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_buffer_object; @@ -11938,6 +13034,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ATI_element_array; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_envmap_bumpmap; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_fragment_shader; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_map_object_buffer; +GLEW_VAR_EXPORT GLboolean __GLEW_ATI_meminfo; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_pn_triangles; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_separate_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_shader_texture_lod; @@ -12000,9 +13097,11 @@ GLEW_VAR_EXPORT GLboolean __GLEW_EXT_pixel_transform; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_pixel_transform_color_table; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_point_parameters; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_polygon_offset; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_provoking_vertex; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_rescale_normal; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_scene_marker; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_secondary_color; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_separate_shader_objects; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_separate_specular_color; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shadow_funcs; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shared_texture_palette; @@ -12033,6 +13132,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_perturb_normal; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_rectangle; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_sRGB; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_shared_exponent; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_snorm; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_swizzle; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_timer_query; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_transform_feedback; @@ -12065,6 +13165,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_MESA_ycbcr_texture; GLEW_VAR_EXPORT GLboolean __GLEW_NV_blend_square; GLEW_VAR_EXPORT GLboolean __GLEW_NV_conditional_render; GLEW_VAR_EXPORT GLboolean __GLEW_NV_copy_depth_to_color; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_copy_image; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_buffer_float; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_range_unclamped; @@ -12087,14 +13188,17 @@ GLEW_VAR_EXPORT GLboolean __GLEW_NV_multisample_filter_hint; GLEW_VAR_EXPORT GLboolean __GLEW_NV_occlusion_query; GLEW_VAR_EXPORT GLboolean __GLEW_NV_packed_depth_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_NV_parameter_buffer_object; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_parameter_buffer_object2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_pixel_data_range; GLEW_VAR_EXPORT GLboolean __GLEW_NV_point_sprite; GLEW_VAR_EXPORT GLboolean __GLEW_NV_present_video; GLEW_VAR_EXPORT GLboolean __GLEW_NV_primitive_restart; GLEW_VAR_EXPORT GLboolean __GLEW_NV_register_combiners; GLEW_VAR_EXPORT GLboolean __GLEW_NV_register_combiners2; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_buffer_load; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texgen_emboss; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texgen_reflection; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_barrier; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_compression_vtc; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_env_combine4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_expand_normal; @@ -12103,8 +13207,10 @@ GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader3; GLEW_VAR_EXPORT GLboolean __GLEW_NV_transform_feedback; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_transform_feedback2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_array_range; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_array_range2; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_buffer_unified_memory; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program1_1; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program2; @@ -12244,6 +13350,7 @@ GLEWAPI const GLubyte* glewGetString (GLenum name); #undef GLEW_APIENTRY_DEFINED #undef APIENTRY #undef GLAPIENTRY +#define GLAPIENTRY #endif #ifdef GLEW_CALLBACK_DEFINED diff --git a/include/GL/glxew.h b/include/GL/glxew.h index a29030da3c..f19e573f84 100644 --- a/include/GL/glxew.h +++ b/include/GL/glxew.h @@ -362,6 +362,19 @@ typedef GLXContext ( * PFNGLXCREATECONTEXTATTRIBSARBPROC) (Display* dpy, GLXFBCo #endif /* GLX_ARB_create_context */ +/* --------------------- GLX_ARB_create_context_profile -------------------- */ + +#ifndef GLX_ARB_create_context_profile +#define GLX_ARB_create_context_profile 1 + +#define GLX_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001 +#define GLX_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002 +#define GLX_CONTEXT_PROFILE_MASK_ARB 0x9126 + +#define GLXEW_ARB_create_context_profile GLXEW_GET_VAR(__GLXEW_ARB_create_context_profile) + +#endif /* GLX_ARB_create_context_profile */ + /* ------------------------- GLX_ARB_fbconfig_float ------------------------ */ #ifndef GLX_ARB_fbconfig_float @@ -529,6 +542,22 @@ typedef int ( * PFNGLXQUERYCONTEXTINFOEXTPROC) (Display* dpy, GLXContext context #endif /* GLX_EXT_scene_marker */ +/* -------------------------- GLX_EXT_swap_control ------------------------- */ + +#ifndef GLX_EXT_swap_control +#define GLX_EXT_swap_control 1 + +#define GLX_SWAP_INTERVAL_EXT 0x20F1 +#define GLX_MAX_SWAP_INTERVAL_EXT 0x20F2 + +typedef void ( * PFNGLXSWAPINTERVALEXTPROC) (Display* dpy, GLXDrawable drawable, int interval); + +#define glXSwapIntervalEXT GLXEW_GET_FUN(__glewXSwapIntervalEXT) + +#define GLXEW_EXT_swap_control GLXEW_GET_VAR(__GLXEW_EXT_swap_control) + +#endif /* GLX_EXT_swap_control */ + /* ---------------------- GLX_EXT_texture_from_pixmap ---------------------- */ #ifndef GLX_EXT_texture_from_pixmap @@ -683,6 +712,19 @@ typedef GLboolean ( * PFNGLXSET3DFXMODEMESAPROC) (GLint mode); #endif /* GLX_MESA_set_3dfx_mode */ +/* --------------------------- GLX_NV_copy_image --------------------------- */ + +#ifndef GLX_NV_copy_image +#define GLX_NV_copy_image 1 + +typedef void ( * PFNGLXCOPYIMAGESUBDATANVPROC) (Display *dpy, GLXContext srcCtx, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLXContext dstCtx, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); + +#define glXCopyImageSubDataNV GLXEW_GET_FUN(__glewXCopyImageSubDataNV) + +#define GLXEW_NV_copy_image GLXEW_GET_VAR(__GLXEW_NV_copy_image) + +#endif /* GLX_NV_copy_image */ + /* -------------------------- GLX_NV_float_buffer -------------------------- */ #ifndef GLX_NV_float_buffer @@ -1217,6 +1259,8 @@ extern PFNGLXGETCONTEXTIDEXTPROC __glewXGetContextIDEXT; extern PFNGLXIMPORTCONTEXTEXTPROC __glewXImportContextEXT; extern PFNGLXQUERYCONTEXTINFOEXTPROC __glewXQueryContextInfoEXT; +extern PFNGLXSWAPINTERVALEXTPROC __glewXSwapIntervalEXT; + extern PFNGLXBINDTEXIMAGEEXTPROC __glewXBindTexImageEXT; extern PFNGLXRELEASETEXIMAGEEXTPROC __glewXReleaseTexImageEXT; @@ -1230,6 +1274,8 @@ extern PFNGLXRELEASEBUFFERSMESAPROC __glewXReleaseBuffersMESA; extern PFNGLXSET3DFXMODEMESAPROC __glewXSet3DfxModeMESA; +extern PFNGLXCOPYIMAGESUBDATANVPROC __glewXCopyImageSubDataNV; + extern PFNGLXBINDVIDEODEVICENVPROC __glewXBindVideoDeviceNV; extern PFNGLXENUMERATEVIDEODEVICESNVPROC __glewXEnumerateVideoDevicesNV; @@ -1318,6 +1364,7 @@ GLXEW_EXPORT GLboolean __GLXEW_VERSION_1_3; GLXEW_EXPORT GLboolean __GLXEW_VERSION_1_4; GLXEW_EXPORT GLboolean __GLXEW_3DFX_multisample; GLXEW_EXPORT GLboolean __GLXEW_ARB_create_context; +GLXEW_EXPORT GLboolean __GLXEW_ARB_create_context_profile; GLXEW_EXPORT GLboolean __GLXEW_ARB_fbconfig_float; GLXEW_EXPORT GLboolean __GLXEW_ARB_framebuffer_sRGB; GLXEW_EXPORT GLboolean __GLXEW_ARB_get_proc_address; @@ -1328,6 +1375,7 @@ GLXEW_EXPORT GLboolean __GLXEW_EXT_fbconfig_packed_float; GLXEW_EXPORT GLboolean __GLXEW_EXT_framebuffer_sRGB; GLXEW_EXPORT GLboolean __GLXEW_EXT_import_context; GLXEW_EXPORT GLboolean __GLXEW_EXT_scene_marker; +GLXEW_EXPORT GLboolean __GLXEW_EXT_swap_control; GLXEW_EXPORT GLboolean __GLXEW_EXT_texture_from_pixmap; GLXEW_EXPORT GLboolean __GLXEW_EXT_visual_info; GLXEW_EXPORT GLboolean __GLXEW_EXT_visual_rating; @@ -1336,6 +1384,7 @@ GLXEW_EXPORT GLboolean __GLXEW_MESA_copy_sub_buffer; GLXEW_EXPORT GLboolean __GLXEW_MESA_pixmap_colormap; GLXEW_EXPORT GLboolean __GLXEW_MESA_release_buffers; GLXEW_EXPORT GLboolean __GLXEW_MESA_set_3dfx_mode; +GLXEW_EXPORT GLboolean __GLXEW_NV_copy_image; GLXEW_EXPORT GLboolean __GLXEW_NV_float_buffer; GLXEW_EXPORT GLboolean __GLXEW_NV_present_video; GLXEW_EXPORT GLboolean __GLXEW_NV_swap_group; diff --git a/include/GL/wglew.h b/include/GL/wglew.h index 2eaad3651a..7c7a380479 100644 --- a/include/GL/wglew.h +++ b/include/GL/wglew.h @@ -62,11 +62,12 @@ #define __wglext_h_ -#if !defined(APIENTRY) && !defined(__CYGWIN__) +#if !defined(WINAPI) # ifndef WIN32_LEAN_AND_MEAN # define WIN32_LEAN_AND_MEAN 1 # endif #include <windows.h> +# undef WIN32_LEAN_AND_MEAN #endif /* @@ -117,6 +118,46 @@ typedef BOOL (WINAPI * PFNWGLSETSTEREOEMITTERSTATE3DLPROC) (HDC hDC, UINT uState #endif /* WGL_3DL_stereo_control */ +/* ------------------------ WGL_AMD_gpu_association ------------------------ */ + +#ifndef WGL_AMD_gpu_association +#define WGL_AMD_gpu_association 1 + +#define WGL_GPU_VENDOR_AMD 0x1F00 +#define WGL_GPU_RENDERER_STRING_AMD 0x1F01 +#define WGL_GPU_OPENGL_VERSION_STRING_AMD 0x1F02 +#define WGL_GPU_FASTEST_TARGET_GPUS_AMD 0x21A2 +#define WGL_GPU_RAM_AMD 0x21A3 +#define WGL_GPU_CLOCK_AMD 0x21A4 +#define WGL_GPU_NUM_PIPES_AMD 0x21A5 +#define WGL_GPU_NUM_SIMD_AMD 0x21A6 +#define WGL_GPU_NUM_RB_AMD 0x21A7 +#define WGL_GPU_NUM_SPI_AMD 0x21A8 + +typedef VOID (WINAPI * PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC) (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC) (UINT id); +typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC) (UINT id, HGLRC hShareContext, const int* attribList); +typedef BOOL (WINAPI * PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC) (HGLRC hglrc); +typedef UINT (WINAPI * PFNWGLGETCONTEXTGPUIDAMDPROC) (HGLRC hglrc); +typedef HGLRC (WINAPI * PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC) (void); +typedef UINT (WINAPI * PFNWGLGETGPUIDSAMDPROC) (UINT maxCount, UINT* ids); +typedef INT (WINAPI * PFNWGLGETGPUINFOAMDPROC) (UINT id, INT property, GLenum dataType, UINT size, void* data); +typedef BOOL (WINAPI * PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC) (HGLRC hglrc); + +#define wglBlitContextFramebufferAMD WGLEW_GET_FUN(__wglewBlitContextFramebufferAMD) +#define wglCreateAssociatedContextAMD WGLEW_GET_FUN(__wglewCreateAssociatedContextAMD) +#define wglCreateAssociatedContextAttribsAMD WGLEW_GET_FUN(__wglewCreateAssociatedContextAttribsAMD) +#define wglDeleteAssociatedContextAMD WGLEW_GET_FUN(__wglewDeleteAssociatedContextAMD) +#define wglGetContextGPUIDAMD WGLEW_GET_FUN(__wglewGetContextGPUIDAMD) +#define wglGetCurrentAssociatedContextAMD WGLEW_GET_FUN(__wglewGetCurrentAssociatedContextAMD) +#define wglGetGPUIDsAMD WGLEW_GET_FUN(__wglewGetGPUIDsAMD) +#define wglGetGPUInfoAMD WGLEW_GET_FUN(__wglewGetGPUInfoAMD) +#define wglMakeAssociatedContextCurrentAMD WGLEW_GET_FUN(__wglewMakeAssociatedContextCurrentAMD) + +#define WGLEW_AMD_gpu_association WGLEW_GET_VAR(__WGLEW_AMD_gpu_association) + +#endif /* WGL_AMD_gpu_association */ + /* ------------------------- WGL_ARB_buffer_region ------------------------- */ #ifndef WGL_ARB_buffer_region @@ -161,6 +202,19 @@ typedef HGLRC (WINAPI * PFNWGLCREATECONTEXTATTRIBSARBPROC) (HDC hDC, HGLRC hShar #endif /* WGL_ARB_create_context */ +/* --------------------- WGL_ARB_create_context_profile -------------------- */ + +#ifndef WGL_ARB_create_context_profile +#define WGL_ARB_create_context_profile 1 + +#define WGL_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001 +#define WGL_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002 +#define WGL_CONTEXT_PROFILE_MASK_ARB 0x9126 + +#define WGLEW_ARB_create_context_profile WGLEW_GET_VAR(__WGLEW_ARB_create_context_profile) + +#endif /* WGL_ARB_create_context_profile */ + /* ----------------------- WGL_ARB_extensions_string ----------------------- */ #ifndef WGL_ARB_extensions_string @@ -752,6 +806,19 @@ typedef BOOL (WINAPI * PFNWGLQUERYFRAMETRACKINGI3DPROC) (DWORD* pFrameCount, DWO #endif /* WGL_I3D_swap_frame_usage */ +/* --------------------------- WGL_NV_copy_image --------------------------- */ + +#ifndef WGL_NV_copy_image +#define WGL_NV_copy_image 1 + +typedef BOOL (WINAPI * PFNWGLCOPYIMAGESUBDATANVPROC) (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); + +#define wglCopyImageSubDataNV WGLEW_GET_FUN(__wglewCopyImageSubDataNV) + +#define WGLEW_NV_copy_image WGLEW_GET_VAR(__WGLEW_NV_copy_image) + +#endif /* WGL_NV_copy_image */ + /* -------------------------- WGL_NV_float_buffer -------------------------- */ #ifndef WGL_NV_float_buffer @@ -863,7 +930,7 @@ typedef BOOL (WINAPI * PFNWGLBINDSWAPBARRIERNVPROC) (GLuint group, GLuint barrie typedef BOOL (WINAPI * PFNWGLJOINSWAPGROUPNVPROC) (HDC hDC, GLuint group); typedef BOOL (WINAPI * PFNWGLQUERYFRAMECOUNTNVPROC) (HDC hDC, GLuint* count); typedef BOOL (WINAPI * PFNWGLQUERYMAXSWAPGROUPSNVPROC) (HDC hDC, GLuint* maxGroups, GLuint *maxBarriers); -typedef BOOL (WINAPI * PFNWGLQUERYSWAPGROUPNVPROC) (HDC hDC, GLuint* group); +typedef BOOL (WINAPI * PFNWGLQUERYSWAPGROUPNVPROC) (HDC hDC, GLuint* group, GLuint *barrier); typedef BOOL (WINAPI * PFNWGLRESETFRAMECOUNTNVPROC) (HDC hDC); #define wglBindSwapBarrierNV WGLEW_GET_FUN(__wglewBindSwapBarrierNV) @@ -969,6 +1036,16 @@ struct WGLEWContextStruct WGLEW_EXPORT PFNWGLSETSTEREOEMITTERSTATE3DLPROC __wglewSetStereoEmitterState3DL; +WGLEW_EXPORT PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC __wglewBlitContextFramebufferAMD; +WGLEW_EXPORT PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC __wglewCreateAssociatedContextAMD; +WGLEW_EXPORT PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC __wglewCreateAssociatedContextAttribsAMD; +WGLEW_EXPORT PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC __wglewDeleteAssociatedContextAMD; +WGLEW_EXPORT PFNWGLGETCONTEXTGPUIDAMDPROC __wglewGetContextGPUIDAMD; +WGLEW_EXPORT PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC __wglewGetCurrentAssociatedContextAMD; +WGLEW_EXPORT PFNWGLGETGPUIDSAMDPROC __wglewGetGPUIDsAMD; +WGLEW_EXPORT PFNWGLGETGPUINFOAMDPROC __wglewGetGPUInfoAMD; +WGLEW_EXPORT PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC __wglewMakeAssociatedContextCurrentAMD; + WGLEW_EXPORT PFNWGLCREATEBUFFERREGIONARBPROC __wglewCreateBufferRegionARB; WGLEW_EXPORT PFNWGLDELETEBUFFERREGIONARBPROC __wglewDeleteBufferRegionARB; WGLEW_EXPORT PFNWGLRESTOREBUFFERREGIONARBPROC __wglewRestoreBufferRegionARB; @@ -1054,6 +1131,8 @@ WGLEW_EXPORT PFNWGLENDFRAMETRACKINGI3DPROC __wglewEndFrameTrackingI3D; WGLEW_EXPORT PFNWGLGETFRAMEUSAGEI3DPROC __wglewGetFrameUsageI3D; WGLEW_EXPORT PFNWGLQUERYFRAMETRACKINGI3DPROC __wglewQueryFrameTrackingI3D; +WGLEW_EXPORT PFNWGLCOPYIMAGESUBDATANVPROC __wglewCopyImageSubDataNV; + WGLEW_EXPORT PFNWGLCREATEAFFINITYDCNVPROC __wglewCreateAffinityDCNV; WGLEW_EXPORT PFNWGLDELETEDCNVPROC __wglewDeleteDCNV; WGLEW_EXPORT PFNWGLENUMGPUDEVICESNVPROC __wglewEnumGpuDevicesNV; @@ -1089,8 +1168,10 @@ WGLEW_EXPORT PFNWGLWAITFORMSCOMLPROC __wglewWaitForMscOML; WGLEW_EXPORT PFNWGLWAITFORSBCOMLPROC __wglewWaitForSbcOML; WGLEW_EXPORT GLboolean __WGLEW_3DFX_multisample; WGLEW_EXPORT GLboolean __WGLEW_3DL_stereo_control; +WGLEW_EXPORT GLboolean __WGLEW_AMD_gpu_association; WGLEW_EXPORT GLboolean __WGLEW_ARB_buffer_region; WGLEW_EXPORT GLboolean __WGLEW_ARB_create_context; +WGLEW_EXPORT GLboolean __WGLEW_ARB_create_context_profile; WGLEW_EXPORT GLboolean __WGLEW_ARB_extensions_string; WGLEW_EXPORT GLboolean __WGLEW_ARB_framebuffer_sRGB; WGLEW_EXPORT GLboolean __WGLEW_ARB_make_current_read; @@ -1117,6 +1198,7 @@ WGLEW_EXPORT GLboolean __WGLEW_I3D_genlock; WGLEW_EXPORT GLboolean __WGLEW_I3D_image_buffer; WGLEW_EXPORT GLboolean __WGLEW_I3D_swap_frame_lock; WGLEW_EXPORT GLboolean __WGLEW_I3D_swap_frame_usage; +WGLEW_EXPORT GLboolean __WGLEW_NV_copy_image; WGLEW_EXPORT GLboolean __WGLEW_NV_float_buffer; WGLEW_EXPORT GLboolean __WGLEW_NV_gpu_affinity; WGLEW_EXPORT GLboolean __WGLEW_NV_present_video; diff --git a/include/VG/vgplatform.h b/include/VG/vgplatform.h index e4f269f658..2c626a971e 100644 --- a/include/VG/vgplatform.h +++ b/include/VG/vgplatform.h @@ -38,6 +38,11 @@ extern "C" {
#endif
+#if defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303
+# define VG_API_CALL __attribute__((visibility("default")))
+# define VGU_API_CALL __attribute__((visibility("default")))
+#endif
+
#ifndef VG_API_CALL
#if defined(OPENVG_STATIC_LIBRARY)
# define VG_API_CALL
diff --git a/include/c99/stdbool.h b/include/c99/stdbool.h new file mode 100644 index 0000000000..99a735dfa7 --- /dev/null +++ b/include/c99/stdbool.h @@ -0,0 +1,46 @@ +/************************************************************************** + * + * Copyright 2007-2010 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR + * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL + * THE COPYRIGHT HOLDERS, AUTHORS AND/OR ITS SUPPLIERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE + * USE OR OTHER DEALINGS IN THE SOFTWARE. + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + **************************************************************************/ + +#ifndef _STDBOOL_H_ +#define _STDBOOL_H_ + +#ifndef __cplusplus + +#define false 0 +#define true 1 +#define bool _Bool + +/* For compilers that don't have the builtin _Bool type. */ +#if defined(_MSC_VER) || (__STDC_VERSION__ < 199901L && __GNUC__ < 3) +typedef unsigned char _Bool; +#endif + +#endif /* !__cplusplus */ + +#define __bool_true_false_are_defined 1 + +#endif /* !_STDBOOL_H_ */ diff --git a/include/c99/stdint.h b/include/c99/stdint.h new file mode 100644 index 0000000000..e3802135be --- /dev/null +++ b/include/c99/stdint.h @@ -0,0 +1,119 @@ +/************************************************************************** + * + * Copyright 2007-2010 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR + * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL + * THE COPYRIGHT HOLDERS, AUTHORS AND/OR ITS SUPPLIERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE + * USE OR OTHER DEALINGS IN THE SOFTWARE. + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + **************************************************************************/ + +/* + * stdint.h -- + * + * Portable subset of C99's stdint.h. + * + * At the moment it only supports MSVC, given all other mainstream compilers + * already support C99. If this is necessary for other compilers then it + * might be worth to replace this with + * http://www.azillionmonkeys.com/qed/pstdint.h. + */ + +#ifndef _STDINT_H_ +#define _STDINT_H_ + + +#ifndef INT8_MAX +#define INT8_MAX 127 +#endif +#ifndef INT8_MIN +#define INT8_MIN -128 +#endif +#ifndef UINT8_MAX +#define UINT8_MAX 255 +#endif +#ifndef INT16_MAX +#define INT16_MAX 32767 +#endif +#ifndef INT16_MIN +#define INT16_MIN -32768 +#endif +#ifndef UINT16_MAX +#define UINT16_MAX 65535 +#endif +#ifndef INT32_MAX +#define INT32_MAX 2147483647 +#endif +#ifndef INT32_MIN +#define INT32_MIN -2147483648 +#endif +#ifndef UINT32_MAX +#define UINT32_MAX 4294967295U +#endif + +#ifndef INT8_C +#define INT8_C(__val) __val +#endif +#ifndef UINT8_C +#define UINT8_C(__val) __val +#endif +#ifndef INT16_C +#define INT16_C(__val) __val +#endif +#ifndef UINT16_C +#define UINT16_C(__val) __val +#endif +#ifndef INT32_C +#define INT32_C(__val) __val +#endif +#ifndef UINT32_C +#define UINT32_C(__val) __val##U +#endif + + +#if defined(_MSC_VER) + +typedef __int8 int8_t; +typedef unsigned __int8 uint8_t; +typedef __int16 int16_t; +typedef unsigned __int16 uint16_t; +#ifndef __eglplatform_h_ +typedef __int32 int32_t; +#endif +typedef unsigned __int32 uint32_t; +typedef __int64 int64_t; +typedef unsigned __int64 uint64_t; + +#if defined(_WIN64) +typedef __int64 intptr_t; +typedef unsigned __int64 uintptr_t; +#else +typedef __int32 intptr_t; +typedef unsigned __int32 uintptr_t; +#endif + +#define INT64_C(__val) __val##i64 +#define UINT64_C(__val) __val##ui64 + +#else +#error "Unsupported compiler" +#endif + +#endif /* _STDINT_H_ */ diff --git a/progs/demos/fire.c b/progs/demos/fire.c index 3db45418fa..9c351e80e5 100644 --- a/progs/demos/fire.c +++ b/progs/demos/fire.c @@ -6,6 +6,7 @@ * Humanware s.r.l. */ +#include <assert.h> #include <stdio.h> #include <stdlib.h> #include <math.h> @@ -758,6 +759,7 @@ main(int ac, char **av) glFogfv(GL_FOG_COLOR, fogcolor); glFogf(GL_FOG_DENSITY, 0.1); + assert(np > 0); p = (part *) malloc(sizeof(part) * np); for (i = 0; i < np; i++) diff --git a/progs/egl/eglgears.c b/progs/egl/eglgears.c index 052d0f9e25..2d9b8cac7f 100644 --- a/progs/egl/eglgears.c +++ b/progs/egl/eglgears.c @@ -374,7 +374,8 @@ main(int argc, char *argv[]) EGLint screenAttribs[10]; EGLModeMESA mode[MAX_MODES]; EGLScreenMESA screen; - EGLint count, chosenMode; + EGLint count; + EGLint chosenMode = 0; GLboolean printInfo = GL_FALSE; EGLint width = 0, height = 0; diff --git a/progs/egl/eglscreen.c b/progs/egl/eglscreen.c index 47b3ce3366..520f76ea03 100644 --- a/progs/egl/eglscreen.c +++ b/progs/egl/eglscreen.c @@ -52,7 +52,8 @@ main(int argc, char *argv[]) EGLint screenAttribs[10]; EGLModeMESA mode[MAX_MODES]; EGLScreenMESA screen; - EGLint count, chosenMode; + EGLint count; + EGLint chosenMode = 0; EGLint width = 0, height = 0; d = eglGetDisplay(EGL_DEFAULT_DISPLAY); diff --git a/progs/fp/Makefile b/progs/fp/Makefile index d77cd32b4d..681928cf26 100755 --- a/progs/fp/Makefile +++ b/progs/fp/Makefile @@ -17,7 +17,6 @@ SOURCES = \ tri-depth2.c \ tri-depthwrite.c \ tri-depthwrite2.c \ - tri-inv.c \ tri-param.c \ fp-tri.c diff --git a/progs/fp/SConscript b/progs/fp/SConscript index 113e11ab54..e209161f32 100644 --- a/progs/fp/SConscript +++ b/progs/fp/SConscript @@ -6,7 +6,6 @@ progs = [ 'tri-depth2', 'tri-depthwrite', 'tri-depthwrite2', - 'tri-inv', 'tri-param', 'tri-tex', 'point-position', diff --git a/progs/fp/fp-tri.c b/progs/fp/fp-tri.c index ed29a2d683..70676d4c40 100644 --- a/progs/fp/fp-tri.c +++ b/progs/fp/fp-tri.c @@ -73,7 +73,7 @@ static void Init( void ) GLuint Texture; GLint errno; GLuint prognum; - char buf[4096]; + char buf[50000]; GLuint sz; FILE *f; diff --git a/progs/fp/tri-inv.c b/progs/fp/tri-inv.c deleted file mode 100644 index 7e490fa61c..0000000000 --- a/progs/fp/tri-inv.c +++ /dev/null @@ -1,111 +0,0 @@ - -#include <stdio.h> -#include <string.h> -#include <stdlib.h> -#include <GL/glew.h> -#include <GL/glut.h> - - - -static void Init( void ) -{ - static const char *modulate2D = - "!!ARBfp1.0\n" - "TEMP R0;\n" - "INV result.color, fragment.color; \n" - "END" - ; - GLuint modulateProg; - - if (!GLEW_ARB_fragment_program) { - printf("Error: GL_ARB_fragment_program not supported!\n"); - exit(1); - } - printf("GL_RENDERER = %s\n", (char *) glGetString(GL_RENDERER)); - - /* Setup the fragment program */ - glGenProgramsARB(1, &modulateProg); - glBindProgramARB(GL_FRAGMENT_PROGRAM_ARB, modulateProg); - glProgramStringARB(GL_FRAGMENT_PROGRAM_ARB, GL_PROGRAM_FORMAT_ASCII_ARB, - strlen(modulate2D), (const GLubyte *)modulate2D); - - printf("glGetError = 0x%x\n", (int) glGetError()); - printf("glError(GL_PROGRAM_ERROR_STRING_ARB) = %s\n", - (char *) glGetString(GL_PROGRAM_ERROR_STRING_ARB)); - - glEnable(GL_FRAGMENT_PROGRAM_ARB); - - glClearColor(.3, .3, .3, 0); -} - -static void Reshape(int width, int height) -{ - - glViewport(0, 0, (GLint)width, (GLint)height); - - glMatrixMode(GL_PROJECTION); - glLoadIdentity(); - glOrtho(-1.0, 1.0, -1.0, 1.0, -0.5, 1000.0); - glMatrixMode(GL_MODELVIEW); -} - -static void Key(unsigned char key, int x, int y) -{ - - switch (key) { - case 27: - exit(1); - default: - break; - } - - glutPostRedisplay(); -} - -static void Draw(void) -{ - glClear(GL_COLOR_BUFFER_BIT); - - glBegin(GL_TRIANGLES); - glColor3f(0,0,1); - glVertex3f( 0.9, -0.9, -30.0); - glColor3f(1,0,0); - glVertex3f( 0.9, 0.9, -30.0); - glColor3f(0,1,0); - glVertex3f(-0.9, 0.0, -30.0); - glEnd(); - - glFlush(); - - -} - - -int main(int argc, char **argv) -{ - GLenum type; - - glutInit(&argc, argv); - - - - glutInitWindowPosition(0, 0); glutInitWindowSize( 250, 250); - - type = GLUT_RGB; - type |= GLUT_SINGLE; - glutInitDisplayMode(type); - - if (glutCreateWindow("First Tri") == GL_FALSE) { - exit(1); - } - - glewInit(); - - Init(); - - glutReshapeFunc(Reshape); - glutKeyboardFunc(Key); - glutDisplayFunc(Draw); - glutMainLoop(); - return 0; -} diff --git a/progs/glsl/shtest.c b/progs/glsl/shtest.c index e9800c307f..7b1917be1c 100644 --- a/progs/glsl/shtest.c +++ b/progs/glsl/shtest.c @@ -549,6 +549,10 @@ ReadConfigFile(const char *filename, struct config_file *conf) type = TypeFromName(typeName); + if (strlen(name) + 1 > sizeof(conf->uniforms[conf->num_uniforms].name)) { + fprintf(stderr, "string overflow\n"); + exit(1); + } strcpy(conf->uniforms[conf->num_uniforms].name, name); conf->uniforms[conf->num_uniforms].value[0] = v1; conf->uniforms[conf->num_uniforms].value[1] = v2; diff --git a/progs/rbug/simple_server.c b/progs/rbug/simple_server.c index 04380c3310..3a842c06c4 100644 --- a/progs/rbug/simple_server.c +++ b/progs/rbug/simple_server.c @@ -29,7 +29,7 @@ #include "rbug/rbug.h" -static void wait() +static void rbug_wait() { int s = u_socket_listen_on_port(13370); int c = u_socket_accept(s); @@ -57,6 +57,6 @@ static void wait() int main(int argc, char** argv) { - wait(); + rbug_wait(); return 0; } diff --git a/progs/samples/olympic.c b/progs/samples/olympic.c index 5385e48702..209a8c141b 100644 --- a/progs/samples/olympic.c +++ b/progs/samples/olympic.c @@ -74,7 +74,7 @@ int iters[RINGS]; GLuint theTorus; -void FillTorus(float rc, int numc, float rt, int numt) +static void FillTorus(float rc, int numc, float rt, int numt) { int i, j, k; double s, t; @@ -106,7 +106,7 @@ void FillTorus(float rc, int numc, float rt, int numt) } } -float Clamp(int iters_left, float t) +static float Clamp(int iters_left, float t) { if (iters_left < 3) { return 0.0; @@ -114,7 +114,7 @@ float Clamp(int iters_left, float t) return (iters_left-2)*t/iters_left; } -void DrawScene(void) +static void DrawScene(void) { int i, j; GLboolean goIdle; @@ -172,7 +172,7 @@ void DrawScene(void) } } -float MyRand(void) +static float MyRand(void) { return 10.0 * ( (float) rand() / (float) RAND_MAX - 0.5 ); } @@ -181,12 +181,12 @@ float MyRand(void) #define GLUTCALLBACK #endif -void GLUTCALLBACK glut_post_redisplay_p(void) +static void GLUTCALLBACK glut_post_redisplay_p(void) { glutPostRedisplay(); } -void ReInit(void) +static void ReInit(void) { int i; float deviation; @@ -206,7 +206,7 @@ void ReInit(void) glutIdleFunc(glut_post_redisplay_p); } -void Init(void) +static void Init(void) { float base, height; float aspect, x, y; @@ -312,13 +312,13 @@ void Init(void) glMatrixMode(GL_MODELVIEW); } -void Reshape(int width, int height) +static void Reshape(int width, int height) { glViewport(0, 0, width, height); } -void Key(unsigned char key, int x, int y) +static void Key(unsigned char key, int x, int y) { switch (key) { @@ -330,7 +330,7 @@ void Key(unsigned char key, int x, int y) } } -GLenum Args(int argc, char **argv) +static GLenum Args(int argc, char **argv) { GLint i; diff --git a/progs/samples/overlay.c b/progs/samples/overlay.c index 23b5a4793b..6087cef281 100644 --- a/progs/samples/overlay.c +++ b/progs/samples/overlay.c @@ -69,19 +69,19 @@ starRec stars[MAXSTARS]; float sinTable[MAXANGLES]; -float Sin(float angle) +static float Sin(float angle) { return (sinTable[(GLint)angle]); } -float Cos(float angle) +static float Cos(float angle) { return (sinTable[((GLint)angle+(MAXANGLES/4))%MAXANGLES]); } -void NewStar(GLint n, GLint d) +static void NewStar(GLint n, GLint d) { if (rand()%4 == 0) { @@ -103,7 +103,7 @@ void NewStar(GLint n, GLint d) } } -void RotatePoint(float *x, float *y, float rotation) +static void RotatePoint(float *x, float *y, float rotation) { float tmpX, tmpY; @@ -113,7 +113,7 @@ void RotatePoint(float *x, float *y, float rotation) *y = tmpY; } -void MoveStars(void) +static void MoveStars(void) { float offset; GLint n; @@ -134,7 +134,7 @@ void MoveStars(void) } } -GLenum StarPoint(GLint n) +static GLenum StarPoint(GLint n) { float x0, y0, x1, y1, width; GLint i; @@ -182,7 +182,7 @@ GLenum StarPoint(GLint n) } } -void ShowStars(void) +static void ShowStars(void) { GLint n; @@ -221,7 +221,7 @@ static void Init(void) glDisable(GL_DITHER); } -void Reshape(int width, int height) +static void Reshape(int width, int height) { windW = (GLint)width; @@ -262,7 +262,7 @@ static void Key(unsigned char key, int x, int y) } } -void Idle(void) +static void Idle(void) { if (overlayInit == GL_FALSE) { diff --git a/progs/samples/rgbtoppm.c b/progs/samples/rgbtoppm.c index dcb74228df..403578ef42 100644 --- a/progs/samples/rgbtoppm.c +++ b/progs/samples/rgbtoppm.c @@ -3,6 +3,7 @@ /* texload is a simplistic routine for reading an SGI .rgb image file. */ +#include <assert.h> #include <stdio.h> #include <stdlib.h> #include <string.h> @@ -25,7 +26,7 @@ typedef struct _ImageRec { int *rowSize; } ImageRec; -void +static void rgbtorgb(unsigned char *r,unsigned char *g,unsigned char *b,unsigned char *l,int n) { while(n--) { l[0] = r[0]; @@ -72,6 +73,7 @@ static ImageRec *ImageOpen(char *fileName) ImageRec *image; int swapFlag; int x; + int result; endianTest.testWord = 1; if (endianTest.testByte[0] == 1) { @@ -90,7 +92,8 @@ static ImageRec *ImageOpen(char *fileName) return NULL; } - fread(image, 1, 12, image->file); + result = fread(image, 1, 12, image->file); + assert(result == 12); if (swapFlag) { ConvertShort(&image->imagic, 1); @@ -117,8 +120,10 @@ static ImageRec *ImageOpen(char *fileName) } image->rleEnd = 512 + (2 * x); fseek(image->file, 512, SEEK_SET); - fread(image->rowStart, 1, x, image->file); - fread(image->rowSize, 1, x, image->file); + result = fread(image->rowStart, 1, x, image->file); + assert(result == x); + result = fread(image->rowSize, 1, x, image->file); + assert(result == x); if (swapFlag) { ConvertUint(image->rowStart, x/(int) sizeof(unsigned)); ConvertUint((unsigned *)image->rowSize, x/(int) sizeof(int)); @@ -138,11 +143,13 @@ static void ImageGetRow(ImageRec *image, unsigned char *buf, int y, int z) { unsigned char *iPtr, *oPtr, pixel; int count; + int result; if ((image->type & 0xFF00) == 0x0100) { fseek(image->file, (long) image->rowStart[y+z*image->ysize], SEEK_SET); - fread(image->tmp, 1, (unsigned int)image->rowSize[y+z*image->ysize], - image->file); + result = fread(image->tmp, 1, (unsigned int)image->rowSize[y+z*image->ysize], + image->file); + assert(result == (unsigned int)image->rowSize[y+z*image->ysize]); iPtr = image->tmp; oPtr = buf; @@ -166,11 +173,13 @@ ImageGetRow(ImageRec *image, unsigned char *buf, int y, int z) { } else { fseek(image->file, 512+(y*image->xsize)+(z*image->xsize*image->ysize), SEEK_SET); - fread(buf, 1, image->xsize, image->file); + result = fread(buf, 1, image->xsize, image->file); + assert(result == image->xsize); } } -GLubyte * +#if 0 +static GLubyte * read_alpha_texture(char *name, int *width, int *height) { unsigned char *base, *lptr; @@ -199,8 +208,9 @@ read_alpha_texture(char *name, int *width, int *height) return (unsigned char *) base; } +#endif -GLubyte * +static GLubyte * read_rgb_texture(char *name, int *width, int *height) { unsigned char *base, *ptr; @@ -261,7 +271,8 @@ read_rgb_texture(char *name, int *width, int *height) int main(int argc, char **argv) { - int width, height; + int width = 0; + int height = 0; GLubyte *data; char buff[32]; int n; diff --git a/progs/samples/sphere.c b/progs/samples/sphere.c index 7d0508dee9..23d4fe32c0 100644 --- a/progs/samples/sphere.c +++ b/progs/samples/sphere.c @@ -445,7 +445,7 @@ GLfloat identity[16] = { }; -void BuildCylinder(int numEdges) +static void BuildCylinder(int numEdges) { int i, top = 1.0, bottom = -1.0; float x[100], y[100], angle; @@ -481,7 +481,7 @@ void BuildCylinder(int numEdges) glEndList(); } -void BuildTorus(float rc, int numc, float rt, int numt) +static void BuildTorus(float rc, int numc, float rt, int numt) { int i, j, k; double s, t; @@ -515,7 +515,7 @@ void BuildTorus(float rc, int numc, float rt, int numt) glEndList(); } -void BuildCage(void) +static void BuildCage(void) { int i; float inc; @@ -609,7 +609,7 @@ void BuildCage(void) glEndList(); } -void BuildCube(void) +static void BuildCube(void) { int i, j; @@ -628,7 +628,7 @@ void BuildCube(void) glEndList(); } -void BuildLists(void) +static void BuildLists(void) { cube = glGenLists(1); @@ -646,7 +646,7 @@ void BuildLists(void) genericObject = torus; } -void SetDefaultSettings(void) +static void SetDefaultSettings(void) { magFilter = nnearest; @@ -657,7 +657,7 @@ void SetDefaultSettings(void) autoRotate = GL_TRUE; } -unsigned char *AlphaPadImage(int bufSize, unsigned char *inData, int alpha) +static unsigned char *AlphaPadImage(int bufSize, unsigned char *inData, int alpha) { unsigned char *outData, *out_ptr, *in_ptr; int i; @@ -677,7 +677,7 @@ unsigned char *AlphaPadImage(int bufSize, unsigned char *inData, int alpha) return outData; } -void Init(void) +static void Init(void) { float ambient[] = {0.0, 0.0, 0.0, 1.0}; float diffuse[] = {1.0, 1.0, 1.0, 1.0}; @@ -753,7 +753,7 @@ void Init(void) BuildLists(); } -void ReInit(void) +static void ReInit(void) { if (genericObject == torus) { glEnable(GL_DEPTH_TEST); @@ -773,7 +773,7 @@ void ReInit(void) glTexEnvfv(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, textureEnvironment); } -void Draw(void) +static void Draw(void) { glClear(GL_COLOR_BUFFER_BIT|GL_DEPTH_BUFFER_BIT); @@ -806,7 +806,7 @@ void Draw(void) glutSwapBuffers(); } -void Reshape(int width, int height) +static void Reshape(int width, int height) { W = width; H = height; @@ -818,7 +818,7 @@ void Reshape(int width, int height) glMatrixMode(GL_MODELVIEW); } -void Idle(void) +static void Idle(void) { static double t0 = -1.; double t, dt; @@ -833,7 +833,7 @@ void Idle(void) glutPostRedisplay(); } -void Key2(int key, int x, int y) +static void Key2(int key, int x, int y) { switch (key) { @@ -863,7 +863,7 @@ void Key2(int key, int x, int y) glutPostRedisplay(); } -void Key(unsigned char key, int x, int y) +static void Key(unsigned char key, int x, int y) { switch (key) { @@ -950,7 +950,7 @@ void Key(unsigned char key, int x, int y) glutPostRedisplay(); } -GLenum Args(int argc, char **argv) +static GLenum Args(int argc, char **argv) { GLint i; diff --git a/progs/samples/star.c b/progs/samples/star.c index 2cf470e2a2..2c44ebfd49 100644 --- a/progs/samples/star.c +++ b/progs/samples/star.c @@ -67,19 +67,19 @@ starRec stars[MAXSTARS]; float sinTable[MAXANGLES]; -float Sin(float angle) +static float Sin(float angle) { return (sinTable[(GLint)angle]); } -float Cos(float angle) +static float Cos(float angle) { return (sinTable[((GLint)angle+(MAXANGLES/4))%MAXANGLES]); } -void NewStar(GLint n, GLint d) +static void NewStar(GLint n, GLint d) { if (rand()%4 == 0) { @@ -101,7 +101,7 @@ void NewStar(GLint n, GLint d) } } -void RotatePoint(float *x, float *y, float rotation) +static void RotatePoint(float *x, float *y, float rotation) { float tmpX, tmpY; @@ -111,7 +111,7 @@ void RotatePoint(float *x, float *y, float rotation) *y = tmpY; } -void MoveStars(void) +static void MoveStars(void) { float offset; GLint n; @@ -142,7 +142,7 @@ void MoveStars(void) } } -GLenum StarPoint(GLint n) +static GLenum StarPoint(GLint n) { float x0, y0, x1, y1, width; GLint i; @@ -190,7 +190,7 @@ GLenum StarPoint(GLint n) } } -void ShowStars(void) +static void ShowStars(void) { GLint n; @@ -229,7 +229,7 @@ static void Init(void) glDisable(GL_DITHER); } -void Reshape(int width, int height) +static void Reshape(int width, int height) { windW = (GLint)width; @@ -260,7 +260,7 @@ static void Key(unsigned char key, int x, int y) } } -void Draw(void) +static void Draw(void) { MoveStars(); @@ -307,7 +307,7 @@ static GLenum Args(int argc, char **argv) #define GLUTCALLBACK #endif -void GLUTCALLBACK glut_post_redisplay_p(void) +static void GLUTCALLBACK glut_post_redisplay_p(void) { glutPostRedisplay(); } diff --git a/progs/samples/stretch.c b/progs/samples/stretch.c index 1fd015d794..11201dca23 100644 --- a/progs/samples/stretch.c +++ b/progs/samples/stretch.c @@ -67,7 +67,7 @@ int cCount, cIndex[2], cStep; GLenum op = OP_NOOP; -void DrawImage(void) +static void DrawImage(void) { glRasterPos2i(0, 0); @@ -84,7 +84,7 @@ void DrawImage(void) image->data); } -void DrawPoint(void) +static void DrawPoint(void) { int i; @@ -102,7 +102,7 @@ void DrawPoint(void) } } -void InitVList(void) +static void InitVList(void) { vList[0].x = 0.0; @@ -141,7 +141,7 @@ void InitVList(void) vList[4].tY = cList[0].y / (float)imageSizeY; } -void ScaleImage(int sizeX, int sizeY) +static void ScaleImage(int sizeX, int sizeY) { GLubyte *buf; @@ -154,7 +154,7 @@ void ScaleImage(int sizeX, int sizeY) image->sizeY = sizeY; } -void SetPoint(int x, int y) +static void SetPoint(int x, int y) { cList[cCount].x = (float)x; @@ -162,7 +162,7 @@ void SetPoint(int x, int y) cCount++; } -void Stretch(void) +static void Stretch(void) { glBegin(GL_TRIANGLES); @@ -221,7 +221,7 @@ void Stretch(void) } } -void Key(unsigned char key, int x, int y) +static void Key(unsigned char key, int x, int y) { switch (key) { @@ -245,7 +245,7 @@ void Key(unsigned char key, int x, int y) glutPostRedisplay(); } -void Mouse(int button, int state, int mouseX, int mouseY) +static void Mouse(int button, int state, int mouseX, int mouseY) { if (state != GLUT_DOWN) @@ -263,7 +263,7 @@ void Mouse(int button, int state, int mouseX, int mouseY) glutPostRedisplay(); } -void Animate(void) +static void Animate(void) { static double t0 = -1.; double t, dt; @@ -322,7 +322,7 @@ static GLenum Args(int argc, char **argv) #define GLUTCALLBACK #endif -void GLUTCALLBACK glut_post_redisplay_p(void) +static void GLUTCALLBACK glut_post_redisplay_p(void) { glutPostRedisplay(); } diff --git a/progs/samples/wave.c b/progs/samples/wave.c index d3c4687459..396a6943e3 100644 --- a/progs/samples/wave.c +++ b/progs/samples/wave.c @@ -92,7 +92,7 @@ GLubyte contourTexture2[] = { #endif -void GLUTCALLBACK glut_post_redisplay_p(void) +static void GLUTCALLBACK glut_post_redisplay_p(void) { static double t0 = -1.; double t, dt; diff --git a/progs/tests/getprocaddress.c b/progs/tests/getprocaddress.c index b905eeaf81..e699baf44b 100644 --- a/progs/tests/getprocaddress.c +++ b/progs/tests/getprocaddress.c @@ -1188,7 +1188,7 @@ exercise_buffer_objects(enum Map_Buffer_Usage usage) GLuint bufferID; GLint bufferMapped; static GLubyte data[BUFFER_DATA_SIZE] = {0}; - float *dataPtr; + float *dataPtr = NULL; /* Get the function pointers we need. These are from * GL_ARB_vertex_buffer_object and are required in all diff --git a/progs/tests/vparray.c b/progs/tests/vparray.c index af9b62d33e..fe168c6cd5 100644 --- a/progs/tests/vparray.c +++ b/progs/tests/vparray.c @@ -37,13 +37,16 @@ static void read_surface( char *filename ) } numverts = 0; - while (!feof(f) && numverts < MAXVERTS) { - fscanf( f, "%f %f %f %f %f %f", - &data[numverts][0], &data[numverts][1], &data[numverts][2], - &data[numverts][3], &data[numverts][4], &data[numverts][5] ); + while (numverts < MAXVERTS) { + int result; + result = fscanf( f, "%f %f %f %f %f %f", + &data[numverts][0], &data[numverts][1], &data[numverts][2], + &data[numverts][3], &data[numverts][4], &data[numverts][5] ); + if (result == EOF) { + break; + } numverts++; } - numverts--; printf("%d vertices, %d triangles\n", numverts, numverts-2); printf("data = %p\n", (void *) data); diff --git a/progs/vp/vp-tris.c b/progs/vp/vp-tris.c index 29cd027b00..09236c296f 100644 --- a/progs/vp/vp-tris.c +++ b/progs/vp/vp-tris.c @@ -96,7 +96,8 @@ static void Init( void ) exit(1); } - sz = (GLuint) fread(buf, 1, sizeof(buf), f); + sz = (GLuint) fread(buf, 1, sizeof(buf) - 1, f); + buf[sizeof(buf) - 1] = '\0'; if (!feof(f)) { fprintf(stderr, "file too long\n"); fclose(f); diff --git a/progs/xdemos/glsync.c b/progs/xdemos/glsync.c index 4dc4937703..c00ba9e468 100644 --- a/progs/xdemos/glsync.c +++ b/progs/xdemos/glsync.c @@ -90,7 +90,7 @@ static char optstr[] = "w:h:s:vi:"; enum sync_type { none = 0, sgi_video_sync, - buffer_swap, + buffer_swap }; static void usage(char *name) diff --git a/progs/xdemos/glxheads.c b/progs/xdemos/glxheads.c index b1a63d3d50..edae0a3ef7 100644 --- a/progs/xdemos/glxheads.c +++ b/progs/xdemos/glxheads.c @@ -145,14 +145,40 @@ AddHead(const char *displayName) /* save the info for this head */ { struct head *h = &Heads[NumHeads]; + const char * tmp; + + if (strlen(displayName) + 1 > sizeof(h->DisplayName)) { + Error(displayName, "displayName string length overflow"); + return NULL; + } strcpy(h->DisplayName, displayName); + h->Dpy = dpy; h->Win = win; h->Context = ctx; h->Angle = 0.0; - strcpy(h->Version, (char *) glGetString(GL_VERSION)); - strcpy(h->Vendor, (char *) glGetString(GL_VENDOR)); - strcpy(h->Renderer, (char *) glGetString(GL_RENDERER)); + + tmp = (char *) glGetString(GL_VERSION); + if (strlen(tmp) + 1 > sizeof(h->Version)) { + Error(displayName, "GL_VERSION string length overflow"); + return NULL; + } + strcpy(h->Version, tmp); + + tmp = (char *) glGetString(GL_VENDOR); + if (strlen(tmp) + 1 > sizeof(h->Vendor)) { + Error(displayName, "GL_VENDOR string length overflow"); + return NULL; + } + strcpy(h->Vendor, tmp); + + tmp = (char *) glGetString(GL_RENDERER); + if (strlen(tmp) + 1 > sizeof(h->Renderer)) { + Error(displayName, "GL_RENDERER string length overflow"); + return NULL; + } + strcpy(h->Renderer, tmp); + NumHeads++; return &Heads[NumHeads-1]; } diff --git a/progs/xdemos/manywin.c b/progs/xdemos/manywin.c index ee357f32a4..3b0810b2e5 100644 --- a/progs/xdemos/manywin.c +++ b/progs/xdemos/manywin.c @@ -177,14 +177,40 @@ AddHead(const char *displayName, const char *name) /* save the info for this head */ { struct head *h = &Heads[NumHeads]; + const char * tmp; + + if (strlen(name) + 1 > sizeof(h->DisplayName)) { + Error(displayName, "name string overflow"); + return NULL; + } strcpy(h->DisplayName, name); + h->Dpy = dpy; h->Win = win; h->Context = ctx; h->Angle = 0.0; - strcpy(h->Version, (char *) glGetString(GL_VERSION)); - strcpy(h->Vendor, (char *) glGetString(GL_VENDOR)); - strcpy(h->Renderer, (char *) glGetString(GL_RENDERER)); + + tmp = (char *) glGetString(GL_VERSION); + if (strlen(tmp) + 1 > sizeof(h->Version)) { + Error(displayName, "GL_VERSION string overflow"); + return NULL; + } + strcpy(h->Version, tmp); + + tmp = (char *) glGetString(GL_VENDOR); + if (strlen(tmp) + 1 > sizeof(h->Vendor)) { + Error(displayName, "GL_VENDOR string overflow"); + return NULL; + } + strcpy(h->Vendor, tmp); + + tmp = (char *) glGetString(GL_RENDERER); + if (strlen(tmp) + 1 > sizeof(h->Renderer)) { + Error(displayName, "GL_RENDERER string overflow"); + return NULL; + } + strcpy(h->Renderer, tmp); + NumHeads++; return &Heads[NumHeads-1]; } diff --git a/progs/xdemos/sharedtex_mt.c b/progs/xdemos/sharedtex_mt.c index f924448cc4..a90903adec 100644 --- a/progs/xdemos/sharedtex_mt.c +++ b/progs/xdemos/sharedtex_mt.c @@ -174,6 +174,10 @@ AddWindow(Display *dpy, const char *displayName, int xpos, int ypos, { static int id = 0; struct window *h = &Windows[NumWindows]; + if (strlen(displayName) + 1 > sizeof(h->DisplayName)) { + Error(displayName, "string overflow"); + return NULL; + } strcpy(h->DisplayName, displayName); h->Dpy = dpy; h->Win = win; diff --git a/scons/llvm.py b/scons/llvm.py index 7b26650290..37c503ec98 100644 --- a/scons/llvm.py +++ b/scons/llvm.py @@ -65,6 +65,7 @@ def generate(env): env.AppendUnique(CPPDEFINES = [ '__STDC_LIMIT_MACROS', '__STDC_CONSTANT_MACROS', + 'HAVE_STDINT_H', ]) env.Prepend(LIBPATH = [os.path.join(llvm_dir, 'lib')]) env.Prepend(LIBS = [ @@ -98,6 +99,16 @@ def generate(env): 'imagehlp', 'psapi', ]) + if env['msvc']: + # Some of the LLVM C headers use the inline keyword without + # defining it. + env.Append(CPPDEFINES = [('inline', '__inline')]) + if env['debug']: + # LLVM libraries are static, build with /MT, and they + # automatically link agains LIBCMT. When we're doing a + # debug build we'll be linking against LIBCMTD, so disable + # that. + env.Append(LINKFLAGS = ['/nodefaultlib:LIBCMT']) env['LLVM_VERSION'] = '2.6' return elif env.Detect('llvm-config'): diff --git a/src/egl/drivers/dri/egldri.c b/src/egl/drivers/dri/egldri.c index 9e400be624..ca6821dad0 100644 --- a/src/egl/drivers/dri/egldri.c +++ b/src/egl/drivers/dri/egldri.c @@ -675,13 +675,13 @@ __eglCreateContextWithConfig(__DRInativeDisplay* ndpy, int screen, drm_context_t * hHWContext) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __eglFindDRIScreen(ndpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) { if (drmCreateContext(psp->fd, hHWContext)) { _eglLog(_EGL_WARNING, "drmCreateContext failed."); @@ -691,14 +691,14 @@ __eglCreateContextWithConfig(__DRInativeDisplay* ndpy, int screen, } #if 0 __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __glXFindDRIScreen(dpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) { if (drmCreateContext(psp->fd, hHWContext)) { @@ -716,13 +716,13 @@ static GLboolean __eglDestroyContext( __DRInativeDisplay * ndpy, int screen, __DRIid context ) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __eglFindDRIScreen(ndpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) drmDestroyContext(psp->fd, context); @@ -735,13 +735,13 @@ __eglCreateDrawable(__DRInativeDisplay * ndpy, int screen, __DRIid drawable, drm_drawable_t * hHWDrawable) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __eglFindDRIScreen(ndpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) { if (drmCreateDrawable(psp->fd, hHWDrawable)) { _eglLog(_EGL_WARNING, "drmCreateDrawable failed."); @@ -756,13 +756,13 @@ static GLboolean __eglDestroyDrawable( __DRInativeDisplay * ndpy, int screen, __DRIid drawable ) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __eglFindDRIScreen(ndpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) drmDestroyDrawable(psp->fd, drawable); @@ -778,7 +778,7 @@ __eglGetDrawableInfo(__DRInativeDisplay * ndpy, int screen, __DRIid drawable, int* numBackClipRects, drm_clip_rect_t ** pBackClipRects ) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; driSurface *surf = Lookup_driSurface((EGLSurface) drawable); pDRIScreen = __eglFindDRIScreen(ndpy, screen); @@ -786,7 +786,7 @@ __eglGetDrawableInfo(__DRInativeDisplay * ndpy, int screen, __DRIid drawable, if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; *X = 0; *Y = 0; *W = surf->Base.Width; @@ -807,7 +807,7 @@ __eglGetDrawableInfo(__DRInativeDisplay * ndpy, int screen, __DRIid drawable, GLXDrawable drawable = (GLXDrawable) draw; drm_clip_rect_t * cliprect; Display* display = (Display*)dpy; - __DRIcontextPrivate *pcp = (__DRIcontextPrivate *)CurrentContext->driContext.private; + __DRIcontext *pcp = (__DRIcontext *)CurrentContext->driContext.private; if (drawable == 0) { return GL_FALSE; } diff --git a/src/egl/main/Makefile b/src/egl/main/Makefile index c951b070f1..ec326a845d 100644 --- a/src/egl/main/Makefile +++ b/src/egl/main/Makefile @@ -4,7 +4,10 @@ TOP = ../../.. include $(TOP)/configs/current -INCLUDE_DIRS = -I$(TOP)/include -I$(TOP)/src/mesa/glapi $(X11_INCLUDES) +EGL_MAJOR = 1 +EGL_MINOR = 0 + +INCLUDE_DIRS = -I$(TOP)/include HEADERS = \ eglcompiler.h \ @@ -43,7 +46,7 @@ SOURCES = \ OBJECTS = $(SOURCES:.c=.o) -# Undefined for now +# use dl*() to load drivers LOCAL_CFLAGS = -D_EGL_PLATFORM_X=1 @@ -56,21 +59,21 @@ default: depend library # EGL Library -library: $(TOP)/$(LIB_DIR)/libEGL.so +library: $(TOP)/$(LIB_DIR)/$(EGL_LIB_NAME) -$(TOP)/$(LIB_DIR)/libEGL.so: $(OBJECTS) - $(MKLIB) -o EGL -linker '$(CC)' -ldflags '$(LDFLAGS)' \ - -major 1 -minor 0 \ - -install $(TOP)/$(LIB_DIR) \ +$(TOP)/$(LIB_DIR)/$(EGL_LIB_NAME): $(OBJECTS) + $(MKLIB) -o $(EGL_LIB) -linker '$(CC)' -ldflags '$(LDFLAGS)' \ + -major $(EGL_MAJOR) -minor $(EGL_MINOR) \ + -install $(TOP)/$(LIB_DIR) $(MKLIB_OPTIONS) \ $(EGL_LIB_DEPS) $(OBJECTS) install: default $(INSTALL) -d $(DESTDIR)$(INSTALL_LIB_DIR) - $(MINSTALL) $(TOP)/$(LIB_DIR)/libEGL.so* $(DESTDIR)$(INSTALL_LIB_DIR) + $(MINSTALL) $(TOP)/$(LIB_DIR)/$(EGL_LIB_GLOB) \ + $(DESTDIR)$(INSTALL_LIB_DIR) clean: - -rm -f *.o *.so* - -rm -f core.* + -rm -f *.o -rm -f depend depend.bak @@ -82,5 +85,5 @@ depend: $(SOURCES) $(HEADERS) $(SOURCES) $(HEADERS) > /dev/null 2>/dev/null -include depend +-include depend # DO NOT DELETE diff --git a/src/egl/main/eglcompiler.h b/src/egl/main/eglcompiler.h index 6b639b75c6..f7c93f14ce 100644 --- a/src/egl/main/eglcompiler.h +++ b/src/egl/main/eglcompiler.h @@ -61,4 +61,14 @@ #endif +/** + * Function visibility + */ +#if defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303 +# define PUBLIC __attribute__((visibility("default"))) +#else +# define PUBLIC +#endif + + #endif /* EGLCOMPILER_INCLUDED */ diff --git a/src/egl/main/eglconfig.h b/src/egl/main/eglconfig.h index 6b8a259984..799bf4ee24 100644 --- a/src/egl/main/eglconfig.h +++ b/src/egl/main/eglconfig.h @@ -91,11 +91,11 @@ _eglSetConfigAttrib(_EGLConfig *conf, EGLint attr, EGLint val) } -extern void +PUBLIC void _eglInitConfig(_EGLConfig *config, EGLint id); -extern EGLConfig +PUBLIC EGLConfig _eglAddConfig(_EGLDisplay *dpy, _EGLConfig *conf); @@ -144,24 +144,24 @@ _eglGetConfigHandle(_EGLConfig *conf) } -extern EGLBoolean +PUBLIC EGLBoolean _eglValidateConfig(const _EGLConfig *conf, EGLBoolean for_matching); -extern EGLBoolean +PUBLIC EGLBoolean _eglMatchConfig(const _EGLConfig *conf, const _EGLConfig *criteria); -extern EGLBoolean +PUBLIC EGLBoolean _eglParseConfigAttribList(_EGLConfig *conf, const EGLint *attrib_list); -extern EGLint +PUBLIC EGLint _eglCompareConfigs(const _EGLConfig *conf1, const _EGLConfig *conf2, const _EGLConfig *criteria, EGLBoolean compare_id); -extern void +PUBLIC void _eglSortConfigs(const _EGLConfig **configs, EGLint count, EGLint (*compare)(const _EGLConfig *, const _EGLConfig *, void *), diff --git a/src/egl/main/eglconfigutil.h b/src/egl/main/eglconfigutil.h index 8c923ee206..9f8906dedb 100644 --- a/src/egl/main/eglconfigutil.h +++ b/src/egl/main/eglconfigutil.h @@ -7,16 +7,16 @@ #include "eglconfig.h" -extern void +PUBLIC void _eglConfigToContextModesRec(const _EGLConfig *config, __GLcontextModes *mode); -extern EGLBoolean +PUBLIC EGLBoolean _eglConfigFromContextModesRec(_EGLConfig *conf, const __GLcontextModes *m, EGLint conformant, EGLint renderable_type); -extern EGLBoolean +PUBLIC EGLBoolean _eglFillInConfigs( _EGLConfig *configs, EGLenum fb_format, EGLenum fb_type, const uint8_t * depth_bits, const uint8_t * stencil_bits, diff --git a/src/egl/main/eglcontext.h b/src/egl/main/eglcontext.h index 45c7b4717b..cb9e3f4a89 100644 --- a/src/egl/main/eglcontext.h +++ b/src/egl/main/eglcontext.h @@ -30,7 +30,7 @@ struct _egl_context }; -extern EGLBoolean +PUBLIC EGLBoolean _eglInitContext(_EGLDriver *drv, _EGLContext *ctx, _EGLConfig *config, const EGLint *attrib_list); @@ -47,7 +47,7 @@ extern EGLBoolean _eglQueryContext(_EGLDriver *drv, _EGLDisplay *dpy, _EGLContext *ctx, EGLint attribute, EGLint *value); -extern EGLBoolean +PUBLIC EGLBoolean _eglMakeCurrent(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *draw, _EGLSurface *read, _EGLContext *ctx); diff --git a/src/egl/main/eglcurrent.h b/src/egl/main/eglcurrent.h index 9503e0aba0..c4478b3891 100644 --- a/src/egl/main/eglcurrent.h +++ b/src/egl/main/eglcurrent.h @@ -60,7 +60,7 @@ _eglConvertApiFromIndex(EGLint idx) } -extern _EGLThreadInfo * +PUBLIC _EGLThreadInfo * _eglGetCurrentThread(void); @@ -72,19 +72,19 @@ extern EGLBoolean _eglIsCurrentThreadDummy(void); -extern _EGLContext * +PUBLIC _EGLContext * _eglGetCurrentContext(void); -extern _EGLDisplay * +PUBLIC _EGLDisplay * _eglGetCurrentDisplay(void); -extern _EGLSurface * +PUBLIC _EGLSurface * _eglGetCurrentSurface(EGLint readdraw); -extern EGLBoolean +PUBLIC EGLBoolean _eglError(EGLint errCode, const char *msg); diff --git a/src/egl/main/egldisplay.h b/src/egl/main/egldisplay.h index ea4e35a8b3..4f619e5371 100644 --- a/src/egl/main/egldisplay.h +++ b/src/egl/main/egldisplay.h @@ -78,11 +78,11 @@ extern _EGLDisplay * _eglFindDisplay(NativeDisplayType nativeDisplay); -extern void +PUBLIC void _eglReleaseDisplayResources(_EGLDriver *drv, _EGLDisplay *dpy); -extern void +PUBLIC void _eglCleanupDisplay(_EGLDisplay *disp); diff --git a/src/egl/main/egldriver.h b/src/egl/main/egldriver.h index 6c848eb35e..59bd1954aa 100644 --- a/src/egl/main/egldriver.h +++ b/src/egl/main/egldriver.h @@ -25,7 +25,8 @@ struct _egl_driver }; -extern _EGLDriver *_eglMain(const char *args); +PUBLIC _EGLDriver * +_eglMain(const char *args); extern const char * @@ -48,11 +49,11 @@ extern _EGLDriver * _eglLookupDriver(EGLDisplay d); -extern void +PUBLIC void _eglInitDriverFallbacks(_EGLDriver *drv); -extern EGLint +PUBLIC EGLint _eglFindAPIs(void); diff --git a/src/egl/main/egllog.h b/src/egl/main/egllog.h index 83c8bb72a6..3a99bfea4b 100644 --- a/src/egl/main/egllog.h +++ b/src/egl/main/egllog.h @@ -12,15 +12,15 @@ typedef void (*_EGLLogProc)(EGLint level, const char *msg); -extern void +PUBLIC void _eglSetLogProc(_EGLLogProc logger); -extern void +PUBLIC void _eglSetLogLevel(EGLint level); -extern void +PUBLIC void _eglLog(EGLint level, const char *fmtStr, ...); diff --git a/src/egl/main/eglmode.h b/src/egl/main/eglmode.h index af7c2c56d3..a089a5e194 100644 --- a/src/egl/main/eglmode.h +++ b/src/egl/main/eglmode.h @@ -29,7 +29,7 @@ extern _EGLMode * _eglLookupMode(EGLModeMESA mode, _EGLDisplay *dpy); -extern _EGLMode * +PUBLIC _EGLMode * _eglAddNewMode(_EGLScreen *screen, EGLint width, EGLint height, EGLint refreshRate, const char *name); diff --git a/src/egl/main/eglscreen.h b/src/egl/main/eglscreen.h index 8860a2aa7f..d52e5388c3 100644 --- a/src/egl/main/eglscreen.h +++ b/src/egl/main/eglscreen.h @@ -30,7 +30,7 @@ extern EGLScreenMESA _eglAllocScreenHandle(void); -extern void +PUBLIC void _eglInitScreen(_EGLScreen *screen); @@ -38,7 +38,7 @@ extern _EGLScreen * _eglLookupScreen(EGLScreenMESA screen, _EGLDisplay *dpy); -extern void +PUBLIC void _eglAddScreen(_EGLDisplay *display, _EGLScreen *screen); @@ -83,7 +83,7 @@ extern void _eglDestroyScreenModes(_EGLScreen *scrn); -extern void +PUBLIC void _eglDestroyScreen(_EGLScreen *scrn); diff --git a/src/egl/main/eglsurface.h b/src/egl/main/eglsurface.h index b75fa9c368..dacdf7e63c 100644 --- a/src/egl/main/eglsurface.h +++ b/src/egl/main/eglsurface.h @@ -40,7 +40,7 @@ struct _egl_surface }; -extern EGLBoolean +PUBLIC EGLBoolean _eglInitSurface(_EGLDriver *drv, _EGLSurface *surf, EGLint type, _EGLConfig *config, const EGLint *attrib_list); diff --git a/src/gallium/auxiliary/gallivm/tgsitollvm.cpp b/src/gallium/auxiliary/gallivm/tgsitollvm.cpp index 5cafe8c3f0..8f7d3b7100 100644 --- a/src/gallium/auxiliary/gallivm/tgsitollvm.cpp +++ b/src/gallium/auxiliary/gallivm/tgsitollvm.cpp @@ -552,7 +552,7 @@ translate_instruction(llvm::Module *module, break; case TGSI_OPCODE_SHL: break; - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: break; case TGSI_OPCODE_AND: break; @@ -919,7 +919,7 @@ translate_instructionir(llvm::Module *module, break; case TGSI_OPCODE_SHL: break; - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: break; case TGSI_OPCODE_AND: break; diff --git a/src/gallium/auxiliary/pipebuffer/pb_buffer_fenced.c b/src/gallium/auxiliary/pipebuffer/pb_buffer_fenced.c index a9375abd21..ba6f7b15f9 100644 --- a/src/gallium/auxiliary/pipebuffer/pb_buffer_fenced.c +++ b/src/gallium/auxiliary/pipebuffer/pb_buffer_fenced.c @@ -80,7 +80,7 @@ struct fenced_buffer_list */ struct fenced_buffer { - /* + /* * Immutable members. */ @@ -126,8 +126,8 @@ fenced_buffer(struct pb_buffer *buf) /** * Add the buffer to the fenced list. * - * fenced_buffer_list::mutex and fenced_buffer::mutex must be held, in this - * order before calling this function. + * fenced_buffer_list::mutex and fenced_buffer::mutex must be held, in this + * order, before calling this function. * * Reference count should be incremented before calling this function. */ @@ -191,7 +191,7 @@ fenced_buffer_remove_locked(struct fenced_buffer_list *fenced_list, * Wait for the fence to expire, and remove it from the fenced list. * * fenced_buffer::mutex must be held. fenced_buffer_list::mutex must not be - * held -- it will + * held -- it will be acquired internally. */ static INLINE enum pipe_error fenced_buffer_finish_locked(struct fenced_buffer_list *fenced_list, @@ -207,7 +207,10 @@ fenced_buffer_finish_locked(struct fenced_buffer_list *fenced_list, assert(pipe_is_referenced(&fenced_buf->base.base.reference)); assert(fenced_buf->fence); - /* Acquire the global lock */ + /* + * Acquire the global lock. Must release buffer mutex first to preserve + * lock order. + */ pipe_mutex_unlock(fenced_buf->mutex); pipe_mutex_lock(fenced_list->mutex); pipe_mutex_lock(fenced_buf->mutex); @@ -217,7 +220,7 @@ fenced_buffer_finish_locked(struct fenced_buffer_list *fenced_list, /* Remove from the fenced list */ /* TODO: remove consequents */ fenced_buffer_remove_locked(fenced_list, fenced_buf); - + p_atomic_dec(&fenced_buf->base.base.reference.count); assert(pipe_is_referenced(&fenced_buf->base.base.reference)); @@ -238,7 +241,7 @@ fenced_buffer_finish_locked(struct fenced_buffer_list *fenced_list, */ static void fenced_buffer_list_check_free_locked(struct fenced_buffer_list *fenced_list, - int wait) + int wait) { struct pb_fence_ops *ops = fenced_list->ops; struct list_head *curr, *next; @@ -274,7 +277,6 @@ fenced_buffer_list_check_free_locked(struct fenced_buffer_list *fenced_list, pb_buf = &fenced_buf->base; pb_reference(&pb_buf, NULL); - curr = next; next = curr->next; @@ -329,7 +331,7 @@ fenced_buffer_map(struct pb_buffer *buf, if((flags & PIPE_BUFFER_USAGE_DONTBLOCK) && ops->fence_signalled(ops, fenced_buf->fence, 0) == 0) { /* Don't wait for the GPU to finish writing */ - goto finish; + goto done; } /* Wait for the GPU to finish writing */ @@ -350,7 +352,7 @@ fenced_buffer_map(struct pb_buffer *buf, fenced_buf->flags |= flags & PIPE_BUFFER_USAGE_CPU_READ_WRITE; } -finish: +done: pipe_mutex_unlock(fenced_buf->mutex); return map; @@ -391,7 +393,7 @@ fenced_buffer_validate(struct pb_buffer *buf, fenced_buf->vl = NULL; fenced_buf->validation_flags = 0; ret = PIPE_OK; - goto finish; + goto done; } assert(flags & PIPE_BUFFER_USAGE_GPU_READ_WRITE); @@ -401,7 +403,7 @@ fenced_buffer_validate(struct pb_buffer *buf, /* Buffer cannot be validated in two different lists */ if(fenced_buf->vl && fenced_buf->vl != vl) { ret = PIPE_ERROR_RETRY; - goto finish; + goto done; } #if 0 @@ -409,7 +411,7 @@ fenced_buffer_validate(struct pb_buffer *buf, if(fenced_buf->flags & PIPE_BUFFER_USAGE_CPU_READ_WRITE) { /* TODO: wait for the thread that mapped the buffer to unmap it */ ret = PIPE_ERROR_RETRY; - goto finish; + goto done; } /* Final sanity checking */ assert(!(fenced_buf->flags & PIPE_BUFFER_USAGE_CPU_READ_WRITE)); @@ -420,17 +422,17 @@ fenced_buffer_validate(struct pb_buffer *buf, (fenced_buf->validation_flags & flags) == flags) { /* Nothing to do -- buffer already validated */ ret = PIPE_OK; - goto finish; + goto done; } ret = pb_validate(fenced_buf->buffer, vl, flags); if (ret != PIPE_OK) - goto finish; + goto done; fenced_buf->vl = vl; fenced_buf->validation_flags |= flags; -finish: +done: pipe_mutex_unlock(fenced_buf->mutex); return ret; diff --git a/src/gallium/auxiliary/rtasm/rtasm_execmem.c b/src/gallium/auxiliary/rtasm/rtasm_execmem.c index 01811d5011..ffed768f97 100644 --- a/src/gallium/auxiliary/rtasm/rtasm_execmem.c +++ b/src/gallium/auxiliary/rtasm/rtasm_execmem.c @@ -41,6 +41,12 @@ #define MAP_ANONYMOUS MAP_ANON #endif +#if defined(PIPE_OS_WINDOWS) +#ifndef WIN32_LEAN_AND_MEAN +#define WIN32_LEAN_AND_MEAN 1 +#endif +#include <windows.h> +#endif #if defined(PIPE_OS_LINUX) || defined(PIPE_OS_BSD) || defined(PIPE_OS_SOLARIS) @@ -118,7 +124,29 @@ rtasm_exec_free(void *addr) } -#else /* PIPE_OS_LINUX || PIPE_OS_BSD || PIPE_OS_SOLARIS */ +#elif defined(PIPE_OS_WINDOWS) + + +/* + * Avoid Data Execution Prevention. + */ + +void * +rtasm_exec_malloc(size_t size) +{ + return VirtualAlloc(NULL, size, MEM_COMMIT, PAGE_EXECUTE_READWRITE); +} + + +void +rtasm_exec_free(void *addr) +{ + VirtualFree(addr, 0, MEM_RELEASE); +} + + +#else + /* * Just use regular memory. @@ -138,4 +166,4 @@ rtasm_exec_free(void *addr) } -#endif /* PIPE_OS_LINUX || PIPE_OS_BSD || PIPE_OS_SOLARIS */ +#endif diff --git a/src/gallium/auxiliary/tgsi/tgsi_dump.c b/src/gallium/auxiliary/tgsi/tgsi_dump.c index 2c65ff16d8..e2e5394f86 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_dump.c +++ b/src/gallium/auxiliary/tgsi/tgsi_dump.c @@ -128,7 +128,9 @@ static const char *semantic_names[] = static const char *immediate_type_names[] = { - "FLT32" + "FLT32", + "UINT32", + "INT32" }; static const char *swizzle_names[] = @@ -412,6 +414,12 @@ iter_immediate( case TGSI_IMM_FLOAT32: FLT( imm->u[i].Float ); break; + case TGSI_IMM_UINT32: + UID(imm->u[i].Uint); + break; + case TGSI_IMM_INT32: + SID(imm->u[i].Int); + break; default: assert( 0 ); } diff --git a/src/gallium/auxiliary/tgsi/tgsi_exec.c b/src/gallium/auxiliary/tgsi/tgsi_exec.c index ba89f2fbc3..2bcb33392a 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_exec.c +++ b/src/gallium/auxiliary/tgsi/tgsi_exec.c @@ -2,6 +2,7 @@ * * Copyright 2007-2008 Tungsten Graphics, Inc., Cedar Park, Texas. * All Rights Reserved. + * Copyright 2009-2010 VMware, Inc. All rights Reserved. * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the @@ -60,6 +61,7 @@ #include "util/u_memory.h" #include "util/u_math.h" + #define FAST_MATH 1 #define TILE_TOP_LEFT 0 @@ -67,11 +69,329 @@ #define TILE_BOTTOM_LEFT 2 #define TILE_BOTTOM_RIGHT 3 +static void +micro_abs(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = fabsf(src->f[0]); + dst->f[1] = fabsf(src->f[1]); + dst->f[2] = fabsf(src->f[2]); + dst->f[3] = fabsf(src->f[3]); +} + +static void +micro_arl(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = (int)floorf(src->f[0]); + dst->i[1] = (int)floorf(src->f[1]); + dst->i[2] = (int)floorf(src->f[2]); + dst->i[3] = (int)floorf(src->f[3]); +} + +static void +micro_arr(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = (int)floorf(src->f[0] + 0.5f); + dst->i[1] = (int)floorf(src->f[1] + 0.5f); + dst->i[2] = (int)floorf(src->f[2] + 0.5f); + dst->i[3] = (int)floorf(src->f[3] + 0.5f); +} + +static void +micro_ceil(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = ceilf(src->f[0]); + dst->f[1] = ceilf(src->f[1]); + dst->f[2] = ceilf(src->f[2]); + dst->f[3] = ceilf(src->f[3]); +} + +static void +micro_cos(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = cosf(src->f[0]); + dst->f[1] = cosf(src->f[1]); + dst->f[2] = cosf(src->f[2]); + dst->f[3] = cosf(src->f[3]); +} + +static void +micro_ddx(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = + dst->f[1] = + dst->f[2] = + dst->f[3] = src->f[TILE_BOTTOM_RIGHT] - src->f[TILE_BOTTOM_LEFT]; +} + +static void +micro_ddy(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = + dst->f[1] = + dst->f[2] = + dst->f[3] = src->f[TILE_BOTTOM_LEFT] - src->f[TILE_TOP_LEFT]; +} + +static void +micro_exp2(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ +#if FAST_MATH + dst->f[0] = util_fast_exp2(src->f[0]); + dst->f[1] = util_fast_exp2(src->f[1]); + dst->f[2] = util_fast_exp2(src->f[2]); + dst->f[3] = util_fast_exp2(src->f[3]); +#else +#if DEBUG + /* Inf is okay for this instruction, so clamp it to silence assertions. */ + uint i; + union tgsi_exec_channel clamped; + + for (i = 0; i < 4; i++) { + if (src->f[i] > 127.99999f) { + clamped.f[i] = 127.99999f; + } else if (src->f[i] < -126.99999f) { + clamped.f[i] = -126.99999f; + } else { + clamped.f[i] = src->f[i]; + } + } + src = &clamped; +#endif /* DEBUG */ + + dst->f[0] = powf(2.0f, src->f[0]); + dst->f[1] = powf(2.0f, src->f[1]); + dst->f[2] = powf(2.0f, src->f[2]); + dst->f[3] = powf(2.0f, src->f[3]); +#endif /* FAST_MATH */ +} + +static void +micro_flr(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = floorf(src->f[0]); + dst->f[1] = floorf(src->f[1]); + dst->f[2] = floorf(src->f[2]); + dst->f[3] = floorf(src->f[3]); +} + +static void +micro_frc(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src->f[0] - floorf(src->f[0]); + dst->f[1] = src->f[1] - floorf(src->f[1]); + dst->f[2] = src->f[2] - floorf(src->f[2]); + dst->f[3] = src->f[3] - floorf(src->f[3]); +} + +static void +micro_iabs(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src->i[0] >= 0 ? src->i[0] : -src->i[0]; + dst->i[1] = src->i[1] >= 0 ? src->i[1] : -src->i[1]; + dst->i[2] = src->i[2] >= 0 ? src->i[2] : -src->i[2]; + dst->i[3] = src->i[3] >= 0 ? src->i[3] : -src->i[3]; +} + +static void +micro_ineg(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = -src->i[0]; + dst->i[1] = -src->i[1]; + dst->i[2] = -src->i[2]; + dst->i[3] = -src->i[3]; +} + +static void +micro_lg2(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ +#if FAST_MATH + dst->f[0] = util_fast_log2(src->f[0]); + dst->f[1] = util_fast_log2(src->f[1]); + dst->f[2] = util_fast_log2(src->f[2]); + dst->f[3] = util_fast_log2(src->f[3]); +#else + dst->f[0] = logf(src->f[0]) * 1.442695f; + dst->f[1] = logf(src->f[1]) * 1.442695f; + dst->f[2] = logf(src->f[2]) * 1.442695f; + dst->f[3] = logf(src->f[3]) * 1.442695f; +#endif +} + +static void +micro_lrp(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] * (src[1].f[0] - src[2].f[0]) + src[2].f[0]; + dst->f[1] = src[0].f[1] * (src[1].f[1] - src[2].f[1]) + src[2].f[1]; + dst->f[2] = src[0].f[2] * (src[1].f[2] - src[2].f[2]) + src[2].f[2]; + dst->f[3] = src[0].f[3] * (src[1].f[3] - src[2].f[3]) + src[2].f[3]; +} + +static void +micro_mad(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] * src[1].f[0] + src[2].f[0]; + dst->f[1] = src[0].f[1] * src[1].f[1] + src[2].f[1]; + dst->f[2] = src[0].f[2] * src[1].f[2] + src[2].f[2]; + dst->f[3] = src[0].f[3] * src[1].f[3] + src[2].f[3]; +} + +static void +micro_mov(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src->u[0]; + dst->u[1] = src->u[1]; + dst->u[2] = src->u[2]; + dst->u[3] = src->u[3]; +} + +static void +micro_rcp(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = 1.0f / src->f[0]; + dst->f[1] = 1.0f / src->f[1]; + dst->f[2] = 1.0f / src->f[2]; + dst->f[3] = 1.0f / src->f[3]; +} + +static void +micro_rnd(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = floorf(src->f[0] + 0.5f); + dst->f[1] = floorf(src->f[1] + 0.5f); + dst->f[2] = floorf(src->f[2] + 0.5f); + dst->f[3] = floorf(src->f[3] + 0.5f); +} + +static void +micro_rsq(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = 1.0f / sqrtf(fabsf(src->f[0])); + dst->f[1] = 1.0f / sqrtf(fabsf(src->f[1])); + dst->f[2] = 1.0f / sqrtf(fabsf(src->f[2])); + dst->f[3] = 1.0f / sqrtf(fabsf(src->f[3])); +} + +static void +micro_seq(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] == src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] == src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] == src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] == src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_sge(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] >= src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] >= src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] >= src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] >= src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_sgn(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src->f[0] < 0.0f ? -1.0f : src->f[0] > 0.0f ? 1.0f : 0.0f; + dst->f[1] = src->f[1] < 0.0f ? -1.0f : src->f[1] > 0.0f ? 1.0f : 0.0f; + dst->f[2] = src->f[2] < 0.0f ? -1.0f : src->f[2] > 0.0f ? 1.0f : 0.0f; + dst->f[3] = src->f[3] < 0.0f ? -1.0f : src->f[3] > 0.0f ? 1.0f : 0.0f; +} + +static void +micro_sgt(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] > src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] > src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] > src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] > src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_sin(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = sinf(src->f[0]); + dst->f[1] = sinf(src->f[1]); + dst->f[2] = sinf(src->f[2]); + dst->f[3] = sinf(src->f[3]); +} + +static void +micro_sle(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] <= src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] <= src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] <= src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] <= src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_slt(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] < src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] < src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] < src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] < src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_sne(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = src[0].f[0] != src[1].f[0] ? 1.0f : 0.0f; + dst->f[1] = src[0].f[1] != src[1].f[1] ? 1.0f : 0.0f; + dst->f[2] = src[0].f[2] != src[1].f[2] ? 1.0f : 0.0f; + dst->f[3] = src[0].f[3] != src[1].f[3] ? 1.0f : 0.0f; +} + +static void +micro_trunc(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = (float)(int)src->f[0]; + dst->f[1] = (float)(int)src->f[1]; + dst->f[2] = (float)(int)src->f[2]; + dst->f[3] = (float)(int)src->f[3]; +} + + #define CHAN_X 0 #define CHAN_Y 1 #define CHAN_Z 2 #define CHAN_W 3 +enum tgsi_exec_datatype { + TGSI_EXEC_DATA_FLOAT, + TGSI_EXEC_DATA_INT, + TGSI_EXEC_DATA_UINT +}; + /* * Shorthand locations of various utility registers (_I = Index, _C = Channel) */ @@ -123,23 +443,19 @@ /** The execution mask depends on the conditional mask and the loop mask */ #define UPDATE_EXEC_MASK(MACH) \ - MACH->ExecMask = MACH->CondMask & MACH->LoopMask & MACH->ContMask & MACH->FuncMask + MACH->ExecMask = MACH->CondMask & MACH->LoopMask & MACH->ContMask & MACH->Switch.mask & MACH->FuncMask static const union tgsi_exec_channel ZeroVec = { { 0.0, 0.0, 0.0, 0.0 } }; -#ifdef DEBUG -static void -check_inf_or_nan(const union tgsi_exec_channel *chan) -{ - assert(!util_is_inf_or_nan(chan->f[0])); - assert(!util_is_inf_or_nan(chan->f[1])); - assert(!util_is_inf_or_nan(chan->f[2])); - assert(!util_is_inf_or_nan(chan->f[3])); -} -#endif +#define CHECK_INF_OR_NAN(chan) do {\ + assert(!util_is_inf_or_nan((chan)->f[0]));\ + assert(!util_is_inf_or_nan((chan)->f[1]));\ + assert(!util_is_inf_or_nan((chan)->f[2]));\ + assert(!util_is_inf_or_nan((chan)->f[3]));\ + } while (0) #ifdef DEBUG @@ -422,18 +738,6 @@ tgsi_exec_machine_destroy(struct tgsi_exec_machine *mach) align_free(mach); } - -static void -micro_abs( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = fabsf( src->f[0] ); - dst->f[1] = fabsf( src->f[1] ); - dst->f[2] = fabsf( src->f[2] ); - dst->f[3] = fabsf( src->f[3] ); -} - static void micro_add( union tgsi_exec_channel *dst, @@ -446,76 +750,6 @@ micro_add( dst->f[3] = src0->f[3] + src1->f[3]; } -#if 0 -static void -micro_iadd( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] + src1->i[0]; - dst->i[1] = src0->i[1] + src1->i[1]; - dst->i[2] = src0->i[2] + src1->i[2]; - dst->i[3] = src0->i[3] + src1->i[3]; -} -#endif - -static void -micro_and( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] & src1->u[0]; - dst->u[1] = src0->u[1] & src1->u[1]; - dst->u[2] = src0->u[2] & src1->u[2]; - dst->u[3] = src0->u[3] & src1->u[3]; -} - -static void -micro_ceil( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = ceilf( src->f[0] ); - dst->f[1] = ceilf( src->f[1] ); - dst->f[2] = ceilf( src->f[2] ); - dst->f[3] = ceilf( src->f[3] ); -} - -static void -micro_cos( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = cosf( src->f[0] ); - dst->f[1] = cosf( src->f[1] ); - dst->f[2] = cosf( src->f[2] ); - dst->f[3] = cosf( src->f[3] ); -} - -static void -micro_ddx( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = - dst->f[1] = - dst->f[2] = - dst->f[3] = src->f[TILE_BOTTOM_RIGHT] - src->f[TILE_BOTTOM_LEFT]; -} - -static void -micro_ddy( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = - dst->f[1] = - dst->f[2] = - dst->f[3] = src->f[TILE_BOTTOM_LEFT] - src->f[TILE_TOP_LEFT]; -} - static void micro_div( union tgsi_exec_channel *dst, @@ -536,99 +770,6 @@ micro_div( } } -#if 0 -static void -micro_udiv( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] / src1->u[0]; - dst->u[1] = src0->u[1] / src1->u[1]; - dst->u[2] = src0->u[2] / src1->u[2]; - dst->u[3] = src0->u[3] / src1->u[3]; -} -#endif - -static void -micro_eq( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1, - const union tgsi_exec_channel *src2, - const union tgsi_exec_channel *src3 ) -{ - dst->f[0] = src0->f[0] == src1->f[0] ? src2->f[0] : src3->f[0]; - dst->f[1] = src0->f[1] == src1->f[1] ? src2->f[1] : src3->f[1]; - dst->f[2] = src0->f[2] == src1->f[2] ? src2->f[2] : src3->f[2]; - dst->f[3] = src0->f[3] == src1->f[3] ? src2->f[3] : src3->f[3]; -} - -#if 0 -static void -micro_ieq( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1, - const union tgsi_exec_channel *src2, - const union tgsi_exec_channel *src3 ) -{ - dst->i[0] = src0->i[0] == src1->i[0] ? src2->i[0] : src3->i[0]; - dst->i[1] = src0->i[1] == src1->i[1] ? src2->i[1] : src3->i[1]; - dst->i[2] = src0->i[2] == src1->i[2] ? src2->i[2] : src3->i[2]; - dst->i[3] = src0->i[3] == src1->i[3] ? src2->i[3] : src3->i[3]; -} -#endif - -static void -micro_exp2( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src) -{ -#if FAST_MATH - dst->f[0] = util_fast_exp2( src->f[0] ); - dst->f[1] = util_fast_exp2( src->f[1] ); - dst->f[2] = util_fast_exp2( src->f[2] ); - dst->f[3] = util_fast_exp2( src->f[3] ); -#else - -#if DEBUG - /* Inf is okay for this instruction, so clamp it to silence assertions. */ - uint i; - union tgsi_exec_channel clamped; - - for (i = 0; i < 4; i++) { - if (src->f[i] > 127.99999f) { - clamped.f[i] = 127.99999f; - } else if (src->f[i] < -126.99999f) { - clamped.f[i] = -126.99999f; - } else { - clamped.f[i] = src->f[i]; - } - } - src = &clamped; -#endif - - dst->f[0] = powf( 2.0f, src->f[0] ); - dst->f[1] = powf( 2.0f, src->f[1] ); - dst->f[2] = powf( 2.0f, src->f[2] ); - dst->f[3] = powf( 2.0f, src->f[3] ); -#endif -} - -#if 0 -static void -micro_f2ut( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->u[0] = (uint) src->f[0]; - dst->u[1] = (uint) src->f[1]; - dst->u[2] = (uint) src->f[2]; - dst->u[3] = (uint) src->f[3]; -} -#endif - static void micro_float_clamp(union tgsi_exec_channel *dst, const union tgsi_exec_channel *src) @@ -656,71 +797,6 @@ micro_float_clamp(union tgsi_exec_channel *dst, } static void -micro_flr( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = floorf( src->f[0] ); - dst->f[1] = floorf( src->f[1] ); - dst->f[2] = floorf( src->f[2] ); - dst->f[3] = floorf( src->f[3] ); -} - -static void -micro_frc( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = src->f[0] - floorf( src->f[0] ); - dst->f[1] = src->f[1] - floorf( src->f[1] ); - dst->f[2] = src->f[2] - floorf( src->f[2] ); - dst->f[3] = src->f[3] - floorf( src->f[3] ); -} - -static void -micro_i2f( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = (float) src->i[0]; - dst->f[1] = (float) src->i[1]; - dst->f[2] = (float) src->i[2]; - dst->f[3] = (float) src->i[3]; -} - -static void -micro_lg2( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ -#if FAST_MATH - dst->f[0] = util_fast_log2( src->f[0] ); - dst->f[1] = util_fast_log2( src->f[1] ); - dst->f[2] = util_fast_log2( src->f[2] ); - dst->f[3] = util_fast_log2( src->f[3] ); -#else - dst->f[0] = logf( src->f[0] ) * 1.442695f; - dst->f[1] = logf( src->f[1] ) * 1.442695f; - dst->f[2] = logf( src->f[2] ) * 1.442695f; - dst->f[3] = logf( src->f[3] ) * 1.442695f; -#endif -} - -static void -micro_le( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1, - const union tgsi_exec_channel *src2, - const union tgsi_exec_channel *src3 ) -{ - dst->f[0] = src0->f[0] <= src1->f[0] ? src2->f[0] : src3->f[0]; - dst->f[1] = src0->f[1] <= src1->f[1] ? src2->f[1] : src3->f[1]; - dst->f[2] = src0->f[2] <= src1->f[2] ? src2->f[2] : src3->f[2]; - dst->f[3] = src0->f[3] <= src1->f[3] ? src2->f[3] : src3->f[3]; -} - -static void micro_lt( union tgsi_exec_channel *dst, const union tgsi_exec_channel *src0, @@ -734,38 +810,6 @@ micro_lt( dst->f[3] = src0->f[3] < src1->f[3] ? src2->f[3] : src3->f[3]; } -#if 0 -static void -micro_ilt( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1, - const union tgsi_exec_channel *src2, - const union tgsi_exec_channel *src3 ) -{ - dst->i[0] = src0->i[0] < src1->i[0] ? src2->i[0] : src3->i[0]; - dst->i[1] = src0->i[1] < src1->i[1] ? src2->i[1] : src3->i[1]; - dst->i[2] = src0->i[2] < src1->i[2] ? src2->i[2] : src3->i[2]; - dst->i[3] = src0->i[3] < src1->i[3] ? src2->i[3] : src3->i[3]; -} -#endif - -#if 0 -static void -micro_ult( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1, - const union tgsi_exec_channel *src2, - const union tgsi_exec_channel *src3 ) -{ - dst->u[0] = src0->u[0] < src1->u[0] ? src2->u[0] : src3->u[0]; - dst->u[1] = src0->u[1] < src1->u[1] ? src2->u[1] : src3->u[1]; - dst->u[2] = src0->u[2] < src1->u[2] ? src2->u[2] : src3->u[2]; - dst->u[3] = src0->u[3] < src1->u[3] ? src2->u[3] : src3->u[3]; -} -#endif - static void micro_max( union tgsi_exec_channel *dst, @@ -778,34 +822,6 @@ micro_max( dst->f[3] = src0->f[3] > src1->f[3] ? src0->f[3] : src1->f[3]; } -#if 0 -static void -micro_imax( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] > src1->i[0] ? src0->i[0] : src1->i[0]; - dst->i[1] = src0->i[1] > src1->i[1] ? src0->i[1] : src1->i[1]; - dst->i[2] = src0->i[2] > src1->i[2] ? src0->i[2] : src1->i[2]; - dst->i[3] = src0->i[3] > src1->i[3] ? src0->i[3] : src1->i[3]; -} -#endif - -#if 0 -static void -micro_umax( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] > src1->u[0] ? src0->u[0] : src1->u[0]; - dst->u[1] = src0->u[1] > src1->u[1] ? src0->u[1] : src1->u[1]; - dst->u[2] = src0->u[2] > src1->u[2] ? src0->u[2] : src1->u[2]; - dst->u[3] = src0->u[3] > src1->u[3] ? src0->u[3] : src1->u[3]; -} -#endif - static void micro_min( union tgsi_exec_channel *dst, @@ -818,48 +834,6 @@ micro_min( dst->f[3] = src0->f[3] < src1->f[3] ? src0->f[3] : src1->f[3]; } -#if 0 -static void -micro_imin( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] < src1->i[0] ? src0->i[0] : src1->i[0]; - dst->i[1] = src0->i[1] < src1->i[1] ? src0->i[1] : src1->i[1]; - dst->i[2] = src0->i[2] < src1->i[2] ? src0->i[2] : src1->i[2]; - dst->i[3] = src0->i[3] < src1->i[3] ? src0->i[3] : src1->i[3]; -} -#endif - -#if 0 -static void -micro_umin( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] < src1->u[0] ? src0->u[0] : src1->u[0]; - dst->u[1] = src0->u[1] < src1->u[1] ? src0->u[1] : src1->u[1]; - dst->u[2] = src0->u[2] < src1->u[2] ? src0->u[2] : src1->u[2]; - dst->u[3] = src0->u[3] < src1->u[3] ? src0->u[3] : src1->u[3]; -} -#endif - -#if 0 -static void -micro_umod( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] % src1->u[0]; - dst->u[1] = src0->u[1] % src1->u[1]; - dst->u[2] = src0->u[2] % src1->u[2]; - dst->u[3] = src0->u[3] % src1->u[3]; -} -#endif - static void micro_mul( union tgsi_exec_channel *dst, @@ -874,20 +848,6 @@ micro_mul( #if 0 static void -micro_imul( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] * src1->i[0]; - dst->i[1] = src0->i[1] * src1->i[1]; - dst->i[2] = src0->i[2] * src1->i[2]; - dst->i[3] = src0->i[3] * src1->i[3]; -} -#endif - -#if 0 -static void micro_imul64( union tgsi_exec_channel *dst0, union tgsi_exec_channel *dst1, @@ -951,42 +911,6 @@ micro_neg( dst->f[3] = -src->f[3]; } -#if 0 -static void -micro_ineg( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->i[0] = -src->i[0]; - dst->i[1] = -src->i[1]; - dst->i[2] = -src->i[2]; - dst->i[3] = -src->i[3]; -} -#endif - -static void -micro_not( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->u[0] = ~src->u[0]; - dst->u[1] = ~src->u[1]; - dst->u[2] = ~src->u[2]; - dst->u[3] = ~src->u[3]; -} - -static void -micro_or( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] | src1->u[0]; - dst->u[1] = src0->u[1] | src1->u[1]; - dst->u[2] = src0->u[2] | src1->u[2]; - dst->u[3] = src0->u[3] | src1->u[3]; -} - static void micro_pow( union tgsi_exec_channel *dst, @@ -1007,88 +931,6 @@ micro_pow( } static void -micro_rnd( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = floorf( src->f[0] + 0.5f ); - dst->f[1] = floorf( src->f[1] + 0.5f ); - dst->f[2] = floorf( src->f[2] + 0.5f ); - dst->f[3] = floorf( src->f[3] + 0.5f ); -} - -static void -micro_sgn( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = src->f[0] < 0.0f ? -1.0f : src->f[0] > 0.0f ? 1.0f : 0.0f; - dst->f[1] = src->f[1] < 0.0f ? -1.0f : src->f[1] > 0.0f ? 1.0f : 0.0f; - dst->f[2] = src->f[2] < 0.0f ? -1.0f : src->f[2] > 0.0f ? 1.0f : 0.0f; - dst->f[3] = src->f[3] < 0.0f ? -1.0f : src->f[3] > 0.0f ? 1.0f : 0.0f; -} - -static void -micro_shl( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] << src1->i[0]; - dst->i[1] = src0->i[1] << src1->i[1]; - dst->i[2] = src0->i[2] << src1->i[2]; - dst->i[3] = src0->i[3] << src1->i[3]; -} - -static void -micro_ishr( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->i[0] = src0->i[0] >> src1->i[0]; - dst->i[1] = src0->i[1] >> src1->i[1]; - dst->i[2] = src0->i[2] >> src1->i[2]; - dst->i[3] = src0->i[3] >> src1->i[3]; -} - -static void -micro_trunc( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0 ) -{ - dst->f[0] = (float) (int) src0->f[0]; - dst->f[1] = (float) (int) src0->f[1]; - dst->f[2] = (float) (int) src0->f[2]; - dst->f[3] = (float) (int) src0->f[3]; -} - -#if 0 -static void -micro_ushr( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] >> src1->u[0]; - dst->u[1] = src0->u[1] >> src1->u[1]; - dst->u[2] = src0->u[2] >> src1->u[2]; - dst->u[3] = src0->u[3] >> src1->u[3]; -} -#endif - -static void -micro_sin( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = sinf( src->f[0] ); - dst->f[1] = sinf( src->f[1] ); - dst->f[2] = sinf( src->f[2] ); - dst->f[3] = sinf( src->f[3] ); -} - -static void micro_sqrt( union tgsi_exec_channel *dst, const union tgsi_exec_channel *src ) { @@ -1110,31 +952,6 @@ micro_sub( dst->f[3] = src0->f[3] - src1->f[3]; } -#if 0 -static void -micro_u2f( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src ) -{ - dst->f[0] = (float) src->u[0]; - dst->f[1] = (float) src->u[1]; - dst->f[2] = (float) src->u[2]; - dst->f[3] = (float) src->u[3]; -} -#endif - -static void -micro_xor( - union tgsi_exec_channel *dst, - const union tgsi_exec_channel *src0, - const union tgsi_exec_channel *src1 ) -{ - dst->u[0] = src0->u[0] ^ src1->u[0]; - dst->u[1] = src0->u[1] ^ src1->u[1]; - dst->u[2] = src0->u[2] ^ src1->u[2]; - dst->u[3] = src0->u[3] ^ src1->u[3]; -} - static void fetch_src_file_channel( const struct tgsi_exec_machine *mach, @@ -1233,11 +1050,11 @@ fetch_src_file_channel( } static void -fetch_source( - const struct tgsi_exec_machine *mach, - union tgsi_exec_channel *chan, - const struct tgsi_full_src_register *reg, - const uint chan_index ) +fetch_source(const struct tgsi_exec_machine *mach, + union tgsi_exec_channel *chan, + const struct tgsi_full_src_register *reg, + const uint chan_index, + enum tgsi_exec_datatype src_datatype) { union tgsi_exec_channel index; uint swizzle; @@ -1286,10 +1103,10 @@ fetch_source( &indir_index ); /* add value of address register to the offset */ - index.i[0] += (int) indir_index.f[0]; - index.i[1] += (int) indir_index.f[1]; - index.i[2] += (int) indir_index.f[2]; - index.i[3] += (int) indir_index.f[3]; + index.i[0] += indir_index.i[0]; + index.i[1] += indir_index.i[1]; + index.i[2] += indir_index.i[2]; + index.i[3] += indir_index.i[3]; /* for disabled execution channels, zero-out the index to * avoid using a potential garbage value. @@ -1366,10 +1183,10 @@ fetch_source( &index2, &indir_index ); - index.i[0] += (int) indir_index.f[0]; - index.i[1] += (int) indir_index.f[1]; - index.i[2] += (int) indir_index.f[2]; - index.i[3] += (int) indir_index.f[3]; + index.i[0] += indir_index.i[0]; + index.i[1] += indir_index.i[1]; + index.i[2] += indir_index.i[2]; + index.i[3] += indir_index.i[3]; /* for disabled execution channels, zero-out the index to * avoid using a potential garbage value. @@ -1394,32 +1211,30 @@ fetch_source( &index, chan ); - switch (tgsi_util_get_full_src_register_sign_mode( reg, chan_index )) { - case TGSI_UTIL_SIGN_CLEAR: - micro_abs( chan, chan ); - break; - - case TGSI_UTIL_SIGN_SET: - micro_abs( chan, chan ); - micro_neg( chan, chan ); - break; - - case TGSI_UTIL_SIGN_TOGGLE: - micro_neg( chan, chan ); - break; + if (reg->Register.Absolute) { + if (src_datatype == TGSI_EXEC_DATA_FLOAT) { + micro_abs(chan, chan); + } else { + micro_iabs(chan, chan); + } + } - case TGSI_UTIL_SIGN_KEEP: - break; + if (reg->Register.Negate) { + if (src_datatype == TGSI_EXEC_DATA_FLOAT) { + micro_neg(chan, chan); + } else { + micro_ineg(chan, chan); + } } } static void -store_dest( - struct tgsi_exec_machine *mach, - const union tgsi_exec_channel *chan, - const struct tgsi_full_dst_register *reg, - const struct tgsi_full_instruction *inst, - uint chan_index ) +store_dest(struct tgsi_exec_machine *mach, + const union tgsi_exec_channel *chan, + const struct tgsi_full_dst_register *reg, + const struct tgsi_full_instruction *inst, + uint chan_index, + enum tgsi_exec_datatype dst_datatype) { uint i; union tgsi_exec_channel null; @@ -1428,9 +1243,9 @@ store_dest( int offset = 0; /* indirection offset */ int index; -#ifdef DEBUG - check_inf_or_nan(chan); -#endif + if (dst_datatype == TGSI_EXEC_DATA_FLOAT) { + CHECK_INF_OR_NAN(chan); + } /* There is an extra source register that indirectly subscripts * a register file. The direct index now becomes an offset @@ -1465,7 +1280,7 @@ store_dest( &indir_index ); /* save indirection offset */ - offset = (int) indir_index.f[0]; + offset = indir_index.i[0]; } switch (reg->Register.File) { @@ -1595,10 +1410,10 @@ store_dest( } #define FETCH(VAL,INDEX,CHAN)\ - fetch_source (mach, VAL, &inst->Src[INDEX], CHAN) + fetch_source(mach, VAL, &inst->Src[INDEX], CHAN, TGSI_EXEC_DATA_FLOAT) #define STORE(VAL,INDEX,CHAN)\ - store_dest (mach, VAL, &inst->Dst[INDEX], inst, CHAN ) + store_dest(mach, VAL, &inst->Dst[INDEX], inst, CHAN, TGSI_EXEC_DATA_FLOAT) /** @@ -1694,7 +1509,8 @@ fetch_texel( struct tgsi_sampler *sampler, const union tgsi_exec_channel *s, const union tgsi_exec_channel *t, const union tgsi_exec_channel *p, - float lodbias, /* XXX should be float[4] */ + const union tgsi_exec_channel *c0, + enum tgsi_sampler_control control, union tgsi_exec_channel *r, union tgsi_exec_channel *g, union tgsi_exec_channel *b, @@ -1703,7 +1519,7 @@ fetch_texel( struct tgsi_sampler *sampler, uint j; float rgba[NUM_CHANNELS][QUAD_SIZE]; - sampler->get_samples(sampler, s->f, t->f, p->f, lodbias, rgba); + sampler->get_samples(sampler, s->f, t->f, p->f, c0->f, control, rgba); for (j = 0; j < 4; j++) { r->f[j] = rgba[0][j]; @@ -1714,102 +1530,95 @@ fetch_texel( struct tgsi_sampler *sampler, } +#define TEX_MODIFIER_NONE 0 +#define TEX_MODIFIER_PROJECTED 1 +#define TEX_MODIFIER_LOD_BIAS 2 +#define TEX_MODIFIER_EXPLICIT_LOD 3 + + static void exec_tex(struct tgsi_exec_machine *mach, const struct tgsi_full_instruction *inst, - boolean biasLod, - boolean projected) + uint modifier) { const uint unit = inst->Src[1].Register.Index; union tgsi_exec_channel r[4]; + const union tgsi_exec_channel *lod = &ZeroVec; + enum tgsi_sampler_control control; uint chan_index; - float lodBias; - /* debug_printf("Sampler %u unit %u\n", sampler, unit); */ + if (modifier != TEX_MODIFIER_NONE) { + FETCH(&r[3], 0, CHAN_W); + if (modifier != TEX_MODIFIER_PROJECTED) { + lod = &r[3]; + } + } + + if (modifier == TEX_MODIFIER_EXPLICIT_LOD) { + control = tgsi_sampler_lod_explicit; + } else { + control = tgsi_sampler_lod_bias; + } switch (inst->Texture.Texture) { case TGSI_TEXTURE_1D: case TGSI_TEXTURE_SHADOW1D: - FETCH(&r[0], 0, CHAN_X); - if (projected) { - FETCH(&r[1], 0, CHAN_W); - micro_div( &r[0], &r[0], &r[1] ); - } - - if (biasLod) { - FETCH(&r[1], 0, CHAN_W); - lodBias = r[2].f[0]; + if (modifier == TEX_MODIFIER_PROJECTED) { + micro_div(&r[0], &r[0], &r[3]); } - else - lodBias = 0.0; fetch_texel(mach->Samplers[unit], - &r[0], &ZeroVec, &ZeroVec, lodBias, /* S, T, P, BIAS */ - &r[0], &r[1], &r[2], &r[3]); /* R, G, B, A */ + &r[0], &ZeroVec, &ZeroVec, lod, /* S, T, P, LOD */ + control, + &r[0], &r[1], &r[2], &r[3]); /* R, G, B, A */ break; case TGSI_TEXTURE_2D: case TGSI_TEXTURE_RECT: case TGSI_TEXTURE_SHADOW2D: case TGSI_TEXTURE_SHADOWRECT: - FETCH(&r[0], 0, CHAN_X); FETCH(&r[1], 0, CHAN_Y); FETCH(&r[2], 0, CHAN_Z); - if (projected) { - FETCH(&r[3], 0, CHAN_W); - micro_div( &r[0], &r[0], &r[3] ); - micro_div( &r[1], &r[1], &r[3] ); - micro_div( &r[2], &r[2], &r[3] ); - } - - if (biasLod) { - FETCH(&r[3], 0, CHAN_W); - lodBias = r[3].f[0]; + if (modifier == TEX_MODIFIER_PROJECTED) { + micro_div(&r[0], &r[0], &r[3]); + micro_div(&r[1], &r[1], &r[3]); + micro_div(&r[2], &r[2], &r[3]); } - else - lodBias = 0.0; fetch_texel(mach->Samplers[unit], - &r[0], &r[1], &r[2], lodBias, /* inputs */ + &r[0], &r[1], &r[2], lod, /* S, T, P, LOD */ + control, &r[0], &r[1], &r[2], &r[3]); /* outputs */ break; case TGSI_TEXTURE_3D: case TGSI_TEXTURE_CUBE: - FETCH(&r[0], 0, CHAN_X); FETCH(&r[1], 0, CHAN_Y); FETCH(&r[2], 0, CHAN_Z); - if (projected) { - FETCH(&r[3], 0, CHAN_W); - micro_div( &r[0], &r[0], &r[3] ); - micro_div( &r[1], &r[1], &r[3] ); - micro_div( &r[2], &r[2], &r[3] ); - } - - if (biasLod) { - FETCH(&r[3], 0, CHAN_W); - lodBias = r[3].f[0]; + if (modifier == TEX_MODIFIER_PROJECTED) { + micro_div(&r[0], &r[0], &r[3]); + micro_div(&r[1], &r[1], &r[3]); + micro_div(&r[2], &r[2], &r[3]); } - else - lodBias = 0.0; fetch_texel(mach->Samplers[unit], - &r[0], &r[1], &r[2], lodBias, + &r[0], &r[1], &r[2], lod, + control, &r[0], &r[1], &r[2], &r[3]); break; default: - assert (0); + assert(0); } - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[chan_index], 0, chan_index ); + FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { + STORE(&r[chan_index], 0, chan_index); } } @@ -1832,8 +1641,9 @@ exec_txd(struct tgsi_exec_machine *mach, FETCH(&r[0], 0, CHAN_X); fetch_texel(mach->Samplers[unit], - &r[0], &ZeroVec, &ZeroVec, 0.0f, /* S, T, P, BIAS */ - &r[0], &r[1], &r[2], &r[3]); /* R, G, B, A */ + &r[0], &ZeroVec, &ZeroVec, &ZeroVec, /* S, T, P, BIAS */ + tgsi_sampler_lod_bias, + &r[0], &r[1], &r[2], &r[3]); /* R, G, B, A */ break; case TGSI_TEXTURE_2D: @@ -1846,8 +1656,9 @@ exec_txd(struct tgsi_exec_machine *mach, FETCH(&r[2], 0, CHAN_Z); fetch_texel(mach->Samplers[unit], - &r[0], &r[1], &r[2], 0.0f, /* inputs */ - &r[0], &r[1], &r[2], &r[3]); /* outputs */ + &r[0], &r[1], &r[2], &ZeroVec, /* inputs */ + tgsi_sampler_lod_bias, + &r[0], &r[1], &r[2], &r[3]); /* outputs */ break; case TGSI_TEXTURE_3D: @@ -1858,7 +1669,8 @@ exec_txd(struct tgsi_exec_machine *mach, FETCH(&r[2], 0, CHAN_Z); fetch_texel(mach->Samplers[unit], - &r[0], &r[1], &r[2], 0.0f, + &r[0], &r[1], &r[2], &ZeroVec, + tgsi_sampler_lod_bias, &r[0], &r[1], &r[2], &r[3]); break; @@ -1955,7 +1767,7 @@ exec_declaration(struct tgsi_exec_machine *mach, if (decl->Semantic.Name == TGSI_SEMANTIC_POSITION) { assert(decl->Semantic.Index == 0); assert(first == last); - assert(mask = TGSI_WRITEMASK_XYZW); + assert(mask == TGSI_WRITEMASK_XYZW); mach->Inputs[first] = mach->QuadPos; } else if (decl->Semantic.Name == TGSI_SEMANTIC_FACE) { @@ -2001,6 +1813,585 @@ exec_declaration(struct tgsi_exec_machine *mach, } } +typedef void (* micro_op)(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src); + +static void +exec_scalar_unary(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst, + micro_op op, + enum tgsi_exec_datatype dst_datatype, + enum tgsi_exec_datatype src_datatype) +{ + unsigned int chan; + union tgsi_exec_channel src; + union tgsi_exec_channel dst; + + fetch_source(mach, &src, &inst->Src[0], CHAN_X, src_datatype); + op(&dst, &src); + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &dst, &inst->Dst[0], inst, chan, dst_datatype); + } + } +} + +static void +exec_vector_unary(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst, + micro_op op, + enum tgsi_exec_datatype dst_datatype, + enum tgsi_exec_datatype src_datatype) +{ + unsigned int chan; + struct tgsi_exec_vector dst; + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + union tgsi_exec_channel src; + + fetch_source(mach, &src, &inst->Src[0], chan, src_datatype); + op(&dst.xyzw[chan], &src); + } + } + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &dst.xyzw[chan], &inst->Dst[0], inst, chan, dst_datatype); + } + } +} + +static void +exec_vector_binary(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst, + micro_op op, + enum tgsi_exec_datatype dst_datatype, + enum tgsi_exec_datatype src_datatype) +{ + unsigned int chan; + struct tgsi_exec_vector dst; + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + union tgsi_exec_channel src[2]; + + fetch_source(mach, &src[0], &inst->Src[0], chan, src_datatype); + fetch_source(mach, &src[1], &inst->Src[1], chan, src_datatype); + op(&dst.xyzw[chan], src); + } + } + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &dst.xyzw[chan], &inst->Dst[0], inst, chan, dst_datatype); + } + } +} + +static void +exec_vector_trinary(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst, + micro_op op, + enum tgsi_exec_datatype dst_datatype, + enum tgsi_exec_datatype src_datatype) +{ + unsigned int chan; + struct tgsi_exec_vector dst; + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + union tgsi_exec_channel src[3]; + + fetch_source(mach, &src[0], &inst->Src[0], chan, src_datatype); + fetch_source(mach, &src[1], &inst->Src[1], chan, src_datatype); + fetch_source(mach, &src[2], &inst->Src[2], chan, src_datatype); + op(&dst.xyzw[chan], src); + } + } + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &dst.xyzw[chan], &inst->Dst[0], inst, chan, dst_datatype); + } + } +} + +static void +exec_dp3(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + unsigned int chan; + union tgsi_exec_channel arg[3]; + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_mul(&arg[2], &arg[0], &arg[1]); + + for (chan = CHAN_Y; chan <= CHAN_Z; chan++) { + fetch_source(mach, &arg[0], &inst->Src[0], chan, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], chan, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[2], arg); + } + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &arg[2], &inst->Dst[0], inst, chan, TGSI_EXEC_DATA_FLOAT); + } + } +} + +static void +exec_dp4(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + unsigned int chan; + union tgsi_exec_channel arg[3]; + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_mul(&arg[2], &arg[0], &arg[1]); + + for (chan = CHAN_Y; chan <= CHAN_W; chan++) { + fetch_source(mach, &arg[0], &inst->Src[0], chan, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], chan, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[2], arg); + } + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &arg[2], &inst->Dst[0], inst, chan, TGSI_EXEC_DATA_FLOAT); + } + } +} + +static void +exec_dp2a(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + unsigned int chan; + union tgsi_exec_channel arg[3]; + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_mul(&arg[2], &arg[0], &arg[1]); + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[0], arg); + + fetch_source(mach, &arg[1], &inst->Src[2], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_add(&arg[0], &arg[0], &arg[1]); + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &arg[0], &inst->Dst[0], inst, chan, TGSI_EXEC_DATA_FLOAT); + } + } +} + +static void +exec_dph(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + unsigned int chan; + union tgsi_exec_channel arg[3]; + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_mul(&arg[2], &arg[0], &arg[1]); + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[2], arg); + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_Z, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_Z, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[0], arg); + + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_W, TGSI_EXEC_DATA_FLOAT); + micro_add(&arg[0], &arg[0], &arg[1]); + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &arg[0], &inst->Dst[0], inst, chan, TGSI_EXEC_DATA_FLOAT); + } + } +} + +static void +exec_dp2(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + unsigned int chan; + union tgsi_exec_channel arg[3]; + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_X, TGSI_EXEC_DATA_FLOAT); + micro_mul(&arg[2], &arg[0], &arg[1]); + + fetch_source(mach, &arg[0], &inst->Src[0], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + fetch_source(mach, &arg[1], &inst->Src[1], CHAN_Y, TGSI_EXEC_DATA_FLOAT); + micro_mad(&arg[2], arg); + + for (chan = 0; chan < NUM_CHANNELS; chan++) { + if (inst->Dst[0].Register.WriteMask & (1 << chan)) { + store_dest(mach, &arg[2], &inst->Dst[0], inst, chan, TGSI_EXEC_DATA_FLOAT); + } + } +} + +static void +exec_break(struct tgsi_exec_machine *mach) +{ + if (mach->BreakType == TGSI_EXEC_BREAK_INSIDE_LOOP) { + /* turn off loop channels for each enabled exec channel */ + mach->LoopMask &= ~mach->ExecMask; + /* Todo: if mach->LoopMask == 0, jump to end of loop */ + UPDATE_EXEC_MASK(mach); + } else { + assert(mach->BreakType == TGSI_EXEC_BREAK_INSIDE_SWITCH); + + mach->Switch.mask = 0x0; + + UPDATE_EXEC_MASK(mach); + } +} + +static void +exec_switch(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + assert(mach->SwitchStackTop < TGSI_EXEC_MAX_SWITCH_NESTING); + assert(mach->BreakStackTop < TGSI_EXEC_MAX_BREAK_STACK); + + mach->SwitchStack[mach->SwitchStackTop++] = mach->Switch; + fetch_source(mach, &mach->Switch.selector, &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_UINT); + mach->Switch.mask = 0x0; + mach->Switch.defaultMask = 0x0; + + mach->BreakStack[mach->BreakStackTop++] = mach->BreakType; + mach->BreakType = TGSI_EXEC_BREAK_INSIDE_SWITCH; + + UPDATE_EXEC_MASK(mach); +} + +static void +exec_case(struct tgsi_exec_machine *mach, + const struct tgsi_full_instruction *inst) +{ + uint prevMask = mach->SwitchStack[mach->SwitchStackTop - 1].mask; + union tgsi_exec_channel src; + uint mask = 0; + + fetch_source(mach, &src, &inst->Src[0], CHAN_X, TGSI_EXEC_DATA_UINT); + + if (mach->Switch.selector.u[0] == src.u[0]) { + mask |= 0x1; + } + if (mach->Switch.selector.u[1] == src.u[1]) { + mask |= 0x2; + } + if (mach->Switch.selector.u[2] == src.u[2]) { + mask |= 0x4; + } + if (mach->Switch.selector.u[3] == src.u[3]) { + mask |= 0x8; + } + + mach->Switch.defaultMask |= mask; + + mach->Switch.mask |= mask & prevMask; + + UPDATE_EXEC_MASK(mach); +} + +static void +exec_default(struct tgsi_exec_machine *mach) +{ + uint prevMask = mach->SwitchStack[mach->SwitchStackTop - 1].mask; + + mach->Switch.mask |= ~mach->Switch.defaultMask & prevMask; + + UPDATE_EXEC_MASK(mach); +} + +static void +exec_endswitch(struct tgsi_exec_machine *mach) +{ + mach->Switch = mach->SwitchStack[--mach->SwitchStackTop]; + mach->BreakType = mach->BreakStack[--mach->BreakStackTop]; + + UPDATE_EXEC_MASK(mach); +} + +static void +micro_i2f(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = (float)src->i[0]; + dst->f[1] = (float)src->i[1]; + dst->f[2] = (float)src->i[2]; + dst->f[3] = (float)src->i[3]; +} + +static void +micro_not(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = ~src->u[0]; + dst->u[1] = ~src->u[1]; + dst->u[2] = ~src->u[2]; + dst->u[3] = ~src->u[3]; +} + +static void +micro_shl(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] << src[1].u[0]; + dst->u[1] = src[0].u[1] << src[1].u[1]; + dst->u[2] = src[0].u[2] << src[1].u[2]; + dst->u[3] = src[0].u[3] << src[1].u[3]; +} + +static void +micro_and(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] & src[1].u[0]; + dst->u[1] = src[0].u[1] & src[1].u[1]; + dst->u[2] = src[0].u[2] & src[1].u[2]; + dst->u[3] = src[0].u[3] & src[1].u[3]; +} + +static void +micro_or(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] | src[1].u[0]; + dst->u[1] = src[0].u[1] | src[1].u[1]; + dst->u[2] = src[0].u[2] | src[1].u[2]; + dst->u[3] = src[0].u[3] | src[1].u[3]; +} + +static void +micro_xor(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] ^ src[1].u[0]; + dst->u[1] = src[0].u[1] ^ src[1].u[1]; + dst->u[2] = src[0].u[2] ^ src[1].u[2]; + dst->u[3] = src[0].u[3] ^ src[1].u[3]; +} + +static void +micro_f2i(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = (int)src->f[0]; + dst->i[1] = (int)src->f[1]; + dst->i[2] = (int)src->f[2]; + dst->i[3] = (int)src->f[3]; +} + +static void +micro_idiv(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] / src[1].i[0]; + dst->i[1] = src[0].i[1] / src[1].i[1]; + dst->i[2] = src[0].i[2] / src[1].i[2]; + dst->i[3] = src[0].i[3] / src[1].i[3]; +} + +static void +micro_imax(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] > src[1].i[0] ? src[0].i[0] : src[1].i[0]; + dst->i[1] = src[0].i[1] > src[1].i[1] ? src[0].i[1] : src[1].i[1]; + dst->i[2] = src[0].i[2] > src[1].i[2] ? src[0].i[2] : src[1].i[2]; + dst->i[3] = src[0].i[3] > src[1].i[3] ? src[0].i[3] : src[1].i[3]; +} + +static void +micro_imin(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] < src[1].i[0] ? src[0].i[0] : src[1].i[0]; + dst->i[1] = src[0].i[1] < src[1].i[1] ? src[0].i[1] : src[1].i[1]; + dst->i[2] = src[0].i[2] < src[1].i[2] ? src[0].i[2] : src[1].i[2]; + dst->i[3] = src[0].i[3] < src[1].i[3] ? src[0].i[3] : src[1].i[3]; +} + +static void +micro_isge(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] >= src[1].i[0] ? -1 : 0; + dst->i[1] = src[0].i[1] >= src[1].i[1] ? -1 : 0; + dst->i[2] = src[0].i[2] >= src[1].i[2] ? -1 : 0; + dst->i[3] = src[0].i[3] >= src[1].i[3] ? -1 : 0; +} + +static void +micro_ishr(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] >> src[1].i[0]; + dst->i[1] = src[0].i[1] >> src[1].i[1]; + dst->i[2] = src[0].i[2] >> src[1].i[2]; + dst->i[3] = src[0].i[3] >> src[1].i[3]; +} + +static void +micro_islt(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->i[0] = src[0].i[0] < src[1].i[0] ? -1 : 0; + dst->i[1] = src[0].i[1] < src[1].i[1] ? -1 : 0; + dst->i[2] = src[0].i[2] < src[1].i[2] ? -1 : 0; + dst->i[3] = src[0].i[3] < src[1].i[3] ? -1 : 0; +} + +static void +micro_f2u(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = (uint)src->f[0]; + dst->u[1] = (uint)src->f[1]; + dst->u[2] = (uint)src->f[2]; + dst->u[3] = (uint)src->f[3]; +} + +static void +micro_u2f(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->f[0] = (float)src->u[0]; + dst->f[1] = (float)src->u[1]; + dst->f[2] = (float)src->u[2]; + dst->f[3] = (float)src->u[3]; +} + +static void +micro_uadd(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] + src[1].u[0]; + dst->u[1] = src[0].u[1] + src[1].u[1]; + dst->u[2] = src[0].u[2] + src[1].u[2]; + dst->u[3] = src[0].u[3] + src[1].u[3]; +} + +static void +micro_udiv(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] / src[1].u[0]; + dst->u[1] = src[0].u[1] / src[1].u[1]; + dst->u[2] = src[0].u[2] / src[1].u[2]; + dst->u[3] = src[0].u[3] / src[1].u[3]; +} + +static void +micro_umad(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] * src[1].u[0] + src[2].u[0]; + dst->u[1] = src[0].u[1] * src[1].u[1] + src[2].u[1]; + dst->u[2] = src[0].u[2] * src[1].u[2] + src[2].u[2]; + dst->u[3] = src[0].u[3] * src[1].u[3] + src[2].u[3]; +} + +static void +micro_umax(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] > src[1].u[0] ? src[0].u[0] : src[1].u[0]; + dst->u[1] = src[0].u[1] > src[1].u[1] ? src[0].u[1] : src[1].u[1]; + dst->u[2] = src[0].u[2] > src[1].u[2] ? src[0].u[2] : src[1].u[2]; + dst->u[3] = src[0].u[3] > src[1].u[3] ? src[0].u[3] : src[1].u[3]; +} + +static void +micro_umin(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] < src[1].u[0] ? src[0].u[0] : src[1].u[0]; + dst->u[1] = src[0].u[1] < src[1].u[1] ? src[0].u[1] : src[1].u[1]; + dst->u[2] = src[0].u[2] < src[1].u[2] ? src[0].u[2] : src[1].u[2]; + dst->u[3] = src[0].u[3] < src[1].u[3] ? src[0].u[3] : src[1].u[3]; +} + +static void +micro_umod(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] % src[1].u[0]; + dst->u[1] = src[0].u[1] % src[1].u[1]; + dst->u[2] = src[0].u[2] % src[1].u[2]; + dst->u[3] = src[0].u[3] % src[1].u[3]; +} + +static void +micro_umul(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] * src[1].u[0]; + dst->u[1] = src[0].u[1] * src[1].u[1]; + dst->u[2] = src[0].u[2] * src[1].u[2]; + dst->u[3] = src[0].u[3] * src[1].u[3]; +} + +static void +micro_useq(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] == src[1].u[0] ? ~0 : 0; + dst->u[1] = src[0].u[1] == src[1].u[1] ? ~0 : 0; + dst->u[2] = src[0].u[2] == src[1].u[2] ? ~0 : 0; + dst->u[3] = src[0].u[3] == src[1].u[3] ? ~0 : 0; +} + +static void +micro_usge(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] >= src[1].u[0] ? ~0 : 0; + dst->u[1] = src[0].u[1] >= src[1].u[1] ? ~0 : 0; + dst->u[2] = src[0].u[2] >= src[1].u[2] ? ~0 : 0; + dst->u[3] = src[0].u[3] >= src[1].u[3] ? ~0 : 0; +} + +static void +micro_ushr(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] >> src[1].u[0]; + dst->u[1] = src[0].u[1] >> src[1].u[1]; + dst->u[2] = src[0].u[2] >> src[1].u[2]; + dst->u[3] = src[0].u[3] >> src[1].u[3]; +} + +static void +micro_uslt(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] < src[1].u[0] ? ~0 : 0; + dst->u[1] = src[0].u[1] < src[1].u[1] ? ~0 : 0; + dst->u[2] = src[0].u[2] < src[1].u[2] ? ~0 : 0; + dst->u[3] = src[0].u[3] < src[1].u[3] ? ~0 : 0; +} + +static void +micro_usne(union tgsi_exec_channel *dst, + const union tgsi_exec_channel *src) +{ + dst->u[0] = src[0].u[0] != src[1].u[0] ? ~0 : 0; + dst->u[1] = src[0].u[1] != src[1].u[1] ? ~0 : 0; + dst->u[2] = src[0].u[2] != src[1].u[2] ? ~0 : 0; + dst->u[3] = src[0].u[3] != src[1].u[3] ? ~0 : 0; +} + static void exec_instruction( struct tgsi_exec_machine *mach, @@ -2015,23 +2406,11 @@ exec_instruction( switch (inst->Instruction.Opcode) { case TGSI_OPCODE_ARL: - case TGSI_OPCODE_FLR: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_flr(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_arl, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_MOV: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH(&d[chan_index], 0, chan_index); - } - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_mov, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_LIT: @@ -2068,23 +2447,11 @@ exec_instruction( break; case TGSI_OPCODE_RCP: - /* TGSI_OPCODE_RECIP */ - FETCH( &r[0], 0, CHAN_X ); - micro_div( &r[0], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &r[0] ); - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_rcp, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_RSQ: - /* TGSI_OPCODE_RECIPSQRT */ - FETCH( &r[0], 0, CHAN_X ); - micro_abs( &r[0], &r[0] ); - micro_sqrt( &r[0], &r[0] ); - micro_div( &r[0], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &r[0] ); - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_rsq, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_EXP: @@ -2151,54 +2518,11 @@ exec_instruction( break; case TGSI_OPCODE_DP3: - /* TGSI_OPCODE_DOT3 */ - FETCH( &r[0], 0, CHAN_X ); - FETCH( &r[1], 1, CHAN_X ); - micro_mul( &r[0], &r[0], &r[1] ); - - FETCH( &r[1], 0, CHAN_Y ); - FETCH( &r[2], 1, CHAN_Y ); - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH( &r[1], 0, CHAN_Z ); - FETCH( &r[2], 1, CHAN_Z ); - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_dp3(mach, inst); break; - case TGSI_OPCODE_DP4: - /* TGSI_OPCODE_DOT4 */ - FETCH(&r[0], 0, CHAN_X); - FETCH(&r[1], 1, CHAN_X); - - micro_mul( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 0, CHAN_Y); - FETCH(&r[2], 1, CHAN_Y); - - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 0, CHAN_Z); - FETCH(&r[2], 1, CHAN_Z); - - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 0, CHAN_W); - FETCH(&r[2], 1, CHAN_W); - - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + case TGSI_OPCODE_DP4: + exec_dp4(mach, inst); break; case TGSI_OPCODE_DST: @@ -2255,41 +2579,15 @@ exec_instruction( break; case TGSI_OPCODE_SLT: - /* TGSI_OPCODE_SETLT */ - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_lt(&d[chan_index], &r[0], &r[1], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_slt, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SGE: - /* TGSI_OPCODE_SETGE */ - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_le(&d[chan_index], &r[1], &r[0], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_sge, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_MAD: - /* TGSI_OPCODE_MADD */ - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_mul( &r[0], &r[0], &r[1] ); - FETCH( &r[1], 2, chan_index ); - micro_add(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_trinary(mach, inst, micro_mad, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SUB: @@ -2304,17 +2602,7 @@ exec_instruction( break; case TGSI_OPCODE_LRP: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH(&r[0], 0, chan_index); - FETCH(&r[1], 1, chan_index); - FETCH(&r[2], 2, chan_index); - micro_sub( &r[1], &r[1], &r[2] ); - micro_mul( &r[0], &r[0], &r[1] ); - micro_add(&d[chan_index], &r[0], &r[2]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_trinary(mach, inst, micro_lrp, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_CND: @@ -2330,31 +2618,11 @@ exec_instruction( break; case TGSI_OPCODE_DP2A: - FETCH( &r[0], 0, CHAN_X ); - FETCH( &r[1], 1, CHAN_X ); - micro_mul( &r[0], &r[0], &r[1] ); - - FETCH( &r[1], 0, CHAN_Y ); - FETCH( &r[2], 1, CHAN_Y ); - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH( &r[2], 2, CHAN_X ); - micro_add( &r[0], &r[0], &r[2] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_dp2a(mach, inst); break; case TGSI_OPCODE_FRC: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_frc(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_frc, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_CLAMP: @@ -2370,33 +2638,20 @@ exec_instruction( } break; + case TGSI_OPCODE_FLR: + exec_vector_unary(mach, inst, micro_flr, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); + break; + case TGSI_OPCODE_ROUND: - case TGSI_OPCODE_ARR: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_rnd(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_rnd, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_EX2: - FETCH(&r[0], 0, CHAN_X); - - micro_exp2( &r[0], &r[0] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_exp2, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_LG2: - FETCH( &r[0], 0, CHAN_X ); - micro_lg2( &r[0], &r[0] ); - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_lg2, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_POW: @@ -2449,15 +2704,9 @@ exec_instruction( } break; - case TGSI_OPCODE_ABS: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH(&r[0], 0, chan_index); - micro_abs(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } - break; + case TGSI_OPCODE_ABS: + exec_vector_unary(mach, inst, micro_abs, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); + break; case TGSI_OPCODE_RCC: FETCH(&r[0], 0, CHAN_X); @@ -2469,60 +2718,19 @@ exec_instruction( break; case TGSI_OPCODE_DPH: - FETCH(&r[0], 0, CHAN_X); - FETCH(&r[1], 1, CHAN_X); - - micro_mul( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 0, CHAN_Y); - FETCH(&r[2], 1, CHAN_Y); - - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 0, CHAN_Z); - FETCH(&r[2], 1, CHAN_Z); - - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FETCH(&r[1], 1, CHAN_W); - - micro_add( &r[0], &r[0], &r[1] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_dph(mach, inst); break; case TGSI_OPCODE_COS: - FETCH(&r[0], 0, CHAN_X); - - micro_cos( &r[0], &r[0] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_cos, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_DDX: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_ddx(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_ddx, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_DDY: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_ddy(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_ddy, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_KILP: @@ -2599,14 +2807,7 @@ exec_instruction( break; case TGSI_OPCODE_SEQ: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_eq(&d[chan_index], &r[0], &r[1], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_seq, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SFL: @@ -2616,44 +2817,19 @@ exec_instruction( break; case TGSI_OPCODE_SGT: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_le(&d[chan_index], &r[0], &r[1], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_sgt, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SIN: - FETCH( &r[0], 0, CHAN_X ); - micro_sin( &r[0], &r[0] ); - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_scalar_unary(mach, inst, micro_sin, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SLE: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_le(&d[chan_index], &r[0], &r[1], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_sle, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SNE: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_eq(&d[chan_index], &r[0], &r[1], &mach->Temps[TEMP_0_I].xyzw[TEMP_0_C], &mach->Temps[TEMP_1_I].xyzw[TEMP_1_C]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_sne, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_STR: @@ -2666,14 +2842,14 @@ exec_instruction( /* simple texture lookup */ /* src[0] = texcoord */ /* src[1] = sampler unit */ - exec_tex(mach, inst, FALSE, FALSE); + exec_tex(mach, inst, TEX_MODIFIER_NONE); break; case TGSI_OPCODE_TXB: /* Texture lookup with lod bias */ /* src[0] = texcoord (src[0].w = LOD bias) */ /* src[1] = sampler unit */ - exec_tex(mach, inst, TRUE, FALSE); + exec_tex(mach, inst, TEX_MODIFIER_LOD_BIAS); break; case TGSI_OPCODE_TXD: @@ -2689,14 +2865,14 @@ exec_instruction( /* Texture lookup with explit LOD */ /* src[0] = texcoord (src[0].w = LOD) */ /* src[1] = sampler unit */ - exec_tex(mach, inst, TRUE, FALSE); + exec_tex(mach, inst, TEX_MODIFIER_EXPLICIT_LOD); break; case TGSI_OPCODE_TXP: /* Texture lookup with projection */ /* src[0] = texcoord (src[0].w = projection) */ /* src[1] = sampler unit */ - exec_tex(mach, inst, FALSE, TRUE); + exec_tex(mach, inst, TEX_MODIFIER_PROJECTED); break; case TGSI_OPCODE_UP2H: @@ -2758,6 +2934,10 @@ exec_instruction( assert (0); break; + case TGSI_OPCODE_ARR: + exec_vector_unary(mach, inst, micro_arr, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_FLOAT); + break; + case TGSI_OPCODE_BRA: assert (0); break; @@ -2777,6 +2957,8 @@ exec_instruction( mach->CallStack[mach->CallStackTop].CondStackTop = mach->CondStackTop; mach->CallStack[mach->CallStackTop].LoopStackTop = mach->LoopStackTop; mach->CallStack[mach->CallStackTop].ContStackTop = mach->ContStackTop; + mach->CallStack[mach->CallStackTop].SwitchStackTop = mach->SwitchStackTop; + mach->CallStack[mach->CallStackTop].BreakStackTop = mach->BreakStackTop; /* note that PC was already incremented above */ mach->CallStack[mach->CallStackTop].ReturnAddr = *pc; @@ -2784,12 +2966,17 @@ exec_instruction( /* Second, push the Cond, Loop, Cont, Func stacks */ assert(mach->CondStackTop < TGSI_EXEC_MAX_COND_NESTING); - mach->CondStack[mach->CondStackTop++] = mach->CondMask; assert(mach->LoopStackTop < TGSI_EXEC_MAX_LOOP_NESTING); - mach->LoopStack[mach->LoopStackTop++] = mach->LoopMask; assert(mach->ContStackTop < TGSI_EXEC_MAX_LOOP_NESTING); - mach->ContStack[mach->ContStackTop++] = mach->ContMask; + assert(mach->SwitchStackTop < TGSI_EXEC_MAX_SWITCH_NESTING); + assert(mach->BreakStackTop < TGSI_EXEC_MAX_BREAK_STACK); assert(mach->FuncStackTop < TGSI_EXEC_MAX_CALL_NESTING); + + mach->CondStack[mach->CondStackTop++] = mach->CondMask; + mach->LoopStack[mach->LoopStackTop++] = mach->LoopMask; + mach->ContStack[mach->ContStackTop++] = mach->ContMask; + mach->SwitchStack[mach->SwitchStackTop++] = mach->Switch; + mach->BreakStack[mach->BreakStackTop++] = mach->BreakType; mach->FuncStack[mach->FuncStackTop++] = mach->FuncMask; /* Finally, jump to the subroutine */ @@ -2822,6 +3009,12 @@ exec_instruction( mach->ContStackTop = mach->CallStack[mach->CallStackTop].ContStackTop; mach->ContMask = mach->ContStack[mach->ContStackTop]; + mach->SwitchStackTop = mach->CallStack[mach->CallStackTop].SwitchStackTop; + mach->Switch = mach->SwitchStack[mach->SwitchStackTop]; + + mach->BreakStackTop = mach->CallStack[mach->CallStackTop].BreakStackTop; + mach->BreakType = mach->BreakStack[mach->BreakStackTop]; + assert(mach->FuncStackTop > 0); mach->FuncMask = mach->FuncStack[--mach->FuncStackTop]; @@ -2832,14 +3025,7 @@ exec_instruction( break; case TGSI_OPCODE_SSG: - /* TGSI_OPCODE_SGN */ - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_sgn(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_sgn, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_CMP: @@ -2946,18 +3132,7 @@ exec_instruction( break; case TGSI_OPCODE_DP2: - FETCH( &r[0], 0, CHAN_X ); - FETCH( &r[1], 1, CHAN_X ); - micro_mul( &r[0], &r[0], &r[1] ); - - FETCH( &r[1], 0, CHAN_Y ); - FETCH( &r[2], 1, CHAN_Y ); - micro_mul( &r[1], &r[1], &r[2] ); - micro_add( &r[0], &r[0], &r[1] ); - - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - STORE( &r[0], 0, chan_index ); - } + exec_dp2(mach, inst); break; case TGSI_OPCODE_IF: @@ -3023,87 +3198,31 @@ exec_instruction( break; case TGSI_OPCODE_CEIL: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_ceil(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_ceil, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_I2F: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_i2f(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_i2f, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_INT); break; case TGSI_OPCODE_NOT: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_not(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_not, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); break; case TGSI_OPCODE_TRUNC: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - micro_trunc(&d[chan_index], &r[0]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_unary(mach, inst, micro_trunc, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_FLOAT); break; case TGSI_OPCODE_SHL: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_shl(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } - break; - - case TGSI_OPCODE_SHR: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_ishr(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_shl, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); break; case TGSI_OPCODE_AND: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_and(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_and, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); break; case TGSI_OPCODE_OR: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_or(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_or, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); break; case TGSI_OPCODE_MOD: @@ -3111,14 +3230,7 @@ exec_instruction( break; case TGSI_OPCODE_XOR: - FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { - FETCH( &r[0], 0, chan_index ); - FETCH( &r[1], 1, chan_index ); - micro_xor(&d[chan_index], &r[0], &r[1]); - } - FOR_EACH_ENABLED_CHANNEL(*inst, chan_index) { - STORE(&d[chan_index], 0, chan_index); - } + exec_vector_binary(mach, inst, micro_xor, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); break; case TGSI_OPCODE_SAD: @@ -3167,11 +3279,15 @@ exec_instruction( case TGSI_OPCODE_BGNLOOP: /* push LoopMask and ContMasks */ assert(mach->LoopStackTop < TGSI_EXEC_MAX_LOOP_NESTING); - mach->LoopStack[mach->LoopStackTop++] = mach->LoopMask; assert(mach->ContStackTop < TGSI_EXEC_MAX_LOOP_NESTING); - mach->ContStack[mach->ContStackTop++] = mach->ContMask; assert(mach->LoopLabelStackTop < TGSI_EXEC_MAX_LOOP_NESTING); + assert(mach->BreakStackTop < TGSI_EXEC_MAX_BREAK_STACK); + + mach->LoopStack[mach->LoopStackTop++] = mach->LoopMask; + mach->ContStack[mach->ContStackTop++] = mach->ContMask; mach->LoopLabelStack[mach->LoopLabelStackTop++] = *pc - 1; + mach->BreakStack[mach->BreakStackTop++] = mach->BreakType; + mach->BreakType = TGSI_EXEC_BREAK_INSIDE_LOOP; break; case TGSI_OPCODE_ENDFOR: @@ -3218,6 +3334,8 @@ exec_instruction( --mach->LoopLabelStackTop; assert(mach->LoopCounterStackTop > 0); --mach->LoopCounterStackTop; + + mach->BreakType = mach->BreakStack[--mach->BreakStackTop]; } UPDATE_EXEC_MASK(mach); break; @@ -3241,15 +3359,14 @@ exec_instruction( mach->ContMask = mach->ContStack[--mach->ContStackTop]; assert(mach->LoopLabelStackTop > 0); --mach->LoopLabelStackTop; + + mach->BreakType = mach->BreakStack[--mach->BreakStackTop]; } UPDATE_EXEC_MASK(mach); break; case TGSI_OPCODE_BRK: - /* turn off loop channels for each enabled exec channel */ - mach->LoopMask &= ~mach->ExecMask; - /* Todo: if mach->LoopMask == 0, jump to end of loop */ - UPDATE_EXEC_MASK(mach); + exec_break(mach); break; case TGSI_OPCODE_CONT: @@ -3280,6 +3397,12 @@ exec_instruction( mach->ContStackTop = mach->CallStack[mach->CallStackTop].ContStackTop; mach->ContMask = mach->ContStack[mach->ContStackTop]; + mach->SwitchStackTop = mach->CallStack[mach->CallStackTop].SwitchStackTop; + mach->Switch = mach->SwitchStack[mach->SwitchStackTop]; + + mach->BreakStackTop = mach->CallStack[mach->CallStackTop].BreakStackTop; + mach->BreakType = mach->BreakStack[mach->BreakStackTop]; + assert(mach->FuncStackTop > 0); mach->FuncMask = mach->FuncStack[--mach->FuncStackTop]; @@ -3310,11 +3433,116 @@ exec_instruction( UPDATE_EXEC_MASK(mach); break; + case TGSI_OPCODE_F2I: + exec_vector_unary(mach, inst, micro_f2i, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_FLOAT); + break; + + case TGSI_OPCODE_IDIV: + exec_vector_binary(mach, inst, micro_idiv, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_IMAX: + exec_vector_binary(mach, inst, micro_imax, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_IMIN: + exec_vector_binary(mach, inst, micro_imin, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_INEG: + exec_vector_unary(mach, inst, micro_ineg, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_ISGE: + exec_vector_binary(mach, inst, micro_isge, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_ISHR: + exec_vector_binary(mach, inst, micro_ishr, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_ISLT: + exec_vector_binary(mach, inst, micro_islt, TGSI_EXEC_DATA_INT, TGSI_EXEC_DATA_INT); + break; + + case TGSI_OPCODE_F2U: + exec_vector_unary(mach, inst, micro_f2u, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_FLOAT); + break; + + case TGSI_OPCODE_U2F: + exec_vector_unary(mach, inst, micro_u2f, TGSI_EXEC_DATA_FLOAT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UADD: + exec_vector_binary(mach, inst, micro_uadd, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UDIV: + exec_vector_binary(mach, inst, micro_udiv, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UMAD: + exec_vector_trinary(mach, inst, micro_umad, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UMAX: + exec_vector_binary(mach, inst, micro_umax, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UMIN: + exec_vector_binary(mach, inst, micro_umin, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UMOD: + exec_vector_binary(mach, inst, micro_umod, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_UMUL: + exec_vector_binary(mach, inst, micro_umul, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_USEQ: + exec_vector_binary(mach, inst, micro_useq, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_USGE: + exec_vector_binary(mach, inst, micro_usge, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_USHR: + exec_vector_binary(mach, inst, micro_ushr, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_USLT: + exec_vector_binary(mach, inst, micro_uslt, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_USNE: + exec_vector_binary(mach, inst, micro_usne, TGSI_EXEC_DATA_UINT, TGSI_EXEC_DATA_UINT); + break; + + case TGSI_OPCODE_SWITCH: + exec_switch(mach, inst); + break; + + case TGSI_OPCODE_CASE: + exec_case(mach, inst); + break; + + case TGSI_OPCODE_DEFAULT: + exec_default(mach); + break; + + case TGSI_OPCODE_ENDSWITCH: + exec_endswitch(mach); + break; + default: assert( 0 ); } } + #define DEBUG_EXECUTION 0 @@ -3334,9 +3562,13 @@ tgsi_exec_machine_run( struct tgsi_exec_machine *mach ) mach->FuncMask = 0xf; mach->ExecMask = 0xf; + mach->Switch.mask = 0xf; + assert(mach->CondStackTop == 0); assert(mach->LoopStackTop == 0); assert(mach->ContStackTop == 0); + assert(mach->SwitchStackTop == 0); + assert(mach->BreakStackTop == 0); assert(mach->CallStackTop == 0); mach->Temps[TEMP_KILMASK_I].xyzw[TEMP_KILMASK_C].u[0] = 0; @@ -3393,11 +3625,11 @@ tgsi_exec_machine_run( struct tgsi_exec_machine *mach ) if (j > 0) { debug_printf(" "); } - debug_printf("(%6f, %6f, %6f, %6f)\n", - temps[i].xyzw[0].f[j], - temps[i].xyzw[1].f[j], - temps[i].xyzw[2].f[j], - temps[i].xyzw[3].f[j]); + debug_printf("(%6f %u, %6f %u, %6f %u, %6f %u)\n", + temps[i].xyzw[0].f[j], temps[i].xyzw[0].u[j], + temps[i].xyzw[1].f[j], temps[i].xyzw[1].u[j], + temps[i].xyzw[2].f[j], temps[i].xyzw[2].u[j], + temps[i].xyzw[3].f[j], temps[i].xyzw[3].u[j]); } } } @@ -3411,11 +3643,11 @@ tgsi_exec_machine_run( struct tgsi_exec_machine *mach ) if (j > 0) { debug_printf(" "); } - debug_printf("{%6f, %6f, %6f, %6f}\n", - outputs[i].xyzw[0].f[j], - outputs[i].xyzw[1].f[j], - outputs[i].xyzw[2].f[j], - outputs[i].xyzw[3].f[j]); + debug_printf("(%6f %u, %6f %u, %6f %u, %6f %u)\n", + outputs[i].xyzw[0].f[j], outputs[i].xyzw[0].u[j], + outputs[i].xyzw[1].f[j], outputs[i].xyzw[1].u[j], + outputs[i].xyzw[2].f[j], outputs[i].xyzw[2].u[j], + outputs[i].xyzw[3].f[j], outputs[i].xyzw[3].u[j]); } } } @@ -3437,6 +3669,8 @@ tgsi_exec_machine_run( struct tgsi_exec_machine *mach ) assert(mach->CondStackTop == 0); assert(mach->LoopStackTop == 0); assert(mach->ContStackTop == 0); + assert(mach->SwitchStackTop == 0); + assert(mach->BreakStackTop == 0); assert(mach->CallStackTop == 0); return ~mach->Temps[TEMP_KILMASK_I].xyzw[TEMP_KILMASK_C].u[0]; diff --git a/src/gallium/auxiliary/tgsi/tgsi_exec.h b/src/gallium/auxiliary/tgsi/tgsi_exec.h index afaf5c39c4..59e3b445cc 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_exec.h +++ b/src/gallium/auxiliary/tgsi/tgsi_exec.h @@ -2,6 +2,7 @@ * * Copyright 2007-2008 Tungsten Graphics, Inc., Cedar Park, Texas. * All Rights Reserved. + * Copyright 2009-2010 VMware, Inc. All rights Reserved. * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the @@ -35,11 +36,13 @@ extern "C" { #endif + #define MAX_LABELS (4 * 1024) /**< basically, max instructions */ #define NUM_CHANNELS 4 /* R,G,B,A */ #define QUAD_SIZE 4 /* 4 pixel/quad */ + /** * Registers may be treated as float, signed int or unsigned int. */ @@ -69,6 +72,11 @@ struct tgsi_interp_coef float dady[NUM_CHANNELS]; }; +enum tgsi_sampler_control { + tgsi_sampler_lod_bias, + tgsi_sampler_lod_explicit +}; + /** * Information for sampling textures, which must be implemented * by code outside the TGSI executor. @@ -80,7 +88,8 @@ struct tgsi_sampler const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]); }; @@ -179,6 +188,7 @@ struct tgsi_exec_labels #define TGSI_EXEC_MAX_COND_NESTING 32 #define TGSI_EXEC_MAX_LOOP_NESTING 32 +#define TGSI_EXEC_MAX_SWITCH_NESTING 32 #define TGSI_EXEC_MAX_CALL_NESTING 32 /* The maximum number of input attributes per vertex. For 2D @@ -206,9 +216,29 @@ struct tgsi_call_record uint CondStackTop; uint LoopStackTop; uint ContStackTop; + int SwitchStackTop; + int BreakStackTop; uint ReturnAddr; }; + +/* Switch-case block state. */ +struct tgsi_switch_record { + uint mask; /**< execution mask */ + union tgsi_exec_channel selector; /**< a value case statements are compared to */ + uint defaultMask; /**< non-execute mask for default case */ +}; + + +enum tgsi_break_type { + TGSI_EXEC_BREAK_INSIDE_LOOP, + TGSI_EXEC_BREAK_INSIDE_SWITCH +}; + + +#define TGSI_EXEC_MAX_BREAK_STACK (TGSI_EXEC_MAX_LOOP_NESTING + TGSI_EXEC_MAX_SWITCH_NESTING) + + /** * Run-time virtual machine state for executing TGSI shader. */ @@ -251,6 +281,12 @@ struct tgsi_exec_machine uint FuncMask; /**< For function calls */ uint ExecMask; /**< = CondMask & LoopMask */ + /* Current switch-case state. */ + struct tgsi_switch_record Switch; + + /* Current break type. */ + enum tgsi_break_type BreakType; + /** Condition mask stack (for nested conditionals) */ uint CondStack[TGSI_EXEC_MAX_COND_NESTING]; int CondStackTop; @@ -271,6 +307,13 @@ struct tgsi_exec_machine uint ContStack[TGSI_EXEC_MAX_LOOP_NESTING]; int ContStackTop; + /** Switch case stack */ + struct tgsi_switch_record SwitchStack[TGSI_EXEC_MAX_SWITCH_NESTING]; + int SwitchStackTop; + + enum tgsi_break_type BreakStack[TGSI_EXEC_MAX_BREAK_STACK]; + int BreakStackTop; + /** Function execution mask stack (for executing subroutine code) */ uint FuncStack[TGSI_EXEC_MAX_CALL_NESTING]; int FuncStackTop; diff --git a/src/gallium/auxiliary/tgsi/tgsi_info.c b/src/gallium/auxiliary/tgsi/tgsi_info.c index be375cabb8..de0e09cdba 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_info.c +++ b/src/gallium/auxiliary/tgsi/tgsi_info.c @@ -119,7 +119,7 @@ static const struct tgsi_opcode_info opcode_info[TGSI_OPCODE_LAST] = { 1, 1, 0, 0, 0, 0, "NOT", TGSI_OPCODE_NOT }, { 1, 1, 0, 0, 0, 0, "TRUNC", TGSI_OPCODE_TRUNC }, { 1, 2, 0, 0, 0, 0, "SHL", TGSI_OPCODE_SHL }, - { 1, 2, 0, 0, 0, 0, "SHR", TGSI_OPCODE_SHR }, + { 0, 0, 0, 0, 0, 0, "", 88 }, /* removed */ { 1, 2, 0, 0, 0, 0, "AND", TGSI_OPCODE_AND }, { 1, 2, 0, 0, 0, 0, "OR", TGSI_OPCODE_OR }, { 1, 2, 0, 0, 0, 0, "MOD", TGSI_OPCODE_MOD }, @@ -149,7 +149,33 @@ static const struct tgsi_opcode_info opcode_info[TGSI_OPCODE_LAST] = { 0, 1, 0, 0, 0, 0, "BREAKC", TGSI_OPCODE_BREAKC }, { 0, 1, 0, 0, 0, 0, "KIL", TGSI_OPCODE_KIL }, { 0, 0, 0, 0, 0, 0, "END", TGSI_OPCODE_END }, - { 0, 0, 0, 0, 0, 0, "", 118 } /* removed */ + { 0, 0, 0, 0, 0, 0, "", 118 }, /* removed */ + { 1, 1, 0, 0, 0, 0, "F2I", TGSI_OPCODE_F2I }, + { 1, 2, 0, 0, 0, 0, "IDIV", TGSI_OPCODE_IDIV }, + { 1, 2, 0, 0, 0, 0, "IMAX", TGSI_OPCODE_IMAX }, + { 1, 2, 0, 0, 0, 0, "IMIN", TGSI_OPCODE_IMIN }, + { 1, 1, 0, 0, 0, 0, "INEG", TGSI_OPCODE_INEG }, + { 1, 2, 0, 0, 0, 0, "ISGE", TGSI_OPCODE_ISGE }, + { 1, 2, 0, 0, 0, 0, "ISHR", TGSI_OPCODE_ISHR }, + { 1, 2, 0, 0, 0, 0, "ISLT", TGSI_OPCODE_ISLT }, + { 1, 1, 0, 0, 0, 0, "F2U", TGSI_OPCODE_F2U }, + { 1, 1, 0, 0, 0, 0, "U2F", TGSI_OPCODE_U2F }, + { 1, 2, 0, 0, 0, 0, "UADD", TGSI_OPCODE_UADD }, + { 1, 2, 0, 0, 0, 0, "UDIV", TGSI_OPCODE_UDIV }, + { 1, 3, 0, 0, 0, 0, "UMAD", TGSI_OPCODE_UMAD }, + { 1, 2, 0, 0, 0, 0, "UMAX", TGSI_OPCODE_UMAX }, + { 1, 2, 0, 0, 0, 0, "UMIN", TGSI_OPCODE_UMIN }, + { 1, 2, 0, 0, 0, 0, "UMOD", TGSI_OPCODE_UMOD }, + { 1, 2, 0, 0, 0, 0, "UMUL", TGSI_OPCODE_UMUL }, + { 1, 2, 0, 0, 0, 0, "USEQ", TGSI_OPCODE_USEQ }, + { 1, 2, 0, 0, 0, 0, "USGE", TGSI_OPCODE_USGE }, + { 1, 2, 0, 0, 0, 0, "USHR", TGSI_OPCODE_USHR }, + { 1, 2, 0, 0, 0, 0, "USLT", TGSI_OPCODE_USLT }, + { 1, 2, 0, 0, 0, 0, "USNE", TGSI_OPCODE_USNE }, + { 0, 1, 0, 0, 0, 0, "SWITCH", TGSI_OPCODE_SWITCH }, + { 0, 1, 0, 0, 0, 0, "CASE", TGSI_OPCODE_CASE }, + { 0, 0, 0, 0, 0, 0, "DEFAULT", TGSI_OPCODE_DEFAULT }, + { 0, 0, 0, 0, 0, 0, "ENDSWITCH", TGSI_OPCODE_ENDSWITCH } }; const struct tgsi_opcode_info * diff --git a/src/gallium/auxiliary/tgsi/tgsi_opcode_tmp.h b/src/gallium/auxiliary/tgsi/tgsi_opcode_tmp.h index b34263da48..e4af15c156 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_opcode_tmp.h +++ b/src/gallium/auxiliary/tgsi/tgsi_opcode_tmp.h @@ -124,7 +124,6 @@ OP11(I2F) OP11(NOT) OP11(TRUNC) OP12(SHL) -OP12(SHR) OP12(AND) OP12(OR) OP12(MOD) @@ -146,6 +145,28 @@ OP01(IFC) OP01(BREAKC) OP01(KIL) OP00(END) +OP11(F2I) +OP12(IDIV) +OP12(IMAX) +OP12(IMIN) +OP11(INEG) +OP12(ISGE) +OP12(ISHR) +OP12(ISLT) +OP11(F2U) +OP11(U2F) +OP12(UADD) +OP12(UDIV) +OP13(UMAD) +OP12(UMAX) +OP12(UMIN) +OP12(UMOD) +OP12(UMUL) +OP12(USEQ) +OP12(USGE) +OP12(USHR) +OP12(USLT) +OP12(USNE) #undef OP00 diff --git a/src/gallium/auxiliary/tgsi/tgsi_parse.c b/src/gallium/auxiliary/tgsi/tgsi_parse.c index fa65ecb997..8c7062d850 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_parse.c +++ b/src/gallium/auxiliary/tgsi/tgsi_parse.c @@ -119,17 +119,29 @@ tgsi_parse_token( case TGSI_TOKEN_TYPE_IMMEDIATE: { struct tgsi_full_immediate *imm = &ctx->FullToken.FullImmediate; + uint imm_count; memset(imm, 0, sizeof *imm); copy_token(&imm->Immediate, &token); + imm_count = imm->Immediate.NrTokens - 1; + switch (imm->Immediate.DataType) { case TGSI_IMM_FLOAT32: - { - uint imm_count = imm->Immediate.NrTokens - 1; - for (i = 0; i < imm_count; i++) { - next_token(ctx, &imm->u[i]); - } + for (i = 0; i < imm_count; i++) { + next_token(ctx, &imm->u[i].Float); + } + break; + + case TGSI_IMM_UINT32: + for (i = 0; i < imm_count; i++) { + next_token(ctx, &imm->u[i].Uint); + } + break; + + case TGSI_IMM_INT32: + for (i = 0; i < imm_count; i++) { + next_token(ctx, &imm->u[i].Int); } break; diff --git a/src/gallium/auxiliary/tgsi/tgsi_sanity.c b/src/gallium/auxiliary/tgsi/tgsi_sanity.c index 16b8ec6051..7f1c8e5dd6 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_sanity.c +++ b/src/gallium/auxiliary/tgsi/tgsi_sanity.c @@ -195,7 +195,7 @@ is_any_register_declared( struct cso_hash_iter iter = cso_hash_first_node(ctx->regs_decl); - while (cso_hash_iter_is_null(iter)) { + while (!cso_hash_iter_is_null(iter)) { scan_register *reg = (scan_register *)cso_hash_iter_data(iter); if (reg->file == file) return TRUE; @@ -247,7 +247,7 @@ check_register_usage( boolean indirect_access ) { if (!check_file_name( ctx, reg->file )) { - free(reg); + FREE(reg); return FALSE; } @@ -261,21 +261,23 @@ check_register_usage( if (!is_ind_register_used(ctx, reg)) cso_hash_insert(ctx->regs_ind_used, reg->file, reg); else - free(reg); + FREE(reg); } else { if (!is_register_declared( ctx, reg )) { - if (reg->dimensions == 2) + if (reg->dimensions == 2) { report_error( ctx, "%s[%d][%d]: Undeclared %s register", file_names[reg->file], reg->indices[0], reg->indices[1], name ); - else + } + else { report_error( ctx, "%s[%d]: Undeclared %s register", file_names[reg->file], reg->indices[0], name ); } + } if (!is_register_used( ctx, reg )) cso_hash_insert(ctx->regs_used, scan_register_key(reg), reg); else - free(reg); + FREE(reg); } return TRUE; } @@ -333,15 +335,15 @@ iter_instruction( fill_scan_register1d(ind_reg, inst->Src[i].Indirect.File, inst->Src[i].Indirect.Index); + if (!(reg->file == TGSI_FILE_ADDRESS || reg->file == TGSI_FILE_LOOP) || + reg->indices[0] != 0) { + report_warning(ctx, "Indirect register neither ADDR[0] nor LOOP[0]"); + } check_register_usage( ctx, reg, "indirect", FALSE ); - if (!(reg->file == TGSI_FILE_ADDRESS || reg->file == TGSI_FILE_LOOP) || - reg->indices[0] != 0) { - report_warning(ctx, "Indirect register neither ADDR[0] nor LOOP[0]"); - } } } @@ -445,7 +447,9 @@ iter_immediate( /* Check data type validity. */ - if (imm->Immediate.DataType != TGSI_IMM_FLOAT32) { + if (imm->Immediate.DataType != TGSI_IMM_FLOAT32 && + imm->Immediate.DataType != TGSI_IMM_UINT32 && + imm->Immediate.DataType != TGSI_IMM_INT32) { report_error( ctx, "(%u): Invalid immediate data type", imm->Immediate.DataType ); return TRUE; } @@ -486,7 +490,7 @@ epilog( struct cso_hash_iter iter = cso_hash_first_node(ctx->regs_decl); - while (cso_hash_iter_is_null(iter)) { + while (!cso_hash_iter_is_null(iter)) { scan_register *reg = (scan_register *)cso_hash_iter_data(iter); if (!is_register_used(ctx, reg) && !is_ind_register_used(ctx, reg)) { report_warning( ctx, "%s[%u]: Register never used", @@ -511,7 +515,8 @@ regs_hash_destroy(struct cso_hash *hash) while (!cso_hash_iter_is_null(iter)) { scan_register *reg = (scan_register *)cso_hash_iter_data(iter); iter = cso_hash_erase(hash, iter); - free(reg); + assert(reg->file < TGSI_FILE_COUNT); + FREE(reg); } cso_hash_delete(hash); } diff --git a/src/gallium/auxiliary/tgsi/tgsi_sse2.c b/src/gallium/auxiliary/tgsi/tgsi_sse2.c index d63c75dafb..a85cc4659e 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_sse2.c +++ b/src/gallium/auxiliary/tgsi/tgsi_sse2.c @@ -2,6 +2,7 @@ * * Copyright 2007-2008 Tungsten Graphics, Inc., Cedar Park, Texas. * All Rights Reserved. + * Copyright 2009-2010 VMware, Inc. All rights Reserved. * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the @@ -1418,13 +1419,13 @@ fetch_texel( struct tgsi_sampler **sampler, sampler, *sampler, store ); - debug_printf("lodbias %f\n", store[12]); - for (j = 0; j < 4; j++) - debug_printf("sample %d texcoord %f %f\n", + debug_printf("sample %d texcoord %f %f %f lodbias %f\n", j, store[0+j], - store[4+j]); + store[4+j], + store[8 + j], + store[12 + j]); #endif { @@ -1433,7 +1434,8 @@ fetch_texel( struct tgsi_sampler **sampler, &store[0], /* s */ &store[4], /* t */ &store[8], /* r */ - store[12], /* lodbias */ + &store[12], /* lodbias */ + tgsi_sampler_lod_bias, rgba); /* results */ memcpy( store, rgba, 16 * sizeof(float)); @@ -2144,40 +2146,50 @@ emit_instruction( break; case TGSI_OPCODE_XPD: + /* Note: we do all stores after all operands have been fetched + * to avoid src/dst register aliasing issues for an instruction + * such as: XPD TEMP[2].xyz, TEMP[0], TEMP[2]; + */ if( IS_DST0_CHANNEL_ENABLED( *inst, CHAN_X ) || IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Y ) ) { - FETCH( func, *inst, 1, 1, CHAN_Z ); - FETCH( func, *inst, 3, 0, CHAN_Z ); + FETCH( func, *inst, 1, 1, CHAN_Z ); /* xmm[1] = src[1].z */ + FETCH( func, *inst, 3, 0, CHAN_Z ); /* xmm[3] = src[0].z */ } if( IS_DST0_CHANNEL_ENABLED( *inst, CHAN_X ) || IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Z ) ) { - FETCH( func, *inst, 0, 0, CHAN_Y ); - FETCH( func, *inst, 4, 1, CHAN_Y ); + FETCH( func, *inst, 0, 0, CHAN_Y ); /* xmm[0] = src[0].y */ + FETCH( func, *inst, 4, 1, CHAN_Y ); /* xmm[4] = src[1].y */ } IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_X ) { - emit_MOV( func, 2, 0 ); - emit_mul( func, 2, 1 ); - emit_MOV( func, 5, 3 ); - emit_mul( func, 5, 4 ); - emit_sub( func, 2, 5 ); - STORE( func, *inst, 2, 0, CHAN_X ); + emit_MOV( func, 7, 0 ); /* xmm[7] = xmm[0] */ + emit_mul( func, 7, 1 ); /* xmm[7] = xmm[2] * xmm[1] */ + emit_MOV( func, 5, 3 ); /* xmm[5] = xmm[3] */ + emit_mul( func, 5, 4 ); /* xmm[5] = xmm[5] * xmm[4] */ + emit_sub( func, 7, 5 ); /* xmm[7] = xmm[2] - xmm[5] */ + /* store xmm[7] in dst.x below */ } if( IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Y ) || IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Z ) ) { - FETCH( func, *inst, 2, 1, CHAN_X ); - FETCH( func, *inst, 5, 0, CHAN_X ); + FETCH( func, *inst, 2, 1, CHAN_X ); /* xmm[2] = src[1].x */ + FETCH( func, *inst, 5, 0, CHAN_X ); /* xmm[5] = src[0].x */ } IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Y ) { - emit_mul( func, 3, 2 ); - emit_mul( func, 1, 5 ); - emit_sub( func, 3, 1 ); - STORE( func, *inst, 3, 0, CHAN_Y ); + emit_mul( func, 3, 2 ); /* xmm[3] = xmm[3] * xmm[2] */ + emit_mul( func, 1, 5 ); /* xmm[1] = xmm[1] * xmm[5] */ + emit_sub( func, 3, 1 ); /* xmm[3] = xmm[3] - xmm[1] */ + /* store xmm[3] in dst.y below */ } IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Z ) { - emit_mul( func, 5, 4 ); - emit_mul( func, 0, 2 ); - emit_sub( func, 5, 0 ); - STORE( func, *inst, 5, 0, CHAN_Z ); + emit_mul( func, 5, 4 ); /* xmm[5] = xmm[5] * xmm[4] */ + emit_mul( func, 0, 2 ); /* xmm[0] = xmm[0] * xmm[2] */ + emit_sub( func, 5, 0 ); /* xmm[5] = xmm[5] - xmm[0] */ + STORE( func, *inst, 5, 0, CHAN_Z ); /* dst.z = xmm[5] */ + } + IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_X ) { + STORE( func, *inst, 7, 0, CHAN_X ); /* dst.x = xmm[7] */ + } + IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_Y ) { + STORE( func, *inst, 3, 0, CHAN_Y ); /* dst.y = xmm[3] */ } IF_IS_DST0_CHANNEL_ENABLED( *inst, CHAN_W ) { emit_tempf( @@ -2506,7 +2518,7 @@ emit_instruction( break; case TGSI_OPCODE_TXL: - emit_tex( func, inst, TRUE, FALSE ); + return 0; break; case TGSI_OPCODE_TXP: @@ -2578,7 +2590,7 @@ emit_instruction( return 0; break; - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: return 0; break; diff --git a/src/gallium/auxiliary/tgsi/tgsi_ureg.c b/src/gallium/auxiliary/tgsi/tgsi_ureg.c index 6a0af664dd..e64e2b731d 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_ureg.c +++ b/src/gallium/auxiliary/tgsi/tgsi_ureg.c @@ -101,8 +101,13 @@ struct ureg_program unsigned nr_outputs; struct { - float v[4]; + union { + float f[4]; + unsigned u[4]; + int i[4]; + } value; unsigned nr; + unsigned type; } immediate[UREG_MAX_IMMEDIATE]; unsigned nr_immediates; @@ -486,22 +491,22 @@ struct ureg_src ureg_DECL_sampler( struct ureg_program *ureg, } - - -static int match_or_expand_immediate( const float *v, - unsigned nr, - float *v2, - unsigned *nr2, - unsigned *swizzle ) +static int +match_or_expand_immediate( const unsigned *v, + unsigned nr, + unsigned *v2, + unsigned *pnr2, + unsigned *swizzle ) { + unsigned nr2 = *pnr2; unsigned i, j; - + *swizzle = 0; for (i = 0; i < nr; i++) { boolean found = FALSE; - for (j = 0; j < *nr2 && !found; j++) { + for (j = 0; j < nr2 && !found; j++) { if (v[i] == v2[j]) { *swizzle |= j << (i * 2); found = TRUE; @@ -509,24 +514,28 @@ static int match_or_expand_immediate( const float *v, } if (!found) { - if (*nr2 >= 4) + if (nr2 >= 4) { return FALSE; + } - v2[*nr2] = v[i]; - *swizzle |= *nr2 << (i * 2); - (*nr2)++; + v2[nr2] = v[i]; + *swizzle |= nr2 << (i * 2); + nr2++; } } + /* Actually expand immediate only when fully succeeded. + */ + *pnr2 = nr2; return TRUE; } - - -struct ureg_src ureg_DECL_immediate( struct ureg_program *ureg, - const float *v, - unsigned nr ) +static struct ureg_src +decl_immediate( struct ureg_program *ureg, + const unsigned *v, + unsigned nr, + unsigned type ) { unsigned i, j; unsigned swizzle; @@ -536,38 +545,82 @@ struct ureg_src ureg_DECL_immediate( struct ureg_program *ureg, */ for (i = 0; i < ureg->nr_immediates; i++) { - if (match_or_expand_immediate( v, - nr, - ureg->immediate[i].v, - &ureg->immediate[i].nr, - &swizzle )) + if (ureg->immediate[i].type != type) { + continue; + } + if (match_or_expand_immediate(v, + nr, + ureg->immediate[i].value.u, + &ureg->immediate[i].nr, + &swizzle)) { goto out; + } } if (ureg->nr_immediates < UREG_MAX_IMMEDIATE) { i = ureg->nr_immediates++; - if (match_or_expand_immediate( v, - nr, - ureg->immediate[i].v, - &ureg->immediate[i].nr, - &swizzle )) + ureg->immediate[i].type = type; + if (match_or_expand_immediate(v, + nr, + ureg->immediate[i].value.u, + &ureg->immediate[i].nr, + &swizzle)) { goto out; + } } - set_bad( ureg ); + set_bad(ureg); out: /* Make sure that all referenced elements are from this immediate. * Has the effect of making size-one immediates into scalars. */ - for (j = nr; j < 4; j++) + for (j = nr; j < 4; j++) { swizzle |= (swizzle & 0x3) << (j * 2); + } + + return ureg_swizzle(ureg_src_register(TGSI_FILE_IMMEDIATE, i), + (swizzle >> 0) & 0x3, + (swizzle >> 2) & 0x3, + (swizzle >> 4) & 0x3, + (swizzle >> 6) & 0x3); +} + + +struct ureg_src +ureg_DECL_immediate( struct ureg_program *ureg, + const float *v, + unsigned nr ) +{ + union { + float f[4]; + unsigned u[4]; + } fu; + unsigned int i; + + for (i = 0; i < nr; i++) { + fu.f[i] = v[i]; + } + + return decl_immediate(ureg, fu.u, nr, TGSI_IMM_FLOAT32); +} + - return ureg_swizzle( ureg_src_register( TGSI_FILE_IMMEDIATE, i ), - (swizzle >> 0) & 0x3, - (swizzle >> 2) & 0x3, - (swizzle >> 4) & 0x3, - (swizzle >> 6) & 0x3); +struct ureg_src +ureg_DECL_immediate_uint( struct ureg_program *ureg, + const unsigned *v, + unsigned nr ) +{ + return decl_immediate(ureg, v, nr, TGSI_IMM_UINT32); +} + + +struct ureg_src +ureg_DECL_immediate_int( struct ureg_program *ureg, + const int *v, + unsigned nr ) +{ + return decl_immediate(ureg, (const unsigned *)v, nr, TGSI_IMM_INT32); } @@ -955,21 +1008,23 @@ static void emit_decl_range( struct ureg_program *ureg, out[1].decl_range.Last = first + count - 1; } -static void emit_immediate( struct ureg_program *ureg, - const float *v ) +static void +emit_immediate( struct ureg_program *ureg, + const unsigned *v, + unsigned type ) { union tgsi_any_token *out = get_tokens( ureg, DOMAIN_DECL, 5 ); out[0].value = 0; out[0].imm.Type = TGSI_TOKEN_TYPE_IMMEDIATE; out[0].imm.NrTokens = 5; - out[0].imm.DataType = TGSI_IMM_FLOAT32; + out[0].imm.DataType = type; out[0].imm.Padding = 0; - out[1].imm_data.Float = v[0]; - out[2].imm_data.Float = v[1]; - out[3].imm_data.Float = v[2]; - out[4].imm_data.Float = v[3]; + out[1].imm_data.Uint = v[0]; + out[2].imm_data.Uint = v[1]; + out[3].imm_data.Uint = v[2]; + out[4].imm_data.Uint = v[3]; } @@ -1055,7 +1110,8 @@ static void emit_decls( struct ureg_program *ureg ) for (i = 0; i < ureg->nr_immediates; i++) { emit_immediate( ureg, - ureg->immediate[i].v ); + ureg->immediate[i].value.u, + ureg->immediate[i].type ); } } diff --git a/src/gallium/auxiliary/tgsi/tgsi_ureg.h b/src/gallium/auxiliary/tgsi/tgsi_ureg.h index 7e3e7bcf1d..6f11273320 100644 --- a/src/gallium/auxiliary/tgsi/tgsi_ureg.h +++ b/src/gallium/auxiliary/tgsi/tgsi_ureg.h @@ -148,6 +148,16 @@ ureg_DECL_immediate( struct ureg_program *, unsigned nr ); struct ureg_src +ureg_DECL_immediate_uint( struct ureg_program *, + const unsigned *v, + unsigned nr ); + +struct ureg_src +ureg_DECL_immediate_int( struct ureg_program *, + const int *v, + unsigned nr ); + +struct ureg_src ureg_DECL_constant( struct ureg_program *, unsigned index ); @@ -221,6 +231,90 @@ ureg_imm1f( struct ureg_program *ureg, return ureg_DECL_immediate( ureg, v, 1 ); } +static INLINE struct ureg_src +ureg_imm4u( struct ureg_program *ureg, + unsigned a, unsigned b, + unsigned c, unsigned d) +{ + unsigned v[4]; + v[0] = a; + v[1] = b; + v[2] = c; + v[3] = d; + return ureg_DECL_immediate_uint( ureg, v, 4 ); +} + +static INLINE struct ureg_src +ureg_imm3u( struct ureg_program *ureg, + unsigned a, unsigned b, + unsigned c) +{ + unsigned v[3]; + v[0] = a; + v[1] = b; + v[2] = c; + return ureg_DECL_immediate_uint( ureg, v, 3 ); +} + +static INLINE struct ureg_src +ureg_imm2u( struct ureg_program *ureg, + unsigned a, unsigned b) +{ + unsigned v[2]; + v[0] = a; + v[1] = b; + return ureg_DECL_immediate_uint( ureg, v, 2 ); +} + +static INLINE struct ureg_src +ureg_imm1u( struct ureg_program *ureg, + unsigned a) +{ + return ureg_DECL_immediate_uint( ureg, &a, 1 ); +} + +static INLINE struct ureg_src +ureg_imm4i( struct ureg_program *ureg, + int a, int b, + int c, int d) +{ + int v[4]; + v[0] = a; + v[1] = b; + v[2] = c; + v[3] = d; + return ureg_DECL_immediate_int( ureg, v, 4 ); +} + +static INLINE struct ureg_src +ureg_imm3i( struct ureg_program *ureg, + int a, int b, + int c) +{ + int v[3]; + v[0] = a; + v[1] = b; + v[2] = c; + return ureg_DECL_immediate_int( ureg, v, 3 ); +} + +static INLINE struct ureg_src +ureg_imm2i( struct ureg_program *ureg, + int a, int b) +{ + int v[2]; + v[0] = a; + v[1] = b; + return ureg_DECL_immediate_int( ureg, v, 2 ); +} + +static INLINE struct ureg_src +ureg_imm1i( struct ureg_program *ureg, + int a) +{ + return ureg_DECL_immediate_int( ureg, &a, 1 ); +} + /*********************************************************************** * Functions for patching up labels */ diff --git a/src/gallium/auxiliary/util/u_bitmask.c b/src/gallium/auxiliary/util/u_bitmask.c index 77587c07ec..23c93a3ebc 100644 --- a/src/gallium/auxiliary/util/u_bitmask.c +++ b/src/gallium/auxiliary/util/u_bitmask.c @@ -97,12 +97,12 @@ util_bitmask_resize(struct util_bitmask *bm, if(!minimum_size) return FALSE; - if(bm->size > minimum_size) + if(bm->size >= minimum_size) return TRUE; assert(bm->size % UTIL_BITMASK_BITS_PER_WORD == 0); new_size = bm->size; - while(!(new_size > minimum_size)) { + while(new_size < minimum_size) { new_size *= 2; /* Check integer overflow */ if(new_size < bm->size) @@ -136,7 +136,7 @@ util_bitmask_filled_set(struct util_bitmask *bm, unsigned index) { assert(bm->filled <= bm->size); - assert(index <= bm->size); + assert(index < bm->size); if(index == bm->filled) { ++bm->filled; @@ -149,7 +149,7 @@ util_bitmask_filled_unset(struct util_bitmask *bm, unsigned index) { assert(bm->filled <= bm->size); - assert(index <= bm->size); + assert(index < bm->size); if(index < bm->filled) bm->filled = index; @@ -182,7 +182,7 @@ util_bitmask_add(struct util_bitmask *bm) mask = 1; } found: - + /* grow the bitmask if necessary */ if(!util_bitmask_resize(bm, bm->filled)) return UTIL_BITMASK_INVALID_INDEX; @@ -198,9 +198,9 @@ unsigned util_bitmask_set(struct util_bitmask *bm, unsigned index) { - unsigned word = index / UTIL_BITMASK_BITS_PER_WORD; - unsigned bit = index % UTIL_BITMASK_BITS_PER_WORD; - util_bitmask_word mask = 1 << bit; + unsigned word; + unsigned bit; + util_bitmask_word mask; assert(bm); @@ -208,6 +208,10 @@ util_bitmask_set(struct util_bitmask *bm, if(!util_bitmask_resize(bm, index)) return UTIL_BITMASK_INVALID_INDEX; + word = index / UTIL_BITMASK_BITS_PER_WORD; + bit = index % UTIL_BITMASK_BITS_PER_WORD; + mask = 1 << bit; + bm->words[word] |= mask; util_bitmask_filled_set(bm, index); @@ -220,15 +224,19 @@ void util_bitmask_clear(struct util_bitmask *bm, unsigned index) { - unsigned word = index / UTIL_BITMASK_BITS_PER_WORD; - unsigned bit = index % UTIL_BITMASK_BITS_PER_WORD; - util_bitmask_word mask = 1 << bit; + unsigned word; + unsigned bit; + util_bitmask_word mask; assert(bm); if(index >= bm->size) return; + word = index / UTIL_BITMASK_BITS_PER_WORD; + bit = index % UTIL_BITMASK_BITS_PER_WORD; + mask = 1 << bit; + bm->words[word] &= ~mask; util_bitmask_filled_unset(bm, index); @@ -250,7 +258,7 @@ util_bitmask_get(struct util_bitmask *bm, return TRUE; } - if(index > bm->size) + if(index >= bm->size) return FALSE; if(bm->words[word] & mask) { diff --git a/src/gallium/auxiliary/util/u_blitter.c b/src/gallium/auxiliary/util/u_blitter.c index 1f794d39a1..46b4706b76 100644 --- a/src/gallium/auxiliary/util/u_blitter.c +++ b/src/gallium/auxiliary/util/u_blitter.c @@ -48,6 +48,8 @@ #include "util/u_simple_shaders.h" #include "util/u_texture.h" +#define INVALID_PTR ((void*)~0) + struct blitter_context_priv { struct blitter_context blitter; @@ -110,6 +112,11 @@ struct blitter_context *util_blitter_create(struct pipe_context *pipe) ctx->pipe = pipe; /* init state objects for them to be considered invalid */ + ctx->blitter.saved_blend_state = INVALID_PTR; + ctx->blitter.saved_dsa_state = INVALID_PTR; + ctx->blitter.saved_rs_state = INVALID_PTR; + ctx->blitter.saved_fs = INVALID_PTR; + ctx->blitter.saved_vs = INVALID_PTR; ctx->blitter.saved_fb_state.nr_cbufs = ~0; ctx->blitter.saved_num_textures = ~0; ctx->blitter.saved_num_sampler_states = ~0; @@ -156,6 +163,7 @@ struct blitter_context *util_blitter_create(struct pipe_context *pipe) rs_state.cull_mode = PIPE_WINDING_NONE; rs_state.bypass_vs_clip_and_viewport = 1; rs_state.gl_rasterization_rules = 1; + rs_state.flatshade = 1; ctx->rs_state = pipe->create_rasterizer_state(pipe, &rs_state); /* fragment shaders are created on-demand */ @@ -234,11 +242,11 @@ void util_blitter_destroy(struct blitter_context *blitter) static void blitter_check_saved_CSOs(struct blitter_context_priv *ctx) { /* make sure these CSOs have been saved */ - assert(ctx->blitter.saved_blend_state && - ctx->blitter.saved_dsa_state && - ctx->blitter.saved_rs_state && - ctx->blitter.saved_fs && - ctx->blitter.saved_vs); + assert(ctx->blitter.saved_blend_state != INVALID_PTR && + ctx->blitter.saved_dsa_state != INVALID_PTR && + ctx->blitter.saved_rs_state != INVALID_PTR && + ctx->blitter.saved_fs != INVALID_PTR && + ctx->blitter.saved_vs != INVALID_PTR); } static void blitter_restore_CSOs(struct blitter_context_priv *ctx) @@ -252,11 +260,11 @@ static void blitter_restore_CSOs(struct blitter_context_priv *ctx) pipe->bind_fs_state(pipe, ctx->blitter.saved_fs); pipe->bind_vs_state(pipe, ctx->blitter.saved_vs); - ctx->blitter.saved_blend_state = 0; - ctx->blitter.saved_dsa_state = 0; - ctx->blitter.saved_rs_state = 0; - ctx->blitter.saved_fs = 0; - ctx->blitter.saved_vs = 0; + ctx->blitter.saved_blend_state = INVALID_PTR; + ctx->blitter.saved_dsa_state = INVALID_PTR; + ctx->blitter.saved_rs_state = INVALID_PTR; + ctx->blitter.saved_fs = INVALID_PTR; + ctx->blitter.saved_vs = INVALID_PTR; /* restore the state objects which are required to be saved before copy/fill */ @@ -560,45 +568,29 @@ void util_blitter_clear(struct blitter_context *blitter, blitter_restore_CSOs(ctx); } -void util_blitter_copy(struct blitter_context *blitter, - struct pipe_surface *dst, - unsigned dstx, unsigned dsty, - struct pipe_surface *src, - unsigned srcx, unsigned srcy, - unsigned width, unsigned height, - boolean ignore_stencil) +static boolean +is_overlap(unsigned sx1, unsigned sx2, unsigned sy1, unsigned sy2, + unsigned dx1, unsigned dx2, unsigned dy1, unsigned dy2) +{ + if (sx1 >= dx2 || sx2 <= dx1 || sy1 >= dy2 || sy2 <= dy1) { + return FALSE; + } else { + return TRUE; + } +} + +static void util_blitter_do_copy(struct blitter_context *blitter, + struct pipe_surface *dst, + unsigned dstx, unsigned dsty, + struct pipe_surface *src, + unsigned srcx, unsigned srcy, + unsigned width, unsigned height, + boolean is_depth) { struct blitter_context_priv *ctx = (struct blitter_context_priv*)blitter; struct pipe_context *pipe = ctx->pipe; - struct pipe_screen *screen = pipe->screen; struct pipe_framebuffer_state fb_state; - boolean is_stencil, is_depth; - unsigned dst_tex_usage; - - /* give up if textures are not set */ - assert(dst->texture && src->texture); - if (!dst->texture || !src->texture) - return; - is_depth = util_format_get_component_bits(src->format, UTIL_FORMAT_COLORSPACE_ZS, 0) != 0; - is_stencil = util_format_get_component_bits(src->format, UTIL_FORMAT_COLORSPACE_ZS, 1) != 0; - dst_tex_usage = is_depth || is_stencil ? PIPE_TEXTURE_USAGE_DEPTH_STENCIL : - PIPE_TEXTURE_USAGE_RENDER_TARGET; - - /* check if we can sample from and render to the surfaces */ - /* (assuming copying a stencil buffer is not possible) */ - if ((!ignore_stencil && is_stencil) || - !screen->is_format_supported(screen, dst->format, dst->texture->target, - dst_tex_usage, 0) || - !screen->is_format_supported(screen, src->format, src->texture->target, - PIPE_TEXTURE_USAGE_SAMPLER, 0)) { - util_surface_copy(pipe, FALSE, dst, dstx, dsty, src, srcx, srcy, - width, height); - return; - } - - /* check whether the states are properly saved */ - blitter_check_saved_CSOs(ctx); assert(blitter->saved_fb_state.nr_cbufs != ~0); assert(blitter->saved_num_textures != ~0); assert(blitter->saved_num_sampler_states != ~0); @@ -656,6 +648,108 @@ void util_blitter_copy(struct blitter_context *blitter, blitter_set_rectangle(ctx, dstx, dsty, dstx+width, dsty+height, 0); blitter_draw_quad(ctx); + +} + +static void util_blitter_overlap_copy(struct blitter_context *blitter, + struct pipe_surface *dst, + unsigned dstx, unsigned dsty, + struct pipe_surface *src, + unsigned srcx, unsigned srcy, + unsigned width, unsigned height) +{ + struct blitter_context_priv *ctx = (struct blitter_context_priv*)blitter; + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + + struct pipe_texture texTemp; + struct pipe_texture *texture; + struct pipe_surface *tex_surf; + + /* check whether the states are properly saved */ + blitter_check_saved_CSOs(ctx); + + memset(&texTemp, 0, sizeof(texTemp)); + texTemp.target = PIPE_TEXTURE_2D; + texTemp.format = dst->texture->format; /* XXX verify supported by driver! */ + texTemp.last_level = 0; + texTemp.width0 = width; + texTemp.height0 = height; + texTemp.depth0 = 1; + + texture = screen->texture_create(screen, &texTemp); + if (!texture) + return; + + tex_surf = screen->get_tex_surface(screen, texture, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_READ | + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* blit from the src to the temp */ + util_blitter_do_copy(blitter, tex_surf, 0, 0, + src, srcx, srcy, + width, height, + FALSE); + util_blitter_do_copy(blitter, dst, dstx, dsty, + tex_surf, 0, 0, + width, height, + FALSE); + pipe_surface_reference(&tex_surf, NULL); + pipe_texture_reference(&texture, NULL); + blitter_restore_CSOs(ctx); +} + +void util_blitter_copy(struct blitter_context *blitter, + struct pipe_surface *dst, + unsigned dstx, unsigned dsty, + struct pipe_surface *src, + unsigned srcx, unsigned srcy, + unsigned width, unsigned height, + boolean ignore_stencil) +{ + struct blitter_context_priv *ctx = (struct blitter_context_priv*)blitter; + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + boolean is_stencil, is_depth; + unsigned dst_tex_usage; + + /* give up if textures are not set */ + assert(dst->texture && src->texture); + if (!dst->texture || !src->texture) + return; + + if (dst->texture == src->texture) { + if (is_overlap(srcx, srcx + width, srcy, srcy + height, + dstx, dstx + width, dsty, dsty + height)) { + util_blitter_overlap_copy(blitter, dst, dstx, dsty, src, srcx, srcy, + width, height); + return; + } + } + + is_depth = util_format_get_component_bits(src->format, UTIL_FORMAT_COLORSPACE_ZS, 0) != 0; + is_stencil = util_format_get_component_bits(src->format, UTIL_FORMAT_COLORSPACE_ZS, 1) != 0; + dst_tex_usage = is_depth || is_stencil ? PIPE_TEXTURE_USAGE_DEPTH_STENCIL : + PIPE_TEXTURE_USAGE_RENDER_TARGET; + + /* check if we can sample from and render to the surfaces */ + /* (assuming copying a stencil buffer is not possible) */ + if ((!ignore_stencil && is_stencil) || + !screen->is_format_supported(screen, dst->format, dst->texture->target, + dst_tex_usage, 0) || + !screen->is_format_supported(screen, src->format, src->texture->target, + PIPE_TEXTURE_USAGE_SAMPLER, 0)) { + util_surface_copy(pipe, FALSE, dst, dstx, dsty, src, srcx, srcy, + width, height); + return; + } + + /* check whether the states are properly saved */ + blitter_check_saved_CSOs(ctx); + util_blitter_do_copy(blitter, + dst, dstx, dsty, + src, srcx, srcy, + width, height, is_depth); blitter_restore_CSOs(ctx); } diff --git a/src/gallium/auxiliary/util/u_debug_dump.c b/src/gallium/auxiliary/util/u_debug_dump.c index 09866880ae..61624d05c0 100644 --- a/src/gallium/auxiliary/util/u_debug_dump.c +++ b/src/gallium/auxiliary/util/u_debug_dump.c @@ -255,15 +255,13 @@ DEFINE_DEBUG_DUMP_CONTINUOUS(tex_mipfilter) static const char * debug_dump_tex_filter_names[] = { "PIPE_TEX_FILTER_NEAREST", - "PIPE_TEX_FILTER_LINEAR", - "PIPE_TEX_FILTER_ANISO" + "PIPE_TEX_FILTER_LINEAR" }; static const char * debug_dump_tex_filter_short_names[] = { "nearest", - "linear", - "aniso" + "linear" }; DEFINE_DEBUG_DUMP_CONTINUOUS(tex_filter) diff --git a/src/gallium/auxiliary/util/u_debug_memory.c b/src/gallium/auxiliary/util/u_debug_memory.c index 7623cb9398..d6484f4ad5 100644 --- a/src/gallium/auxiliary/util/u_debug_memory.c +++ b/src/gallium/auxiliary/util/u_debug_memory.c @@ -297,9 +297,9 @@ debug_memory_end(unsigned long start_no) if((start_no <= hdr->no && hdr->no < last_no) || (last_no < start_no && (hdr->no < last_no || start_no <= hdr->no))) { - debug_printf("%s:%u:%s: %u bytes at %p not freed\n", + debug_printf("%s:%u:%s: %lu bytes at %p not freed\n", hdr->file, hdr->line, hdr->function, - hdr->size, ptr); + (unsigned long) hdr->size, ptr); #if DEBUG_MEMORY_STACK debug_backtrace_dump(hdr->backtrace, DEBUG_MEMORY_STACK); #endif @@ -315,8 +315,8 @@ debug_memory_end(unsigned long start_no) } if(total_size) { - debug_printf("Total of %u KB of system memory apparently leaked\n", - (total_size + 1023)/1024); + debug_printf("Total of %lu KB of system memory apparently leaked\n", + (unsigned long) (total_size + 1023)/1024); } else { debug_printf("No memory leaks detected.\n"); diff --git a/src/gallium/auxiliary/util/u_format.csv b/src/gallium/auxiliary/util/u_format.csv index 866b18ff16..9f16b42944 100644 --- a/src/gallium/auxiliary/util/u_format.csv +++ b/src/gallium/auxiliary/util/u_format.csv @@ -76,9 +76,9 @@ PIPE_FORMAT_R8G8_SNORM , array , 1, 1, sn8 , sn8 , , , xy01, PIPE_FORMAT_R8G8B8_SNORM , array , 1, 1, sn8 , sn8 , sn8 , , xyz1, rgb PIPE_FORMAT_R8G8B8A8_SNORM , array , 1, 1, sn8 , sn8 , sn8 , sn8 , xyzw, rgb PIPE_FORMAT_R8G8B8X8_SNORM , array , 1, 1, sn8 , sn8 , sn8 , sn8 , xyz1, rgb -PIPE_FORMAT_B6G5R5_SNORM , arith , 1, 1, sn5 , sn5 , sn6 , , zyx1, rgb -PIPE_FORMAT_A8B8G8R8_SNORM , arith , 1, 1, sn8 , sn8 , sn8 , sn8 , zyxw, rgb -PIPE_FORMAT_X8B8G8R8_SNORM , arith , 1, 1, sn8 , sn8 , sn8 , sn8 , zyx1, rgb +PIPE_FORMAT_B6G5R5_SNORM , arith , 1, 1, sn5 , sn5 , sn6 , , xyz1, rgb +PIPE_FORMAT_A8B8G8R8_SNORM , array , 1, 1, sn8 , sn8 , sn8 , sn8 , wzyx, rgb +PIPE_FORMAT_X8B8G8R8_SNORM , array , 1, 1, sn8 , sn8 , sn8 , sn8 , wzy1, rgb PIPE_FORMAT_R8_SSCALED , array , 1, 1, s8 , , , , x001, rgb PIPE_FORMAT_R8G8_SSCALED , array , 1, 1, s8 , s8 , , , xy01, rgb PIPE_FORMAT_R8G8B8_SSCALED , array , 1, 1, s8 , s8 , s8 , , xyz1, rgb @@ -90,14 +90,14 @@ PIPE_FORMAT_R32G32B32_FIXED , array , 1, 1, h32 , h32 , h32 , , xyz1, PIPE_FORMAT_R32G32B32A32_FIXED , array , 1, 1, h32 , h32 , h32 , h32 , xyzw, rgb PIPE_FORMAT_L8_SRGB , arith , 1, 1, u8 , , , , xxx1, srgb PIPE_FORMAT_A8L8_SRGB , arith , 1, 1, u8 , u8 , , , xxxy, srgb -PIPE_FORMAT_R8G8B8_SRGB , arith , 1, 1, u8 , u8 , u8 , , xyz1, srgb -PIPE_FORMAT_R8G8B8A8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , xyzw, srgb -PIPE_FORMAT_R8G8B8X8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , xyz1, srgb -PIPE_FORMAT_A8R8G8B8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , wxyz, srgb -PIPE_FORMAT_X8R8G8B8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , 1xyz, srgb -PIPE_FORMAT_B8G8R8A8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , zyxw, srgb -PIPE_FORMAT_B8G8R8X8_SRGB , arith , 1, 1, u8 , u8 , u8 , u8 , zyx1, srgb -PIPE_FORMAT_X8UB8UG8SR8S_NORM , arith , 1, 1, sn8 , sn8 , un8 , x8 , 1zyx, rgb +PIPE_FORMAT_R8G8B8_SRGB , array , 1, 1, u8 , u8 , u8 , , xyz1, srgb +PIPE_FORMAT_R8G8B8A8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , xyzw, srgb +PIPE_FORMAT_R8G8B8X8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , xyz1, srgb +PIPE_FORMAT_A8R8G8B8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , yzwx, srgb +PIPE_FORMAT_X8R8G8B8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , yzw1, srgb +PIPE_FORMAT_B8G8R8A8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , zyxw, srgb +PIPE_FORMAT_B8G8R8X8_SRGB , array , 1, 1, u8 , u8 , u8 , u8 , zyx1, srgb +PIPE_FORMAT_X8UB8UG8SR8S_NORM , array , 1, 1, sn8 , sn8 , un8 , x8 , wzy1, rgb PIPE_FORMAT_B6UG5SR5S_NORM , arith , 1, 1, sn5 , sn5 , un6 , , xyz1, rgb PIPE_FORMAT_DXT1_RGB , dxt , 4, 4, x64 , , , , xyz1, rgb PIPE_FORMAT_DXT1_RGBA , dxt , 4, 4, x64 , , , , xyzw, rgb diff --git a/src/gallium/auxiliary/util/u_network.c b/src/gallium/auxiliary/util/u_network.c index 9eb8f309cd..87ee0e4768 100644 --- a/src/gallium/auxiliary/util/u_network.c +++ b/src/gallium/auxiliary/util/u_network.c @@ -117,7 +117,7 @@ u_socket_connect(const char *hostname, uint16_t port) if (!host) return -1; - memcpy((char *)&sa.sin_addr,host->h_addr,host->h_length); + memcpy((char *)&sa.sin_addr,host->h_addr_list[0],host->h_length); sa.sin_family= host->h_addrtype; sa.sin_port = htons(port); diff --git a/src/gallium/auxiliary/util/u_rect.c b/src/gallium/auxiliary/util/u_rect.c index 298fbacecb..8479161c74 100644 --- a/src/gallium/auxiliary/util/u_rect.c +++ b/src/gallium/auxiliary/util/u_rect.c @@ -41,7 +41,7 @@ /** * Copy 2D rect from one place to another. * Position and sizes are in pixels. - * src_pitch may be negative to do vertical flip of pixels from source. + * src_stride may be negative to do vertical flip of pixels from source. */ void util_copy_rect(ubyte * dst, @@ -54,7 +54,7 @@ util_copy_rect(ubyte * dst, const ubyte * src, int src_stride, unsigned src_x, - int src_y) + unsigned src_y) { unsigned i; int src_stride_pos = src_stride < 0 ? -src_stride : src_stride; @@ -65,10 +65,6 @@ util_copy_rect(ubyte * dst, assert(blocksize > 0); assert(blockwidth > 0); assert(blockheight > 0); - assert(src_x >= 0); - assert(src_y >= 0); - assert(dst_x >= 0); - assert(dst_y >= 0); dst_x /= blockwidth; dst_y /= blockheight; @@ -113,8 +109,6 @@ util_fill_rect(ubyte * dst, assert(blocksize > 0); assert(blockwidth > 0); assert(blockheight > 0); - assert(dst_x >= 0); - assert(dst_y >= 0); dst_x /= blockwidth; dst_y /= blockheight; diff --git a/src/gallium/auxiliary/util/u_rect.h b/src/gallium/auxiliary/util/u_rect.h index 5e444ffae2..b44d821904 100644 --- a/src/gallium/auxiliary/util/u_rect.h +++ b/src/gallium/auxiliary/util/u_rect.h @@ -45,7 +45,7 @@ extern void util_copy_rect(ubyte * dst, enum pipe_format format, unsigned dst_stride, unsigned dst_x, unsigned dst_y, unsigned width, unsigned height, const ubyte * src, - int src_stride, unsigned src_x, int src_y); + int src_stride, unsigned src_x, unsigned src_y); extern void util_fill_rect(ubyte * dst, enum pipe_format format, diff --git a/src/gallium/auxiliary/util/u_simple_shaders.c b/src/gallium/auxiliary/util/u_simple_shaders.c index 8172ead020..b751e29ab6 100644 --- a/src/gallium/auxiliary/util/u_simple_shaders.c +++ b/src/gallium/auxiliary/util/u_simple_shaders.c @@ -44,13 +44,15 @@ /** * Make simple vertex pass-through shader. + * \param num_attribs number of attributes to pass through + * \param semantic_names array of semantic names for each attribute + * \param semantic_indexes array of semantic indexes for each attribute */ void * util_make_vertex_passthrough_shader(struct pipe_context *pipe, uint num_attribs, const uint *semantic_names, const uint *semantic_indexes) - { struct ureg_program *ureg; uint i; @@ -78,8 +80,6 @@ util_make_vertex_passthrough_shader(struct pipe_context *pipe, } - - /** * Make simple fragment texture shader: * IMM {0,0,0,1} // (if writemask != 0xf) @@ -125,6 +125,12 @@ util_make_fragment_tex_shader_writemask(struct pipe_context *pipe, return ureg_create_shader_and_destroy( ureg, pipe ); } + +/** + * Make a simple fragment shader that sets the output color to a color + * taken from a texture. + * \param tex_target one of PIPE_TEXTURE_x + */ void * util_make_fragment_tex_shader(struct pipe_context *pipe, unsigned tex_target ) { @@ -133,6 +139,7 @@ util_make_fragment_tex_shader(struct pipe_context *pipe, unsigned tex_target ) TGSI_WRITEMASK_XYZW ); } + /** * Make a simple fragment texture shader which reads an X component from * a texture and writes it as depth. @@ -177,6 +184,7 @@ util_make_fragment_tex_shader_writedepth(struct pipe_context *pipe, return ureg_create_shader_and_destroy( ureg, pipe ); } + /** * Make simple fragment color pass-through shader. */ @@ -186,15 +194,19 @@ util_make_fragment_passthrough_shader(struct pipe_context *pipe) return util_make_fragment_clonecolor_shader(pipe, 1); } + +/** + * Make a fragment shader that copies the input color to N output colors. + */ void * util_make_fragment_clonecolor_shader(struct pipe_context *pipe, int num_cbufs) { struct ureg_program *ureg; struct ureg_src src; - struct ureg_dst dst[8]; + struct ureg_dst dst[PIPE_MAX_COLOR_BUFS]; int i; - assert(num_cbufs <= 8); + assert(num_cbufs <= PIPE_MAX_COLOR_BUFS); ureg = ureg_create( TGSI_PROCESSOR_FRAGMENT ); if (ureg == NULL) diff --git a/src/gallium/auxiliary/util/u_tile.c b/src/gallium/auxiliary/util/u_tile.c index 5b8dd1abb9..1ba82bb21f 100644 --- a/src/gallium/auxiliary/util/u_tile.c +++ b/src/gallium/auxiliary/util/u_tile.c @@ -1155,27 +1155,6 @@ ycbcr_get_tile_rgba(const ushort *src, } -static void -fake_get_tile_rgba(const ushort *src, - unsigned w, unsigned h, - float *p, - unsigned dst_stride) -{ - unsigned i, j; - - for (i = 0; i < h; i++) { - float *pRow = p; - for (j = 0; j < w; j++, pRow += 4) { - pRow[0] = - pRow[1] = - pRow[2] = - pRow[3] = (i ^ j) & 1 ? 1.0f : 0.0f; - } - p += dst_stride; - } -} - - void pipe_tile_raw_to_rgba(enum pipe_format format, void *src, @@ -1258,8 +1237,10 @@ pipe_tile_raw_to_rgba(enum pipe_format format, ycbcr_get_tile_rgba((ushort *) src, w, h, dst, dst_stride, TRUE); break; default: - debug_printf("%s: unsupported format %s\n", __FUNCTION__, pf_name(format)); - fake_get_tile_rgba(src, w, h, dst, dst_stride); + util_format_read_4f(format, + dst, dst_stride * sizeof(float), + src, util_format_get_stride(format, w), + 0, 0, w, h); } } diff --git a/src/gallium/docs/Makefile b/src/gallium/docs/Makefile new file mode 100644 index 0000000000..d4a5be4192 --- /dev/null +++ b/src/gallium/docs/Makefile @@ -0,0 +1,89 @@ +# Makefile for Sphinx documentation +# + +# You can set these variables from the command line. +SPHINXOPTS = +SPHINXBUILD = sphinx-build +PAPER = +BUILDDIR = build + +# Internal variables. +PAPEROPT_a4 = -D latex_paper_size=a4 +PAPEROPT_letter = -D latex_paper_size=letter +ALLSPHINXOPTS = -d $(BUILDDIR)/doctrees $(PAPEROPT_$(PAPER)) $(SPHINXOPTS) source + +.PHONY: help clean html dirhtml pickle json htmlhelp qthelp latex changes linkcheck doctest + +help: + @echo "Please use \`make <target>' where <target> is one of" + @echo " html to make standalone HTML files" + @echo " dirhtml to make HTML files named index.html in directories" + @echo " pickle to make pickle files" + @echo " json to make JSON files" + @echo " htmlhelp to make HTML files and a HTML help project" + @echo " qthelp to make HTML files and a qthelp project" + @echo " latex to make LaTeX files, you can set PAPER=a4 or PAPER=letter" + @echo " changes to make an overview of all changed/added/deprecated items" + @echo " linkcheck to check all external links for integrity" + @echo " doctest to run all doctests embedded in the documentation (if enabled)" + +clean: + -rm -rf $(BUILDDIR)/* + +html: + $(SPHINXBUILD) -b html $(ALLSPHINXOPTS) $(BUILDDIR)/html + @echo + @echo "Build finished. The HTML pages are in $(BUILDDIR)/html." + +dirhtml: + $(SPHINXBUILD) -b dirhtml $(ALLSPHINXOPTS) $(BUILDDIR)/dirhtml + @echo + @echo "Build finished. The HTML pages are in $(BUILDDIR)/dirhtml." + +pickle: + $(SPHINXBUILD) -b pickle $(ALLSPHINXOPTS) $(BUILDDIR)/pickle + @echo + @echo "Build finished; now you can process the pickle files." + +json: + $(SPHINXBUILD) -b json $(ALLSPHINXOPTS) $(BUILDDIR)/json + @echo + @echo "Build finished; now you can process the JSON files." + +htmlhelp: + $(SPHINXBUILD) -b htmlhelp $(ALLSPHINXOPTS) $(BUILDDIR)/htmlhelp + @echo + @echo "Build finished; now you can run HTML Help Workshop with the" \ + ".hhp project file in $(BUILDDIR)/htmlhelp." + +qthelp: + $(SPHINXBUILD) -b qthelp $(ALLSPHINXOPTS) $(BUILDDIR)/qthelp + @echo + @echo "Build finished; now you can run "qcollectiongenerator" with the" \ + ".qhcp project file in $(BUILDDIR)/qthelp, like this:" + @echo "# qcollectiongenerator $(BUILDDIR)/qthelp/Gallium.qhcp" + @echo "To view the help file:" + @echo "# assistant -collectionFile $(BUILDDIR)/qthelp/Gallium.qhc" + +latex: + $(SPHINXBUILD) -b latex $(ALLSPHINXOPTS) $(BUILDDIR)/latex + @echo + @echo "Build finished; the LaTeX files are in $(BUILDDIR)/latex." + @echo "Run \`make all-pdf' or \`make all-ps' in that directory to" \ + "run these through (pdf)latex." + +changes: + $(SPHINXBUILD) -b changes $(ALLSPHINXOPTS) $(BUILDDIR)/changes + @echo + @echo "The overview file is in $(BUILDDIR)/changes." + +linkcheck: + $(SPHINXBUILD) -b linkcheck $(ALLSPHINXOPTS) $(BUILDDIR)/linkcheck + @echo + @echo "Link check complete; look for any errors in the above output " \ + "or in $(BUILDDIR)/linkcheck/output.txt." + +doctest: + $(SPHINXBUILD) -b doctest $(ALLSPHINXOPTS) $(BUILDDIR)/doctest + @echo "Testing of doctests in the sources finished, look at the " \ + "results in $(BUILDDIR)/doctest/output.txt." diff --git a/src/gallium/docs/make.bat b/src/gallium/docs/make.bat new file mode 100644 index 0000000000..6f97e0730a --- /dev/null +++ b/src/gallium/docs/make.bat @@ -0,0 +1,113 @@ +@ECHO OFF + +REM Command file for Sphinx documentation + +set SPHINXBUILD=sphinx-build +set BUILDDIR=build +set ALLSPHINXOPTS=-d %BUILDDIR%/doctrees %SPHINXOPTS% source +if NOT "%PAPER%" == "" ( + set ALLSPHINXOPTS=-D latex_paper_size=%PAPER% %ALLSPHINXOPTS% +) + +if "%1" == "" goto help + +if "%1" == "help" ( + :help + echo.Please use `make ^<target^>` where ^<target^> is one of + echo. html to make standalone HTML files + echo. dirhtml to make HTML files named index.html in directories + echo. pickle to make pickle files + echo. json to make JSON files + echo. htmlhelp to make HTML files and a HTML help project + echo. qthelp to make HTML files and a qthelp project + echo. latex to make LaTeX files, you can set PAPER=a4 or PAPER=letter + echo. changes to make an overview over all changed/added/deprecated items + echo. linkcheck to check all external links for integrity + echo. doctest to run all doctests embedded in the documentation if enabled + goto end +) + +if "%1" == "clean" ( + for /d %%i in (%BUILDDIR%\*) do rmdir /q /s %%i + del /q /s %BUILDDIR%\* + goto end +) + +if "%1" == "html" ( + %SPHINXBUILD% -b html %ALLSPHINXOPTS% %BUILDDIR%/html + echo. + echo.Build finished. The HTML pages are in %BUILDDIR%/html. + goto end +) + +if "%1" == "dirhtml" ( + %SPHINXBUILD% -b dirhtml %ALLSPHINXOPTS% %BUILDDIR%/dirhtml + echo. + echo.Build finished. The HTML pages are in %BUILDDIR%/dirhtml. + goto end +) + +if "%1" == "pickle" ( + %SPHINXBUILD% -b pickle %ALLSPHINXOPTS% %BUILDDIR%/pickle + echo. + echo.Build finished; now you can process the pickle files. + goto end +) + +if "%1" == "json" ( + %SPHINXBUILD% -b json %ALLSPHINXOPTS% %BUILDDIR%/json + echo. + echo.Build finished; now you can process the JSON files. + goto end +) + +if "%1" == "htmlhelp" ( + %SPHINXBUILD% -b htmlhelp %ALLSPHINXOPTS% %BUILDDIR%/htmlhelp + echo. + echo.Build finished; now you can run HTML Help Workshop with the ^ +.hhp project file in %BUILDDIR%/htmlhelp. + goto end +) + +if "%1" == "qthelp" ( + %SPHINXBUILD% -b qthelp %ALLSPHINXOPTS% %BUILDDIR%/qthelp + echo. + echo.Build finished; now you can run "qcollectiongenerator" with the ^ +.qhcp project file in %BUILDDIR%/qthelp, like this: + echo.^> qcollectiongenerator %BUILDDIR%\qthelp\Gallium.qhcp + echo.To view the help file: + echo.^> assistant -collectionFile %BUILDDIR%\qthelp\Gallium.ghc + goto end +) + +if "%1" == "latex" ( + %SPHINXBUILD% -b latex %ALLSPHINXOPTS% %BUILDDIR%/latex + echo. + echo.Build finished; the LaTeX files are in %BUILDDIR%/latex. + goto end +) + +if "%1" == "changes" ( + %SPHINXBUILD% -b changes %ALLSPHINXOPTS% %BUILDDIR%/changes + echo. + echo.The overview file is in %BUILDDIR%/changes. + goto end +) + +if "%1" == "linkcheck" ( + %SPHINXBUILD% -b linkcheck %ALLSPHINXOPTS% %BUILDDIR%/linkcheck + echo. + echo.Link check complete; look for any errors in the above output ^ +or in %BUILDDIR%/linkcheck/output.txt. + goto end +) + +if "%1" == "doctest" ( + %SPHINXBUILD% -b doctest %ALLSPHINXOPTS% %BUILDDIR%/doctest + echo. + echo.Testing of doctests in the sources finished, look at the ^ +results in %BUILDDIR%/doctest/output.txt. + goto end +) + +:end diff --git a/src/gallium/docs/source/conf.py b/src/gallium/docs/source/conf.py new file mode 100644 index 0000000000..9b0c86babd --- /dev/null +++ b/src/gallium/docs/source/conf.py @@ -0,0 +1,197 @@ +# -*- coding: utf-8 -*- +# +# Gallium documentation build configuration file, created by +# sphinx-quickstart on Sun Dec 20 14:09:05 2009. +# +# This file is execfile()d with the current directory set to its containing dir. +# +# Note that not all possible configuration values are present in this +# autogenerated file. +# +# All configuration values have a default; values that are commented out +# serve to show the default. + +import sys, os + +# If extensions (or modules to document with autodoc) are in another directory, +# add these directories to sys.path here. If the directory is relative to the +# documentation root, use os.path.abspath to make it absolute, like shown here. +#sys.path.append(os.path.abspath('.')) + +# -- General configuration ----------------------------------------------------- + +# Add any Sphinx extension module names here, as strings. They can be extensions +# coming with Sphinx (named 'sphinx.ext.*') or your custom ones. +extensions = ['sphinx.ext.pngmath'] + +# Add any paths that contain templates here, relative to this directory. +templates_path = ['_templates'] + +# The suffix of source filenames. +source_suffix = '.rst' + +# The encoding of source files. +#source_encoding = 'utf-8' + +# The master toctree document. +master_doc = 'index' + +# General information about the project. +project = u'Gallium' +copyright = u'2009, VMWare, X.org, Nouveau' + +# The version info for the project you're documenting, acts as replacement for +# |version| and |release|, also used in various other places throughout the +# built documents. +# +# The short X.Y version. +version = '0.3' +# The full version, including alpha/beta/rc tags. +release = '0.3' + +# The language for content autogenerated by Sphinx. Refer to documentation +# for a list of supported languages. +#language = None + +# There are two options for replacing |today|: either, you set today to some +# non-false value, then it is used: +#today = '' +# Else, today_fmt is used as the format for a strftime call. +#today_fmt = '%B %d, %Y' + +# List of documents that shouldn't be included in the build. +#unused_docs = [] + +# List of directories, relative to source directory, that shouldn't be searched +# for source files. +exclude_trees = [] + +# The reST default role (used for this markup: `text`) to use for all documents. +#default_role = None + +# If true, '()' will be appended to :func: etc. cross-reference text. +#add_function_parentheses = True + +# If true, the current module name will be prepended to all description +# unit titles (such as .. function::). +#add_module_names = True + +# If true, sectionauthor and moduleauthor directives will be shown in the +# output. They are ignored by default. +#show_authors = False + +# The name of the Pygments (syntax highlighting) style to use. +pygments_style = 'sphinx' + +# The language for highlighting source code. +highlight_language = 'c' + +# A list of ignored prefixes for module index sorting. +#modindex_common_prefix = [] + + +# -- Options for HTML output --------------------------------------------------- + +# The theme to use for HTML and HTML Help pages. Major themes that come with +# Sphinx are currently 'default' and 'sphinxdoc'. +html_theme = 'default' + +# Theme options are theme-specific and customize the look and feel of a theme +# further. For a list of options available for each theme, see the +# documentation. +#html_theme_options = {} + +# Add any paths that contain custom themes here, relative to this directory. +#html_theme_path = [] + +# The name for this set of Sphinx documents. If None, it defaults to +# "<project> v<release> documentation". +#html_title = None + +# A shorter title for the navigation bar. Default is the same as html_title. +#html_short_title = None + +# The name of an image file (relative to this directory) to place at the top +# of the sidebar. +#html_logo = None + +# The name of an image file (within the static path) to use as favicon of the +# docs. This file should be a Windows icon file (.ico) being 16x16 or 32x32 +# pixels large. +#html_favicon = None + +# Add any paths that contain custom static files (such as style sheets) here, +# relative to this directory. They are copied after the builtin static files, +# so a file named "default.css" will overwrite the builtin "default.css". +html_static_path = ['_static'] + +# If not '', a 'Last updated on:' timestamp is inserted at every page bottom, +# using the given strftime format. +#html_last_updated_fmt = '%b %d, %Y' + +# If true, SmartyPants will be used to convert quotes and dashes to +# typographically correct entities. +#html_use_smartypants = True + +# Custom sidebar templates, maps document names to template names. +#html_sidebars = {} + +# Additional templates that should be rendered to pages, maps page names to +# template names. +#html_additional_pages = {} + +# If false, no module index is generated. +#html_use_modindex = True + +# If false, no index is generated. +#html_use_index = True + +# If true, the index is split into individual pages for each letter. +#html_split_index = False + +# If true, links to the reST sources are added to the pages. +#html_show_sourcelink = True + +# If true, an OpenSearch description file will be output, and all pages will +# contain a <link> tag referring to it. The value of this option must be the +# base URL from which the finished HTML is served. +#html_use_opensearch = '' + +# If nonempty, this is the file name suffix for HTML files (e.g. ".xhtml"). +#html_file_suffix = '' + +# Output file base name for HTML help builder. +htmlhelp_basename = 'Galliumdoc' + + +# -- Options for LaTeX output -------------------------------------------------- + +# The paper size ('letter' or 'a4'). +#latex_paper_size = 'letter' + +# The font size ('10pt', '11pt' or '12pt'). +#latex_font_size = '10pt' + +# Grouping the document tree into LaTeX files. List of tuples +# (source start file, target name, title, author, documentclass [howto/manual]). +latex_documents = [ + ('index', 'Gallium.tex', u'Gallium Documentation', + u'VMWare, X.org, Nouveau', 'manual'), +] + +# The name of an image file (relative to this directory) to place at the top of +# the title page. +#latex_logo = None + +# For "manual" documents, if this is true, then toplevel headings are parts, +# not chapters. +#latex_use_parts = False + +# Additional stuff for the LaTeX preamble. +#latex_preamble = '' + +# Documents to append as an appendix to all manuals. +#latex_appendices = [] + +# If false, no module index is generated. +#latex_use_modindex = True diff --git a/src/gallium/docs/source/context.rst b/src/gallium/docs/source/context.rst new file mode 100644 index 0000000000..21f5f9111a --- /dev/null +++ b/src/gallium/docs/source/context.rst @@ -0,0 +1,128 @@ +Context +======= + +The context object represents the purest, most directly accessible, abilities +of the device's 3D rendering pipeline. + +Methods +------- + +CSO State +^^^^^^^^^ + +All CSO state is created, bound, and destroyed, with triplets of methods that +all follow a specific naming scheme. For example, ``create_blend_state``, +``bind_blend_state``, and ``destroy_blend_state``. + +CSO objects handled by the context object: + +* :ref:`Blend`: ``*_blend_state`` +* :ref:`Sampler`: These are special; they can be bound to either vertex or + fragment samplers, and they are bound in groups. + ``bind_fragment_sampler_states``, ``bind_vertex_sampler_states`` +* :ref:`Rasterizer`: ``*_rasterizer_state`` +* :ref:`Depth, Stencil, & Alpha`: ``*_depth_stencil_alpha_state`` +* :ref:`Shader`: These have two sets of methods. ``*_fs_state`` is for + fragment shaders, and ``*_vs_state`` is for vertex shaders. + + +Resource Binding State +^^^^^^^^^^^^^^^^^^^^^^ + +This state describes how resources in various flavours (textures, +buffers, surfaces) are bound to the driver. + + +* ``set_constant_buffer`` +* ``set_framebuffer_state`` +* ``set_fragment_sampler_textures`` +* ``set_vertex_sampler_textures`` +* ``set_vertex_buffers`` + + +Non-CSO State +^^^^^^^^^^^^^ + +These pieces of state are too small, variable, and/or trivial to have CSO +objects. They all follow simple, one-method binding calls, e.g. +``set_edgeflags``. + +* ``set_edgeflags`` +* ``set_blend_color`` +* ``set_clip_state`` +* ``set_polygon_stipple`` +* ``set_scissor_state`` +* ``set_viewport_state`` +* ``set_vertex_elements`` + + +Clearing +^^^^^^^^ + +``clear`` initializes some or all of the surfaces currently bound to +the framebuffer to particular RGBA, depth, or stencil values. + +Clear is one of the most difficult concepts to nail down to a single +interface and it seems likely that we will want to add additional +clear paths, for instance clearing surfaces not bound to the +framebuffer, or read-modify-write clears such as depth-only or +stencil-only clears of packed depth-stencil buffers. + + +Drawing +^^^^^^^ + +``draw_arrays`` + +``draw_elements`` + +``draw_range_elements`` + + +Queries +^^^^^^^ + +Queries gather some statistic from the 3D pipeline over one or more +draws. Queries may be nested, though no state tracker currently +exercises this. + +Queries can be created with ``create_query`` and deleted with +``destroy_query``. To enable a query, use ``begin_query``, and when finished, +use ``end_query`` to stop the query. Finally, ``get_query_result`` is used +to retrieve the results. + +Flushing +^^^^^^^^ + +``flush`` + + +Resource Busy Queries +^^^^^^^^^^^^^^^^^^^^^ + +``is_texture_referenced`` + +``is_buffer_referenced`` + + + +Blitting +^^^^^^^^ + +These methods emulate classic blitter controls. They are not guaranteed to be +available; if they are set to NULL, then they are not present. + +These methods operate directly on ``pipe_surface`` objects, and stand +apart from any 3D state in the context. Blitting functionality may be +moved to a separate abstraction at some point in the future. + +``surface_fill`` performs a fill operation on a section of a surface. + +``surface_copy`` blits a region of a surface to a region of another surface, +provided that both surfaces are the same format. The source and destination +may be the same surface, and overlapping blits are permitted. + +The interfaces to these calls are likely to change to make it easier +for a driver to batch multiple blits with the same source and +destination. + diff --git a/src/gallium/docs/source/cso.rst b/src/gallium/docs/source/cso.rst new file mode 100644 index 0000000000..dab1ee50f3 --- /dev/null +++ b/src/gallium/docs/source/cso.rst @@ -0,0 +1,14 @@ +CSO +=== + +CSO, Constant State Objects, are a core part of Gallium's API. + +CSO work on the principle of reusable state; they are created by filling +out a state object with the desired properties, then passing that object +to a context. The context returns an opaque context-specific handle which +can be bound at any time for the desired effect. + +.. toctree:: + :glob: + + cso/* diff --git a/src/gallium/docs/source/cso/blend.rst b/src/gallium/docs/source/cso/blend.rst new file mode 100644 index 0000000000..fd9e4a1e2d --- /dev/null +++ b/src/gallium/docs/source/cso/blend.rst @@ -0,0 +1,14 @@ +.. _blend: + +Blend +===== + +This state controls blending of the final fragments into the target rendering +buffers. + +XXX it is unresolved what behavior should result if blend_enable is off. + +Members +------- + +XXX undocumented members diff --git a/src/gallium/docs/source/cso/dsa.rst b/src/gallium/docs/source/cso/dsa.rst new file mode 100644 index 0000000000..12abaa9d6f --- /dev/null +++ b/src/gallium/docs/source/cso/dsa.rst @@ -0,0 +1,58 @@ +.. _depth,stencil,&alpha: + +Depth, Stencil, & Alpha +======================= + +These three states control the depth, stencil, and alpha tests, used to +discard fragments that have passed through the fragment shader. + +Traditionally, these three tests have been clumped together in hardware, so +they are all stored in one structure. + +During actual execution, the order of operations done on fragments is always: + +* Stencil +* Depth +* Alpha + +Depth Members +------------- + +enabled + Whether the depth test is enabled. +writemask + Whether the depth buffer receives depth writes. +func + The depth test function. One of PIPE_FUNC. + +Stencil Members +--------------- + +XXX document valuemask, writemask + +enabled + Whether the stencil test is enabled. For the second stencil, whether the + two-sided stencil is enabled. +func + The stencil test function. One of PIPE_FUNC. +ref_value + Stencil test reference value; used for certain functions. +fail_op + The operation to carry out if the stencil test fails. One of + PIPE_STENCIL_OP. +zfail_op + The operation to carry out if the stencil test passes but the depth test + fails. One of PIPE_STENCIL_OP. +zpass_op + The operation to carry out if the stencil test and depth test both pass. + One of PIPE_STENCIL_OP. + +Alpha Members +------------- + +enabled + Whether the alpha test is enabled. +func + The alpha test function. One of PIPE_FUNC. +ref_value + Alpha test reference value; used for certain functions. diff --git a/src/gallium/docs/source/cso/rasterizer.rst b/src/gallium/docs/source/cso/rasterizer.rst new file mode 100644 index 0000000000..4d8e1708e7 --- /dev/null +++ b/src/gallium/docs/source/cso/rasterizer.rst @@ -0,0 +1,152 @@ +.. _rasterizer: + +Rasterizer +========== + +The rasterizer state controls the rendering of points, lines and triangles. +Attributes include polygon culling state, line width, line stipple, +multisample state, scissoring and flat/smooth shading. + + +Members +------- + +flatshade + If set, the provoking vertex of each polygon is used to determine the + color of the entire polygon. If not set, fragment colors will be + interpolated between the vertex colors. + Note that this is separate from the fragment shader input attributes + CONSTANT, LINEAR and PERSPECTIVE. We need the flatshade state at + clipping time to determine how to set the color of new vertices. + Also note that the draw module can implement flat shading by copying + the provoking vertex color to all the other vertices in the primitive. + +flatshade_first + Whether the first vertex should be the provoking vertex, for most + primitives. If not set, the last vertex is the provoking vertex. + +light_twoside + If set, there are per-vertex back-facing colors. The draw module + uses this state along with the front/back information to set the + final vertex colors prior to rasterization. + +front_winding + Indicates the window order of front-facing polygons, either + PIPE_WINDING_CW or PIPE_WINDING_CCW +cull_mode + Indicates which polygons to cull, either PIPE_WINDING_NONE (cull no + polygons), PIPE_WINDING_CW (cull clockwise-winding polygons), + PIPE_WINDING_CCW (cull counter clockwise-winding polygons), or + PIPE_WINDING_BOTH (cull all polygons). + +fill_cw + Indicates how to fill clockwise polygons, either PIPE_POLYGON_MODE_FILL, + PIPE_POLYGON_MODE_LINE or PIPE_POLYGON_MODE_POINT. +fill_ccw + Indicates how to fill counter clockwise polygons, either + PIPE_POLYGON_MODE_FILL, PIPE_POLYGON_MODE_LINE or PIPE_POLYGON_MODE_POINT. + +poly_stipple_enable + Whether polygon stippling is enabled. +poly_smooth + Controls OpenGL-style polygon smoothing/antialiasing +offset_cw + If set, clockwise polygons will have polygon offset factors applied +offset_ccw + If set, counter clockwise polygons will have polygon offset factors applied +offset_units + Specifies the polygon offset bias +offset_scale + Specifies the polygon offset scale + +line_width + The width of lines. +line_smooth + Whether lines should be smoothed. Line smoothing is simply anti-aliasing. +line_stipple_enable + Whether line stippling is enabled. +line_stipple_pattern + 16-bit bitfield of on/off flags, used to pattern the line stipple. +line_stipple_factor + When drawinga stippled line, each bit in the stipple pattern is + repeated N times, where N = line_stipple_factor + 1. +line_last_pixel + Controls whether the last pixel in a line is drawn or not. OpenGL + omits the last pixel to avoid double-drawing pixels at the ends of lines + when drawing connected lines. + +point_smooth + Whether points should be smoothed. Point smoothing turns rectangular + points into circles or ovals. +point_size_per_vertex + Whether vertices have a point size element. +point_size + The size of points, if not specified per-vertex. +point_size_min + The minimum size of points. +point_size_max + The maximum size of points. +point_sprite + Whether points are drawn as sprites (textured quads) +sprite_coord_mode + Specifies how the value for each shader output should be computed when + drawing sprites. If PIPE_SPRITE_COORD_NONE, don't change the vertex + shader output. Otherwise, the four vertices of the resulting quad will + be assigned texture coordinates. For PIPE_SPRITE_COORD_LOWER_LEFT, the + lower left vertex will have coordinate (0,0,0,1). + For PIPE_SPRITE_COORD_UPPER_LEFT, the upper-left vertex will have + coordinate (0,0,0,1). + This state is needed by the 'draw' module because that's where each + point vertex is converted into four quad vertices. There's no other + place to emit the new vertex texture coordinates which are required for + sprite rendering. + Note that when geometry shaders are available, this state could be + removed. A special geometry shader defined by the state tracker could + converts the incoming points into quads with the proper texture coords. + +scissor + Whether the scissor test is enabled. + +multisample + Whether :ref:`MSAA` is enabled. + +bypass_vs_clip_and_viewport + Whether the entire TCL pipeline should be bypassed. This implies that + vertices are pre-transformed for the viewport, and will not be run + through the vertex shader. Note that implementations may still clip away + vertices that are not in the viewport. + +gl_rasterization_rules + Whether the rasterizer should use (0.5, 0.5) pixel centers. When not set, + the rasterizer will use (0, 0) for pixel centers. + + +Notes +----- + +flatshade +^^^^^^^^^ + +The actual interpolated shading algorithm is obviously +implementation-dependent, but will usually be Gourard for most hardware. + +bypass_vs_clip_and_viewport +^^^^^^^^^^^^^^^^^^^^^^^^^^^ + +When set, this implies that vertices are pre-transformed for the viewport, and +will not be run through the vertex shader. Note that implementations may still +clip away vertices that are not visible. + +flatshade_first +^^^^^^^^^^^^^^^ + +There are several important exceptions to the specification of this rule. + +* ``PIPE_PRIMITIVE_POLYGON``: The provoking vertex is always the first + vertex. If the caller wishes to change the provoking vertex, they merely + need to rotate the vertices themselves. +* ``PIPE_PRIMITIVE_QUAD``, ``PIPE_PRIMITIVE_QUAD_STRIP``: This option has no + effect; the provoking vertex is always the last vertex. +* ``PIPE_PRIMITIVE_TRIANGLE_FAN``: When set, the provoking vertex is the + second vertex, not the first. This permits each segment of the fan to have + a different color. diff --git a/src/gallium/docs/source/cso/sampler.rst b/src/gallium/docs/source/cso/sampler.rst new file mode 100644 index 0000000000..e3f1757f57 --- /dev/null +++ b/src/gallium/docs/source/cso/sampler.rst @@ -0,0 +1,46 @@ +.. _sampler: + +Sampler +======= + +Texture units have many options for selecting texels from loaded textures; +this state controls an individual texture unit's texel-sampling settings. + +Texture coordinates are always treated as four-dimensional, and referred to +with the traditional (S, T, R, Q) notation. + +Members +------- + +XXX undocumented compare_mode, compare_func + +wrap_s + How to wrap the S coordinate. One of PIPE_TEX_WRAP. +wrap_t + How to wrap the T coordinate. One of PIPE_TEX_WRAP. +wrap_r + How to wrap the R coordinate. One of PIPE_TEX_WRAP. +min_img_filter + The filter to use when minifying texels. One of PIPE_TEX_FILTER. +min_mip_filter + The filter to use when minifying mipmapped textures. One of + PIPE_TEX_FILTER. +mag_img_filter + The filter to use when magnifying texels. One of PIPE_TEX_FILTER. +normalized_coords + Whether the texture coordinates are normalized. If normalized, they will + always be in [0, 1]. If not, they will be in the range of each dimension + of the loaded texture. +prefilter + XXX From the Doxy, "weird sampling state exposed by some APIs." Refine. +lod_bias + The bias to apply to the level of detail. +min_lod + Minimum level of detail, used to clamp LoD after bias. +max_lod + Maximum level of detail, used to clamp LoD after bias. +border_color + RGBA color used for out-of-bounds coordinates. +max_anisotropy + Maximum filtering to apply anisotropically to textures. Setting this to + 1.0 effectively disables anisotropic filtering. diff --git a/src/gallium/docs/source/cso/shader.rst b/src/gallium/docs/source/cso/shader.rst new file mode 100644 index 0000000000..0ee42c8787 --- /dev/null +++ b/src/gallium/docs/source/cso/shader.rst @@ -0,0 +1,12 @@ +.. _shader: + +Shader +====== + +One of the two types of shaders supported by Gallium. + +Members +------- + +tokens + A list of tgsi_tokens. diff --git a/src/gallium/docs/source/distro.rst b/src/gallium/docs/source/distro.rst new file mode 100644 index 0000000000..33e846e33d --- /dev/null +++ b/src/gallium/docs/source/distro.rst @@ -0,0 +1,141 @@ +Distribution +============ + +Along with the interface definitions, the following drivers, state trackers, +and auxiliary modules are shipped in the standard Gallium distribution. + +Drivers +------- + +Cell +^^^^ + +Failover +^^^^^^^^ + +Deprecated. + +Intel i915 +^^^^^^^^^^ + +Intel i965 +^^^^^^^^^^ + +Highly experimental. + +Identity +^^^^^^^^ + +Wrapper driver. + +LLVM Softpipe +^^^^^^^^^^^^^ + +nVidia nv04 +^^^^^^^^^^^ + +Deprecated. + +nVidia nv10 +^^^^^^^^^^^ + +Deprecated. + +nVidia nv20 +^^^^^^^^^^^ + +Deprecated. + +nVidia nv30 +^^^^^^^^^^^ + +nVidia nv40 +^^^^^^^^^^^ + +nVidia nv50 +^^^^^^^^^^^ + +VMWare SVGA +^^^^^^^^^^^ + +ATI r300 +^^^^^^^^ + +AMD/ATI r600 +^^^^^^^^^^^^ + +Highly experimental. + +Softpipe +^^^^^^^^ + +Reference software rasterizer. + +Trace +^^^^^ + +Wrapper driver. + +State Trackers +-------------- + +Direct Rendering Infrastructure +^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ + +EGL +^^^ + +GLX +^^^ + +MesaGL +^^^^^^ + +Python +^^^^^^ + +OpenVG +^^^^^^ + +WGL +^^^ + +Xorg XFree86 DDX +^^^^^^^^^^^^^^^^ + +Auxiliary +--------- + +CSO Cache +^^^^^^^^^ + +Draw +^^^^ + +Gallivm +^^^^^^^ + +Indices +^^^^^^^ + +Pipe Buffer Manager +^^^^^^^^^^^^^^^^^^^ + +Remote Debugger +^^^^^^^^^^^^^^^ + +Runtime Assembly Emission +^^^^^^^^^^^^^^^^^^^^^^^^^ + +Surface Context Tracker +^^^^^^^^^^^^^^^^^^^^^^^ + +TGSI +^^^^ + +Translate +^^^^^^^^^ + +Util +^^^^ + diff --git a/src/gallium/docs/source/glossary.rst b/src/gallium/docs/source/glossary.rst new file mode 100644 index 0000000000..6a9110ce78 --- /dev/null +++ b/src/gallium/docs/source/glossary.rst @@ -0,0 +1,10 @@ +Glossary +======== + +.. glossary:: + :sorted: + + MSAA + Multi-Sampled Anti-Aliasing. A basic anti-aliasing technique that takes + multiple samples of the depth buffer, and uses this information to + smooth the edges of polygons. diff --git a/src/gallium/docs/source/index.rst b/src/gallium/docs/source/index.rst new file mode 100644 index 0000000000..54bc883fce --- /dev/null +++ b/src/gallium/docs/source/index.rst @@ -0,0 +1,28 @@ +.. Gallium documentation master file, created by + sphinx-quickstart on Sun Dec 20 14:09:05 2009. + You can adapt this file completely to your liking, but it should at least + contain the root `toctree` directive. + +Welcome to Gallium's documentation! +=================================== + +Contents: + +.. toctree:: + :maxdepth: 2 + + intro + tgsi + screen + context + cso + distro + glossary + +Indices and tables +================== + +* :ref:`genindex` +* :ref:`modindex` +* :ref:`search` + diff --git a/src/gallium/docs/source/intro.rst b/src/gallium/docs/source/intro.rst new file mode 100644 index 0000000000..1ea103840a --- /dev/null +++ b/src/gallium/docs/source/intro.rst @@ -0,0 +1,9 @@ +Introduction +============ + +What is Gallium? +---------------- + +Gallium is essentially an API for writing graphics drivers in a largely +device-agnostic fashion. It provides several objects which encapsulate the +core services of graphics hardware in a straightforward manner. diff --git a/src/gallium/docs/source/screen.rst b/src/gallium/docs/source/screen.rst new file mode 100644 index 0000000000..9631e6967e --- /dev/null +++ b/src/gallium/docs/source/screen.rst @@ -0,0 +1,39 @@ +Screen +====== + +A screen is an object representing the context-independent part of a device. + +Methods +------- + +XXX moar; got bored + +get_name +^^^^^^^^ + +Returns an identifying name for the screen. + +get_vendor +^^^^^^^^^^ + +Returns the screen vendor. + +get_param +^^^^^^^^^ + +Get an integer/boolean screen parameter. + +get_paramf +^^^^^^^^^^ + +Get a floating-point screen parameter. + +is_format_supported +^^^^^^^^^^^^^^^^^^^ + +See if a format can be used in a specific manner. + +texture_create +^^^^^^^^^^^^^^ + +Given a template of texture setup, create a BO-backed texture. diff --git a/src/gallium/docs/source/tgsi.rst b/src/gallium/docs/source/tgsi.rst new file mode 100644 index 0000000000..ebee4902b0 --- /dev/null +++ b/src/gallium/docs/source/tgsi.rst @@ -0,0 +1,1270 @@ +TGSI +==== + +TGSI, Tungsten Graphics Shader Infrastructure, is an intermediate language +for describing shaders. Since Gallium is inherently shaderful, shaders are +an important part of the API. TGSI is the only intermediate representation +used by all drivers. + +Instruction Set +--------------- + +From GL_NV_vertex_program +^^^^^^^^^^^^^^^^^^^^^^^^^ + + +ARL - Address Register Load + +.. math:: + + dst.x = \lfloor src.x\rfloor + + dst.y = \lfloor src.y\rfloor + + dst.z = \lfloor src.z\rfloor + + dst.w = \lfloor src.w\rfloor + + +MOV - Move + +.. math:: + + dst.x = src.x + + dst.y = src.y + + dst.z = src.z + + dst.w = src.w + + +LIT - Light Coefficients + +.. math:: + + dst.x = 1 + + dst.y = max(src.x, 0) + + dst.z = (src.x > 0) ? max(src.y, 0)^{clamp(src.w, -128, 128))} : 0 + + dst.w = 1 + + +RCP - Reciprocal + +.. math:: + + dst.x = \frac{1}{src.x} + + dst.y = \frac{1}{src.x} + + dst.z = \frac{1}{src.x} + + dst.w = \frac{1}{src.x} + + +RSQ - Reciprocal Square Root + +.. math:: + + dst.x = \frac{1}{\sqrt{|src.x|}} + + dst.y = \frac{1}{\sqrt{|src.x|}} + + dst.z = \frac{1}{\sqrt{|src.x|}} + + dst.w = \frac{1}{\sqrt{|src.x|}} + + +EXP - Approximate Exponential Base 2 + +.. math:: + + dst.x = 2^{\lfloor src.x\rfloor} + + dst.y = src.x - \lfloor src.x\rfloor + + dst.z = 2^{src.x} + + dst.w = 1 + + +LOG - Approximate Logarithm Base 2 + +.. math:: + + dst.x = \lfloor\log_2{|src.x|}\rfloor + + dst.y = \frac{|src.x|}{2^{\lfloor\log_2{|src.x|}\rfloor}} + + dst.z = \log_2{|src.x|} + + dst.w = 1 + + +MUL - Multiply + +.. math:: + + dst.x = src0.x \times src1.x + + dst.y = src0.y \times src1.y + + dst.z = src0.z \times src1.z + + dst.w = src0.w \times src1.w + + +ADD - Add + +.. math:: + + dst.x = src0.x + src1.x + + dst.y = src0.y + src1.y + + dst.z = src0.z + src1.z + + dst.w = src0.w + src1.w + + +DP3 - 3-component Dot Product + +.. math:: + + dst.x = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + + dst.y = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + + dst.z = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + + dst.w = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + + +DP4 - 4-component Dot Product + +.. math:: + + dst.x = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src0.w \times src1.w + + dst.y = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src0.w \times src1.w + + dst.z = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src0.w \times src1.w + + dst.w = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src0.w \times src1.w + + +DST - Distance Vector + +.. math:: + + dst.x = 1 + + dst.y = src0.y \times src1.y + + dst.z = src0.z + + dst.w = src1.w + + +MIN - Minimum + +.. math:: + + dst.x = min(src0.x, src1.x) + + dst.y = min(src0.y, src1.y) + + dst.z = min(src0.z, src1.z) + + dst.w = min(src0.w, src1.w) + + +MAX - Maximum + +.. math:: + + dst.x = max(src0.x, src1.x) + + dst.y = max(src0.y, src1.y) + + dst.z = max(src0.z, src1.z) + + dst.w = max(src0.w, src1.w) + + +SLT - Set On Less Than + +.. math:: + + dst.x = (src0.x < src1.x) ? 1 : 0 + + dst.y = (src0.y < src1.y) ? 1 : 0 + + dst.z = (src0.z < src1.z) ? 1 : 0 + + dst.w = (src0.w < src1.w) ? 1 : 0 + + +SGE - Set On Greater Equal Than + +.. math:: + + dst.x = (src0.x >= src1.x) ? 1 : 0 + + dst.y = (src0.y >= src1.y) ? 1 : 0 + + dst.z = (src0.z >= src1.z) ? 1 : 0 + + dst.w = (src0.w >= src1.w) ? 1 : 0 + + +MAD - Multiply And Add + +.. math:: + + dst.x = src0.x \times src1.x + src2.x + + dst.y = src0.y \times src1.y + src2.y + + dst.z = src0.z \times src1.z + src2.z + + dst.w = src0.w \times src1.w + src2.w + + +SUB - Subtract + +.. math:: + + dst.x = src0.x - src1.x + + dst.y = src0.y - src1.y + + dst.z = src0.z - src1.z + + dst.w = src0.w - src1.w + + +LRP - Linear Interpolate + +.. math:: + + dst.x = src0.x \times src1.x + (1 - src0.x) \times src2.x + + dst.y = src0.y \times src1.y + (1 - src0.y) \times src2.y + + dst.z = src0.z \times src1.z + (1 - src0.z) \times src2.z + + dst.w = src0.w \times src1.w + (1 - src0.w) \times src2.w + + +CND - Condition + +.. math:: + + dst.x = (src2.x > 0.5) ? src0.x : src1.x + + dst.y = (src2.y > 0.5) ? src0.y : src1.y + + dst.z = (src2.z > 0.5) ? src0.z : src1.z + + dst.w = (src2.w > 0.5) ? src0.w : src1.w + + +DP2A - 2-component Dot Product And Add + +.. math:: + + dst.x = src0.x \times src1.x + src0.y \times src1.y + src2.x + + dst.y = src0.x \times src1.x + src0.y \times src1.y + src2.x + + dst.z = src0.x \times src1.x + src0.y \times src1.y + src2.x + + dst.w = src0.x \times src1.x + src0.y \times src1.y + src2.x + + +FRAC - Fraction + +.. math:: + + dst.x = src.x - \lfloor src.x\rfloor + + dst.y = src.y - \lfloor src.y\rfloor + + dst.z = src.z - \lfloor src.z\rfloor + + dst.w = src.w - \lfloor src.w\rfloor + + +CLAMP - Clamp + +.. math:: + + dst.x = clamp(src0.x, src1.x, src2.x) + + dst.y = clamp(src0.y, src1.y, src2.y) + + dst.z = clamp(src0.z, src1.z, src2.z) + + dst.w = clamp(src0.w, src1.w, src2.w) + + +FLR - Floor + +This is identical to ARL. + +.. math:: + + dst.x = \lfloor src.x\rfloor + + dst.y = \lfloor src.y\rfloor + + dst.z = \lfloor src.z\rfloor + + dst.w = \lfloor src.w\rfloor + + +ROUND - Round + +.. math:: + + dst.x = round(src.x) + + dst.y = round(src.y) + + dst.z = round(src.z) + + dst.w = round(src.w) + + +EX2 - Exponential Base 2 + +.. math:: + + dst.x = 2^{src.x} + + dst.y = 2^{src.x} + + dst.z = 2^{src.x} + + dst.w = 2^{src.x} + + +LG2 - Logarithm Base 2 + +.. math:: + + dst.x = \log_2{src.x} + + dst.y = \log_2{src.x} + + dst.z = \log_2{src.x} + + dst.w = \log_2{src.x} + + +POW - Power + +.. math:: + + dst.x = src0.x^{src1.x} + + dst.y = src0.x^{src1.x} + + dst.z = src0.x^{src1.x} + + dst.w = src0.x^{src1.x} + +XPD - Cross Product + +.. math:: + + dst.x = src0.y \times src1.z - src1.y \times src0.z + + dst.y = src0.z \times src1.x - src1.z \times src0.x + + dst.z = src0.x \times src1.y - src1.x \times src0.y + + dst.w = 1 + + +ABS - Absolute + +.. math:: + + dst.x = |src.x| + + dst.y = |src.y| + + dst.z = |src.z| + + dst.w = |src.w| + + +RCC - Reciprocal Clamped + +XXX cleanup on aisle three + +.. math:: + + dst.x = (1 / src.x) > 0 ? clamp(1 / src.x, 5.42101e-020, 1.884467e+019) : clamp(1 / src.x, -1.884467e+019, -5.42101e-020) + + dst.y = (1 / src.x) > 0 ? clamp(1 / src.x, 5.42101e-020, 1.884467e+019) : clamp(1 / src.x, -1.884467e+019, -5.42101e-020) + + dst.z = (1 / src.x) > 0 ? clamp(1 / src.x, 5.42101e-020, 1.884467e+019) : clamp(1 / src.x, -1.884467e+019, -5.42101e-020) + + dst.w = (1 / src.x) > 0 ? clamp(1 / src.x, 5.42101e-020, 1.884467e+019) : clamp(1 / src.x, -1.884467e+019, -5.42101e-020) + + +DPH - Homogeneous Dot Product + +.. math:: + + dst.x = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src1.w + + dst.y = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src1.w + + dst.z = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src1.w + + dst.w = src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z + src1.w + + +COS - Cosine + +.. math:: + + dst.x = \cos{src.x} + + dst.y = \cos{src.x} + + dst.z = \cos{src.x} + + dst.w = \cos{src.x} + + +DDX - Derivative Relative To X + +.. math:: + + dst.x = partialx(src.x) + + dst.y = partialx(src.y) + + dst.z = partialx(src.z) + + dst.w = partialx(src.w) + + +DDY - Derivative Relative To Y + +.. math:: + + dst.x = partialy(src.x) + + dst.y = partialy(src.y) + + dst.z = partialy(src.z) + + dst.w = partialy(src.w) + + +KILP - Predicated Discard + + discard + + +PK2H - Pack Two 16-bit Floats + + TBD + + +PK2US - Pack Two Unsigned 16-bit Scalars + + TBD + + +PK4B - Pack Four Signed 8-bit Scalars + + TBD + + +PK4UB - Pack Four Unsigned 8-bit Scalars + + TBD + + +RFL - Reflection Vector + +.. math:: + + dst.x = 2 \times (src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z) / (src0.x \times src0.x + src0.y \times src0.y + src0.z \times src0.z) \times src0.x - src1.x + + dst.y = 2 \times (src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z) / (src0.x \times src0.x + src0.y \times src0.y + src0.z \times src0.z) \times src0.y - src1.y + + dst.z = 2 \times (src0.x \times src1.x + src0.y \times src1.y + src0.z \times src1.z) / (src0.x \times src0.x + src0.y \times src0.y + src0.z \times src0.z) \times src0.z - src1.z + + dst.w = 1 + +Considered for removal. + + +SEQ - Set On Equal + +.. math:: + + dst.x = (src0.x == src1.x) ? 1 : 0 + dst.y = (src0.y == src1.y) ? 1 : 0 + dst.z = (src0.z == src1.z) ? 1 : 0 + dst.w = (src0.w == src1.w) ? 1 : 0 + + +SFL - Set On False + +.. math:: + + dst.x = 0 + dst.y = 0 + dst.z = 0 + dst.w = 0 + +Considered for removal. + +SGT - Set On Greater Than + +.. math:: + + dst.x = (src0.x > src1.x) ? 1 : 0 + dst.y = (src0.y > src1.y) ? 1 : 0 + dst.z = (src0.z > src1.z) ? 1 : 0 + dst.w = (src0.w > src1.w) ? 1 : 0 + + +SIN - Sine + +.. math:: + + dst.x = \sin{src.x} + + dst.y = \sin{src.x} + + dst.z = \sin{src.x} + + dst.w = \sin{src.x} + + +SLE - Set On Less Equal Than + +.. math:: + + dst.x = (src0.x <= src1.x) ? 1 : 0 + dst.y = (src0.y <= src1.y) ? 1 : 0 + dst.z = (src0.z <= src1.z) ? 1 : 0 + dst.w = (src0.w <= src1.w) ? 1 : 0 + + +SNE - Set On Not Equal + +.. math:: + + dst.x = (src0.x != src1.x) ? 1 : 0 + dst.y = (src0.y != src1.y) ? 1 : 0 + dst.z = (src0.z != src1.z) ? 1 : 0 + dst.w = (src0.w != src1.w) ? 1 : 0 + + +STR - Set On True + +.. math:: + + dst.x = 1 + dst.y = 1 + dst.z = 1 + dst.w = 1 + + +TEX - Texture Lookup + + TBD + + +TXD - Texture Lookup with Derivatives + + TBD + + +TXP - Projective Texture Lookup + + TBD + + +UP2H - Unpack Two 16-Bit Floats + + TBD + + Considered for removal. + +UP2US - Unpack Two Unsigned 16-Bit Scalars + + TBD + + Considered for removal. + +UP4B - Unpack Four Signed 8-Bit Values + + TBD + + Considered for removal. + +UP4UB - Unpack Four Unsigned 8-Bit Scalars + + TBD + + Considered for removal. + +X2D - 2D Coordinate Transformation + +.. math:: + + dst.x = src0.x + src1.x \times src2.x + src1.y \times src2.y + dst.y = src0.y + src1.x \times src2.z + src1.y \times src2.w + dst.z = src0.x + src1.x \times src2.x + src1.y \times src2.y + dst.w = src0.y + src1.x \times src2.z + src1.y \times src2.w + +Considered for removal. + + +From GL_NV_vertex_program2 +^^^^^^^^^^^^^^^^^^^^^^^^^^ + + +ARA - Address Register Add + + TBD + + Considered for removal. + +ARR - Address Register Load With Round + +.. math:: + + dst.x = round(src.x) + + dst.y = round(src.y) + + dst.z = round(src.z) + + dst.w = round(src.w) + + +BRA - Branch + + pc = target + + Considered for removal. + +CAL - Subroutine Call + + push(pc) + pc = target + + +RET - Subroutine Call Return + + pc = pop() + + Potential restrictions: + * Only occurs at end of function. + +SSG - Set Sign + +.. math:: + + dst.x = (src.x > 0) ? 1 : (src.x < 0) ? -1 : 0 + + dst.y = (src.y > 0) ? 1 : (src.y < 0) ? -1 : 0 + + dst.z = (src.z > 0) ? 1 : (src.z < 0) ? -1 : 0 + + dst.w = (src.w > 0) ? 1 : (src.w < 0) ? -1 : 0 + + +CMP - Compare + +.. math:: + + dst.x = (src0.x < 0) ? src1.x : src2.x + + dst.y = (src0.y < 0) ? src1.y : src2.y + + dst.z = (src0.z < 0) ? src1.z : src2.z + + dst.w = (src0.w < 0) ? src1.w : src2.w + + +KIL - Conditional Discard + +.. math:: + + if (src.x < 0 || src.y < 0 || src.z < 0 || src.w < 0) + discard + endif + + +SCS - Sine Cosine + +.. math:: + + dst.x = \cos{src.x} + + dst.y = \sin{src.x} + + dst.z = 0 + + dst.y = 1 + + +TXB - Texture Lookup With Bias + + TBD + + +NRM - 3-component Vector Normalise + +.. math:: + + dst.x = src.x / (src.x \times src.x + src.y \times src.y + src.z \times src.z) + + dst.y = src.y / (src.x \times src.x + src.y \times src.y + src.z \times src.z) + + dst.z = src.z / (src.x \times src.x + src.y \times src.y + src.z \times src.z) + + dst.w = 1 + + +DIV - Divide + +.. math:: + + dst.x = \frac{src0.x}{src1.x} + + dst.y = \frac{src0.y}{src1.y} + + dst.z = \frac{src0.z}{src1.z} + + dst.w = \frac{src0.w}{src1.w} + + +DP2 - 2-component Dot Product + +.. math:: + + dst.x = src0.x \times src1.x + src0.y \times src1.y + + dst.y = src0.x \times src1.x + src0.y \times src1.y + + dst.z = src0.x \times src1.x + src0.y \times src1.y + + dst.w = src0.x \times src1.x + src0.y \times src1.y + + +TXL - Texture Lookup With LOD + + TBD + + +BRK - Break + + TBD + + +IF - If + + TBD + + +BGNFOR - Begin a For-Loop + + dst.x = floor(src.x) + dst.y = floor(src.y) + dst.z = floor(src.z) + + if (dst.y <= 0) + pc = [matching ENDFOR] + 1 + endif + + Note: The destination must be a loop register. + The source must be a constant register. + + Considered for cleanup / removal. + + +REP - Repeat + + TBD + + +ELSE - Else + + TBD + + +ENDIF - End If + + TBD + + +ENDFOR - End a For-Loop + + dst.x = dst.x + dst.z + dst.y = dst.y - 1.0 + + if (dst.y > 0) + pc = [matching BGNFOR instruction] + 1 + endif + + Note: The destination must be a loop register. + + Considered for cleanup / removal. + +ENDREP - End Repeat + + TBD + + +PUSHA - Push Address Register On Stack + + push(src.x) + push(src.y) + push(src.z) + push(src.w) + + Considered for cleanup / removal. + +POPA - Pop Address Register From Stack + + dst.w = pop() + dst.z = pop() + dst.y = pop() + dst.x = pop() + + Considered for cleanup / removal. + + +From GL_NV_gpu_program4 +^^^^^^^^^^^^^^^^^^^^^^^^ + +Support for these opcodes indicated by a special pipe capability bit (TBD). + +CEIL - Ceiling + +.. math:: + + dst.x = \lceil src.x\rceil + + dst.y = \lceil src.y\rceil + + dst.z = \lceil src.z\rceil + + dst.w = \lceil src.w\rceil + + +I2F - Integer To Float + +.. math:: + + dst.x = (float) src.x + + dst.y = (float) src.y + + dst.z = (float) src.z + + dst.w = (float) src.w + + +NOT - Bitwise Not + +.. math:: + + dst.x = ~src.x + + dst.y = ~src.y + + dst.z = ~src.z + + dst.w = ~src.w + + +TRUNC - Truncate + +.. math:: + + dst.x = trunc(src.x) + + dst.y = trunc(src.y) + + dst.z = trunc(src.z) + + dst.w = trunc(src.w) + + +SHL - Shift Left + +.. math:: + + dst.x = src0.x << src1.x + + dst.y = src0.y << src1.x + + dst.z = src0.z << src1.x + + dst.w = src0.w << src1.x + + +SHR - Shift Right + +.. math:: + + dst.x = src0.x >> src1.x + + dst.y = src0.y >> src1.x + + dst.z = src0.z >> src1.x + + dst.w = src0.w >> src1.x + + +AND - Bitwise And + +.. math:: + + dst.x = src0.x & src1.x + + dst.y = src0.y & src1.y + + dst.z = src0.z & src1.z + + dst.w = src0.w & src1.w + + +OR - Bitwise Or + +.. math:: + + dst.x = src0.x | src1.x + + dst.y = src0.y | src1.y + + dst.z = src0.z | src1.z + + dst.w = src0.w | src1.w + + +MOD - Modulus + +.. math:: + + dst.x = src0.x \bmod src1.x + + dst.y = src0.y \bmod src1.y + + dst.z = src0.z \bmod src1.z + + dst.w = src0.w \bmod src1.w + + +XOR - Bitwise Xor + +.. math:: + + dst.x = src0.x ^ src1.x + + dst.y = src0.y ^ src1.y + + dst.z = src0.z ^ src1.z + + dst.w = src0.w ^ src1.w + + +SAD - Sum Of Absolute Differences + +.. math:: + + dst.x = |src0.x - src1.x| + src2.x + + dst.y = |src0.y - src1.y| + src2.y + + dst.z = |src0.z - src1.z| + src2.z + + dst.w = |src0.w - src1.w| + src2.w + + +TXF - Texel Fetch + + TBD + + +TXQ - Texture Size Query + + TBD + + +CONT - Continue + + TBD + + +From GL_NV_geometry_program4 +^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ + + +EMIT - Emit + + TBD + + +ENDPRIM - End Primitive + + TBD + + +From GLSL +^^^^^^^^^^ + + +BGNLOOP - Begin a Loop + + TBD + + +BGNSUB - Begin Subroutine + + TBD + + +ENDLOOP - End a Loop + + TBD + + +ENDSUB - End Subroutine + + TBD + + +NOP - No Operation + + Do nothing. + + +NRM4 - 4-component Vector Normalise + +.. math:: + + dst.x = \frac{src.x}{src.x \times src.x + src.y \times src.y + src.z \times src.z + src.w \times src.w} + + dst.y = \frac{src.y}{src.x \times src.x + src.y \times src.y + src.z \times src.z + src.w \times src.w} + + dst.z = \frac{src.z}{src.x \times src.x + src.y \times src.y + src.z \times src.z + src.w \times src.w} + + dst.w = \frac{src.w}{src.x \times src.x + src.y \times src.y + src.z \times src.z + src.w \times src.w} + + +ps_2_x +^^^^^^^^^^^^ + + +CALLNZ - Subroutine Call If Not Zero + + TBD + + +IFC - If + + TBD + + +BREAKC - Break Conditional + + TBD + + +Explanation of symbols used +------------------------------ + + +Functions +^^^^^^^^^^^^^^ + + + :math:`|x|` Absolute value of `x`. + + :math:`\lceil x \rceil` Ceiling of `x`. + + clamp(x,y,z) Clamp x between y and z. + (x < y) ? y : (x > z) ? z : x + + :math:`\lfloor x\rfloor` Floor of `x`. + + :math:`\log_2{x}` Logarithm of `x`, base 2. + + max(x,y) Maximum of x and y. + (x > y) ? x : y + + min(x,y) Minimum of x and y. + (x < y) ? x : y + + partialx(x) Derivative of x relative to fragment's X. + + partialy(x) Derivative of x relative to fragment's Y. + + pop() Pop from stack. + + :math:`x^y` `x` to the power `y`. + + push(x) Push x on stack. + + round(x) Round x. + + trunc(x) Truncate x, i.e. drop the fraction bits. + + +Keywords +^^^^^^^^^^^^^ + + + discard Discard fragment. + + dst First destination register. + + dst0 First destination register. + + pc Program counter. + + src First source register. + + src0 First source register. + + src1 Second source register. + + src2 Third source register. + + target Label of target instruction. + + +Other tokens +--------------- + + +Declaration Semantic +^^^^^^^^^^^^^^^^^^^^^^^^ + + + Follows Declaration token if Semantic bit is set. + + Since its purpose is to link a shader with other stages of the pipeline, + it is valid to follow only those Declaration tokens that declare a register + either in INPUT or OUTPUT file. + + SemanticName field contains the semantic name of the register being declared. + There is no default value. + + SemanticIndex is an optional subscript that can be used to distinguish + different register declarations with the same semantic name. The default value + is 0. + + The meanings of the individual semantic names are explained in the following + sections. + +TGSI_SEMANTIC_POSITION +"""""""""""""""""""""" + +Position, sometimes known as HPOS or WPOS for historical reasons, is the +location of the vertex in space, in ``(x, y, z, w)`` format. ``x``, ``y``, and ``z`` +are the Cartesian coordinates, and ``w`` is the homogenous coordinate and used +for the perspective divide, if enabled. + +As a vertex shader output, position should be scaled to the viewport. When +used in fragment shaders, position will --- + +XXX --- wait a minute. Should position be in [0,1] for x and y? + +XXX additionally, is there a way to configure the perspective divide? it's +accelerated on most chipsets AFAIK... + +Position, if not specified, usually defaults to ``(0, 0, 0, 1)``, and can +be partially specified as ``(x, y, 0, 1)`` or ``(x, y, z, 1)``. + +XXX usually? can we solidify that? + +TGSI_SEMANTIC_COLOR +""""""""""""""""""" + +Colors are used to, well, color the primitives. Colors are always in +``(r, g, b, a)`` format. + +If alpha is not specified, it defaults to 1. + +TGSI_SEMANTIC_BCOLOR +"""""""""""""""""""" + +Back-facing colors are only used for back-facing polygons, and are only valid +in vertex shader outputs. After rasterization, all polygons are front-facing +and COLOR and BCOLOR end up occupying the same slots in the fragment, so +all BCOLORs effectively become regular COLORs in the fragment shader. + +TGSI_SEMANTIC_FOG +""""""""""""""""" + +The fog coordinate historically has been used to replace the depth coordinate +for generation of fog in dedicated fog blocks. Gallium, however, does not use +dedicated fog acceleration, placing it entirely in the fragment shader +instead. + +The fog coordinate should be written in ``(f, 0, 0, 1)`` format. Only the first +component matters when writing from the vertex shader; the driver will ensure +that the coordinate is in this format when used as a fragment shader input. + +TGSI_SEMANTIC_PSIZE +""""""""""""""""""" + +PSIZE, or point size, is used to specify point sizes per-vertex. It should +be in ``(p, n, x, f)`` format, where ``p`` is the point size, ``n`` is the minimum +size, ``x`` is the maximum size, and ``f`` is the fade threshold. + +XXX this is arb_vp. is this what we actually do? should double-check... + +When using this semantic, be sure to set the appropriate state in the +:ref:`rasterizer` first. + +TGSI_SEMANTIC_GENERIC +""""""""""""""""""""" + +Generic semantics are nearly always used for texture coordinate attributes, +in ``(s, t, r, q)`` format. ``t`` and ``r`` may be unused for certain kinds +of lookups, and ``q`` is the level-of-detail bias for biased sampling. + +These attributes are called "generic" because they may be used for anything +else, including parameters, texture generation information, or anything that +can be stored inside a four-component vector. + +TGSI_SEMANTIC_NORMAL +"""""""""""""""""""" + +Vertex normal; could be used to implement per-pixel lighting for legacy APIs +that allow mixing fixed-function and programmable stages. + +TGSI_SEMANTIC_FACE +"""""""""""""""""" + +FACE is the facing bit, to store the facing information for the fragment +shader. ``(f, 0, 0, 1)`` is the format. The first component will be positive +when the fragment is front-facing, and negative when the component is +back-facing. + +TGSI_SEMANTIC_EDGEFLAG +"""""""""""""""""""""" + +XXX no clue diff --git a/src/gallium/drivers/cell/ppu/cell_draw_arrays.c b/src/gallium/drivers/cell/ppu/cell_draw_arrays.c index 01bea0f8cc..3fa8b975d3 100644 --- a/src/gallium/drivers/cell/ppu/cell_draw_arrays.c +++ b/src/gallium/drivers/cell/ppu/cell_draw_arrays.c @@ -85,7 +85,7 @@ cell_unmap_constant_buffers(struct cell_context *sp) * * XXX should the element buffer be specified/bound with a separate function? */ -static boolean +static void cell_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, @@ -145,29 +145,27 @@ cell_draw_range_elements(struct pipe_context *pipe, /* Note: leave drawing surfaces mapped */ cell_unmap_constant_buffers(sp); - - return TRUE; } -static boolean +static void cell_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) { - return cell_draw_range_elements( pipe, indexBuffer, - indexSize, - 0, 0xffffffff, - mode, start, count ); + cell_draw_range_elements( pipe, indexBuffer, + indexSize, + 0, 0xffffffff, + mode, start, count ); } -static boolean +static void cell_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { - return cell_draw_elements(pipe, NULL, 0, mode, start, count); + cell_draw_elements(pipe, NULL, 0, mode, start, count); } diff --git a/src/gallium/drivers/cell/spu/spu_command.c b/src/gallium/drivers/cell/spu/spu_command.c index 5c0179d954..12b855a3db 100644 --- a/src/gallium/drivers/cell/spu/spu_command.c +++ b/src/gallium/drivers/cell/spu/spu_command.c @@ -405,8 +405,6 @@ cmd_state_sampler(const struct cell_command_sampler *sampler) case PIPE_TEX_FILTER_LINEAR: spu.min_sample_texture_2d[unit] = sample_texture_2d_bilinear; break; - case PIPE_TEX_FILTER_ANISO: - /* fall-through, for now */ case PIPE_TEX_FILTER_NEAREST: spu.min_sample_texture_2d[unit] = sample_texture_2d_nearest; break; @@ -418,8 +416,6 @@ cmd_state_sampler(const struct cell_command_sampler *sampler) case PIPE_TEX_FILTER_LINEAR: spu.mag_sample_texture_2d[unit] = sample_texture_2d_bilinear; break; - case PIPE_TEX_FILTER_ANISO: - /* fall-through, for now */ case PIPE_TEX_FILTER_NEAREST: spu.mag_sample_texture_2d[unit] = sample_texture_2d_nearest; break; diff --git a/src/gallium/drivers/cell/spu/spu_exec.c b/src/gallium/drivers/cell/spu/spu_exec.c index 5ed330aa6e..d86d8e09a5 100644 --- a/src/gallium/drivers/cell/spu/spu_exec.c +++ b/src/gallium/drivers/cell/spu/spu_exec.c @@ -1681,7 +1681,7 @@ exec_instruction( } break; - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: FOR_EACH_ENABLED_CHANNEL( *inst, chan_index ) { FETCH( &r[0], 0, chan_index ); FETCH( &r[1], 1, chan_index ); diff --git a/src/gallium/drivers/failover/fo_context.c b/src/gallium/drivers/failover/fo_context.c index 37184eac7b..46e4338d98 100644 --- a/src/gallium/drivers/failover/fo_context.c +++ b/src/gallium/drivers/failover/fo_context.c @@ -44,11 +44,19 @@ static void failover_destroy( struct pipe_context *pipe ) } +void failover_fail_over( struct failover_context *failover ) +{ + failover->dirty = TRUE; + failover->mode = FO_SW; +} -static boolean failover_draw_elements( struct pipe_context *pipe, - struct pipe_buffer *indexBuffer, - unsigned indexSize, - unsigned prim, unsigned start, unsigned count) + +static void failover_draw_elements( struct pipe_context *pipe, + struct pipe_buffer *indexBuffer, + unsigned indexSize, + unsigned prim, + unsigned start, + unsigned count) { struct failover_context *failover = failover_context( pipe ); @@ -62,24 +70,22 @@ static boolean failover_draw_elements( struct pipe_context *pipe, /* Try hardware: */ if (failover->mode == FO_HW) { - if (!failover->hw->draw_elements( failover->hw, - indexBuffer, - indexSize, - prim, - start, - count )) { - - failover->hw->flush( failover->hw, ~0, NULL ); - failover->mode = FO_SW; - } + failover->hw->draw_elements( failover->hw, + indexBuffer, + indexSize, + prim, + start, + count ); } /* Possibly try software: */ if (failover->mode == FO_SW) { - if (failover->dirty) + if (failover->dirty) { + failover->hw->flush( failover->hw, ~0, NULL ); failover_state_emit( failover ); + } failover->sw->draw_elements( failover->sw, indexBuffer, @@ -94,15 +100,13 @@ static boolean failover_draw_elements( struct pipe_context *pipe, */ failover->sw->flush( failover->sw, ~0, NULL ); } - - return TRUE; } -static boolean failover_draw_arrays( struct pipe_context *pipe, +static void failover_draw_arrays( struct pipe_context *pipe, unsigned prim, unsigned start, unsigned count) { - return failover_draw_elements(pipe, NULL, 0, prim, start, count); + failover_draw_elements(pipe, NULL, 0, prim, start, count); } static unsigned int diff --git a/src/gallium/drivers/failover/fo_winsys.h b/src/gallium/drivers/failover/fo_winsys.h index a8ce997a1f..533122b69d 100644 --- a/src/gallium/drivers/failover/fo_winsys.h +++ b/src/gallium/drivers/failover/fo_winsys.h @@ -36,10 +36,13 @@ struct pipe_context; +struct failover_context; struct pipe_context *failover_create( struct pipe_context *hw, struct pipe_context *sw ); +void failover_fail_over( struct failover_context *failover ); + #endif /* FO_WINSYS_H */ diff --git a/src/gallium/drivers/i915/i915_context.c b/src/gallium/drivers/i915/i915_context.c index 949f046350..89feeade75 100644 --- a/src/gallium/drivers/i915/i915_context.c +++ b/src/gallium/drivers/i915/i915_context.c @@ -45,7 +45,7 @@ */ -static boolean +static void i915_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, @@ -106,27 +106,25 @@ i915_draw_range_elements(struct pipe_context *pipe, pipe_buffer_unmap(pipe->screen, indexBuffer); draw_set_mapped_element_buffer_range(draw, 0, start, start + count - 1, NULL); } - - return TRUE; } -static boolean +static void i915_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count) { - return i915_draw_range_elements(pipe, indexBuffer, - indexSize, - 0, 0xffffffff, - prim, start, count); + i915_draw_range_elements(pipe, indexBuffer, + indexSize, + 0, 0xffffffff, + prim, start, count); } -static boolean +static void i915_draw_arrays(struct pipe_context *pipe, unsigned prim, unsigned start, unsigned count) { - return i915_draw_elements(pipe, NULL, 0, prim, start, count); + i915_draw_elements(pipe, NULL, 0, prim, start, count); } diff --git a/src/gallium/drivers/i915/i915_state.c b/src/gallium/drivers/i915/i915_state.c index 1528afc859..5f5b6f8e18 100644 --- a/src/gallium/drivers/i915/i915_state.c +++ b/src/gallium/drivers/i915/i915_state.c @@ -74,8 +74,6 @@ static unsigned translate_img_filter( unsigned filter ) return FILTER_NEAREST; case PIPE_TEX_FILTER_LINEAR: return FILTER_LINEAR; - case PIPE_TEX_FILTER_ANISO: - return FILTER_ANISOTROPIC; default: assert(0); return FILTER_NEAREST; @@ -221,6 +219,9 @@ i915_create_sampler_state(struct pipe_context *pipe, minFilt = translate_img_filter( sampler->min_img_filter ); magFilt = translate_img_filter( sampler->mag_img_filter ); + if (sampler->max_anisotropy > 1.0) + minFilt = magFilt = FILTER_ANISOTROPIC; + if (sampler->max_anisotropy > 2.0) { cso->state[0] |= SS2_MAX_ANISO_4; } diff --git a/src/gallium/drivers/i965/brw_draw.c b/src/gallium/drivers/i965/brw_draw.c index 852fd22982..ea8d39adaf 100644 --- a/src/gallium/drivers/i965/brw_draw.c +++ b/src/gallium/drivers/i965/brw_draw.c @@ -176,7 +176,7 @@ try_draw_range_elements(struct brw_context *brw, } -static boolean +static void brw_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *index_buffer, unsigned index_size, @@ -228,29 +228,27 @@ brw_draw_range_elements(struct pipe_context *pipe, ret = try_draw_range_elements(brw, index_buffer, hw_prim, start, count ); assert(ret == 0); } - - return TRUE; } -static boolean +static void brw_draw_elements(struct pipe_context *pipe, struct pipe_buffer *index_buffer, unsigned index_size, unsigned mode, unsigned start, unsigned count) { - return brw_draw_range_elements( pipe, index_buffer, - index_size, - 0, 0xffffffff, - mode, - start, count ); + brw_draw_range_elements( pipe, index_buffer, + index_size, + 0, 0xffffffff, + mode, + start, count ); } -static boolean +static void brw_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { - return brw_draw_elements(pipe, NULL, 0, mode, start, count); + brw_draw_elements(pipe, NULL, 0, mode, start, count); } diff --git a/src/gallium/drivers/i965/brw_eu_emit.c b/src/gallium/drivers/i965/brw_eu_emit.c index 4fe7b6acc1..00d8eaccbc 100644 --- a/src/gallium/drivers/i965/brw_eu_emit.c +++ b/src/gallium/drivers/i965/brw_eu_emit.c @@ -860,7 +860,7 @@ void brw_land_fwd_jump(struct brw_compile *p, jmpi = 2; assert(jmp_insn->header.opcode == BRW_OPCODE_JMPI); - assert(jmp_insn->bits1.da1.src1_reg_file = BRW_IMMEDIATE_VALUE); + assert(jmp_insn->bits1.da1.src1_reg_file == BRW_IMMEDIATE_VALUE); jmp_insn->bits3.ud = jmpi * ((landing - jmp_insn) - 1); } diff --git a/src/gallium/drivers/i965/brw_pipe_sampler.c b/src/gallium/drivers/i965/brw_pipe_sampler.c index 5ddc63f57e..81712798a5 100644 --- a/src/gallium/drivers/i965/brw_pipe_sampler.c +++ b/src/gallium/drivers/i965/brw_pipe_sampler.c @@ -48,8 +48,6 @@ static GLuint translate_img_filter( unsigned filter ) return BRW_MAPFILTER_NEAREST; case PIPE_TEX_FILTER_LINEAR: return BRW_MAPFILTER_LINEAR; - case PIPE_TEX_FILTER_ANISO: - return BRW_MAPFILTER_ANISOTROPIC; default: assert(0); return BRW_MAPFILTER_NEAREST; diff --git a/src/gallium/drivers/i965/brw_wm_emit.c b/src/gallium/drivers/i965/brw_wm_emit.c index 7e57d0306b..8f983a60ae 100644 --- a/src/gallium/drivers/i965/brw_wm_emit.c +++ b/src/gallium/drivers/i965/brw_wm_emit.c @@ -691,7 +691,7 @@ static void emit_xpd( struct brw_compile *p, { GLuint i; - assert(!(mask & BRW_WRITEMASK_W) == BRW_WRITEMASK_X); + assert((mask & BRW_WRITEMASK_W) != BRW_WRITEMASK_W); for (i = 0 ; i < 3; i++) { if (mask & (1<<i)) { diff --git a/src/gallium/drivers/identity/id_context.c b/src/gallium/drivers/identity/id_context.c index bdbaae5987..9f5b4e6323 100644 --- a/src/gallium/drivers/identity/id_context.c +++ b/src/gallium/drivers/identity/id_context.c @@ -45,7 +45,7 @@ identity_destroy(struct pipe_context *_pipe) free(id_pipe); } -static boolean +static void identity_draw_arrays(struct pipe_context *_pipe, unsigned prim, unsigned start, @@ -54,13 +54,13 @@ identity_draw_arrays(struct pipe_context *_pipe, struct identity_context *id_pipe = identity_context(_pipe); struct pipe_context *pipe = id_pipe->pipe; - return pipe->draw_arrays(pipe, - prim, - start, - count); + pipe->draw_arrays(pipe, + prim, + start, + count); } -static boolean +static void identity_draw_elements(struct pipe_context *_pipe, struct pipe_buffer *_indexBuffer, unsigned indexSize, @@ -73,15 +73,15 @@ identity_draw_elements(struct pipe_context *_pipe, struct pipe_context *pipe = id_pipe->pipe; struct pipe_buffer *indexBuffer = id_buffer->buffer; - return pipe->draw_elements(pipe, - indexBuffer, - indexSize, - prim, - start, - count); + pipe->draw_elements(pipe, + indexBuffer, + indexSize, + prim, + start, + count); } -static boolean +static void identity_draw_range_elements(struct pipe_context *_pipe, struct pipe_buffer *_indexBuffer, unsigned indexSize, @@ -96,14 +96,14 @@ identity_draw_range_elements(struct pipe_context *_pipe, struct pipe_context *pipe = id_pipe->pipe; struct pipe_buffer *indexBuffer = id_buffer->buffer; - return pipe->draw_range_elements(pipe, - indexBuffer, - indexSize, - minIndex, - maxIndex, - mode, - start, - count); + pipe->draw_range_elements(pipe, + indexBuffer, + indexSize, + minIndex, + maxIndex, + mode, + start, + count); } static struct pipe_query * diff --git a/src/gallium/drivers/llvmpipe/Makefile b/src/gallium/drivers/llvmpipe/Makefile index e038a5229e..7c6e46006b 100644 --- a/src/gallium/drivers/llvmpipe/Makefile +++ b/src/gallium/drivers/llvmpipe/Makefile @@ -50,7 +50,6 @@ C_SOURCES = \ lp_state_vs.c \ lp_surface.c \ lp_tex_cache.c \ - lp_tex_sample_c.c \ lp_tex_sample_llvm.c \ lp_texture.c \ lp_tile_cache.c \ diff --git a/src/gallium/drivers/llvmpipe/README b/src/gallium/drivers/llvmpipe/README index 0c3f00fd58..72d9f39658 100644 --- a/src/gallium/drivers/llvmpipe/README +++ b/src/gallium/drivers/llvmpipe/README @@ -59,27 +59,16 @@ Requirements See /proc/cpuinfo to know what your CPU supports. - - LLVM 2.5 or greater. LLVM 2.6 is preferred. + - LLVM 2.6. - On Debian based distributions do: + For Linux, on a recent Debian based distribution do: aptitude install llvm-dev - There is a typo in one of the llvm 2.5 headers, that may cause compilation - errors. To fix it apply the change: + For Windows download pre-built MSVC 9.0 or MinGW binaries from + http://people.freedesktop.org/~jrfonseca/llvm/ and set the LLVM environment + variable to the extracted path. - --- /usr/include/llvm-c/Core.h.orig 2009-08-10 15:38:54.000000000 +0100 - +++ /usr/include/llvm-c/Core.h 2009-08-10 15:38:25.000000000 +0100 - @@ -831,7 +831,7 @@ - template<typename T> - inline T **unwrap(LLVMValueRef *Vals, unsigned Length) { - #if DEBUG - - for (LLVMValueRef *I = Vals, E = Vals + Length; I != E; ++I) - + for (LLVMValueRef *I = Vals, *E = Vals + Length; I != E; ++I) - cast<T>(*I); - #endif - return reinterpret_cast<T**>(Vals); - - scons (optional) - udis86, http://udis86.sourceforge.net/ (optional): @@ -95,9 +84,9 @@ Requirements Building ======== -To build everything invoke scons as: +To build everything on Linux invoke scons as: - scons debug=yes statetrackers=mesa drivers=llvmpipe winsys=xlib dri=false -k + scons debug=yes statetrackers=mesa drivers=trace,llvmpipe winsys=xlib dri=false Alternatively, you can build it with GNU make, if you prefer, by invoking it as @@ -105,12 +94,15 @@ Alternatively, you can build it with GNU make, if you prefer, by invoking it as but the rest of these instructions assume that scons is used. +For windows is everything the except except the winsys: + + scons debug=yes statetrackers=mesa drivers=trace,llvmpipe winsys=gdi dri=false Using ===== -Building will create a drop-in alternative for libGL.so. To use it set the -environment variables: +On Linux, building will create a drop-in alternative for libGL.so. To use it +set the environment variables: export LD_LIBRARY_PATH=$PWD/build/linux-x86_64-debug/lib:$LD_LIBRARY_PATH @@ -121,6 +113,11 @@ or For performance evaluation pass debug=no to scons, and use the corresponding lib directory without the "-debug" suffix. +On Windows, building will create a drop-in alternative for opengl32.dll. To use +it put it in the same directory as the application. It can also be used by +replacing the native ICD driver, but it's quite an advanced usage, so if you +need to ask, don't even try it. + Unit testing ============ diff --git a/src/gallium/drivers/llvmpipe/SConscript b/src/gallium/drivers/llvmpipe/SConscript index 3ca676647c..6bb545a501 100644 --- a/src/gallium/drivers/llvmpipe/SConscript +++ b/src/gallium/drivers/llvmpipe/SConscript @@ -66,7 +66,6 @@ llvmpipe = env.ConvenienceLibrary( 'lp_state_vs.c', 'lp_surface.c', 'lp_tex_cache.c', - 'lp_tex_sample_c.c', 'lp_tex_sample_llvm.c', 'lp_texture.c', 'lp_tile_cache.c', diff --git a/src/gallium/drivers/llvmpipe/lp_bld_blend_aos.c b/src/gallium/drivers/llvmpipe/lp_bld_blend_aos.c index d14f468ba9..ced7b9c11d 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_blend_aos.c +++ b/src/gallium/drivers/llvmpipe/lp_bld_blend_aos.c @@ -142,7 +142,7 @@ lp_build_blend_factor_unswizzled(struct lp_build_blend_aos_context *bld, enum lp_build_blend_swizzle { LP_BUILD_BLEND_SWIZZLE_RGBA = 0, - LP_BUILD_BLEND_SWIZZLE_AAAA = 1, + LP_BUILD_BLEND_SWIZZLE_AAAA = 1 }; diff --git a/src/gallium/drivers/llvmpipe/lp_bld_flow.c b/src/gallium/drivers/llvmpipe/lp_bld_flow.c index dcc25fbff8..25c10af29f 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_flow.c +++ b/src/gallium/drivers/llvmpipe/lp_bld_flow.c @@ -47,7 +47,7 @@ */ enum lp_build_flow_construct_kind { lP_BUILD_FLOW_SCOPE, - LP_BUILD_FLOW_SKIP, + LP_BUILD_FLOW_SKIP }; diff --git a/src/gallium/drivers/llvmpipe/lp_bld_misc.cpp b/src/gallium/drivers/llvmpipe/lp_bld_misc.cpp index d3f78c06d9..6e79438ead 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_misc.cpp +++ b/src/gallium/drivers/llvmpipe/lp_bld_misc.cpp @@ -59,3 +59,17 @@ LLVMInitializeNativeTarget(void) #endif + + +/* + * Hack to allow the linking of release LLVM static libraries on a debug build. + * + * See also: + * - http://social.msdn.microsoft.com/Forums/en-US/vclanguage/thread/7234ea2b-0042-42ed-b4e2-5d8644dfb57d + */ +#if defined(_MSC_VER) && defined(_DEBUG) +#include <crtdefs.h> +extern "C" { + _CRTIMP void __cdecl _invalid_parameter_noinfo(void) {} +} +#endif diff --git a/src/gallium/drivers/llvmpipe/lp_bld_sample.c b/src/gallium/drivers/llvmpipe/lp_bld_sample.c index af70ddc6ab..9003e108c1 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_sample.c +++ b/src/gallium/drivers/llvmpipe/lp_bld_sample.c @@ -69,8 +69,8 @@ lp_sampler_static_state(struct lp_sampler_static_state *state, state->min_img_filter = sampler->min_img_filter; state->min_mip_filter = sampler->min_mip_filter; state->mag_img_filter = sampler->mag_img_filter; - if(sampler->compare_mode) { - state->compare_mode = sampler->compare_mode; + state->compare_mode = sampler->compare_mode; + if(sampler->compare_mode != PIPE_TEX_COMPARE_NONE) { state->compare_func = sampler->compare_func; } state->normalized_coords = sampler->normalized_coords; diff --git a/src/gallium/drivers/llvmpipe/lp_bld_sample_soa.c b/src/gallium/drivers/llvmpipe/lp_bld_sample_soa.c index 47b68b71e2..5ee8d556a6 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_sample_soa.c +++ b/src/gallium/drivers/llvmpipe/lp_bld_sample_soa.c @@ -488,7 +488,7 @@ lp_build_sample_compare(struct lp_build_sample_context *bld, LLVMValueRef res; unsigned chan; - if(!bld->static_state->compare_mode) + if(bld->static_state->compare_mode == PIPE_TEX_COMPARE_NONE) return; /* TODO: Compare before swizzling, to avoid redundant computations */ @@ -577,7 +577,6 @@ lp_build_sample_soa(LLVMBuilderRef builder, lp_build_sample_2d_nearest_soa(&bld, s, t, width, height, stride, data_ptr, texel); break; case PIPE_TEX_FILTER_LINEAR: - case PIPE_TEX_FILTER_ANISO: if(lp_format_is_rgba8(bld.format_desc)) lp_build_sample_2d_linear_aos(&bld, s, t, width, height, stride, data_ptr, texel); else diff --git a/src/gallium/drivers/llvmpipe/lp_bld_tgsi_soa.c b/src/gallium/drivers/llvmpipe/lp_bld_tgsi_soa.c index 7cfa4cc59a..fb1eda4423 100644 --- a/src/gallium/drivers/llvmpipe/lp_bld_tgsi_soa.c +++ b/src/gallium/drivers/llvmpipe/lp_bld_tgsi_soa.c @@ -361,6 +361,9 @@ emit_tex( struct lp_build_tgsi_soa_context *bld, if (projected) coords[i] = lp_build_mul(&bld->base, coords[i], oow); } + for (i = num_coords; i < 3; i++) { + coords[i] = bld->base.undef; + } bld->sampler->emit_fetch_texel(bld->sampler, bld->base.builder, @@ -1315,7 +1318,7 @@ emit_instruction( return 0; break; - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: /* deprecated? */ assert(0); return 0; diff --git a/src/gallium/drivers/llvmpipe/lp_context.c b/src/gallium/drivers/llvmpipe/lp_context.c index 37587d4f79..1cc3c9227c 100644 --- a/src/gallium/drivers/llvmpipe/lp_context.c +++ b/src/gallium/drivers/llvmpipe/lp_context.c @@ -256,22 +256,6 @@ llvmpipe_create( struct pipe_screen *screen ) llvmpipe->vertex_tex_cache[i] = lp_create_tex_tile_cache(screen); - /* vertex shader samplers */ - for (i = 0; i < PIPE_MAX_VERTEX_SAMPLERS; i++) { - llvmpipe->tgsi.vert_samplers[i].base.get_samples = lp_get_samples; - llvmpipe->tgsi.vert_samplers[i].processor = TGSI_PROCESSOR_VERTEX; - llvmpipe->tgsi.vert_samplers[i].cache = llvmpipe->vertex_tex_cache[i]; - llvmpipe->tgsi.vert_samplers_list[i] = &llvmpipe->tgsi.vert_samplers[i]; - } - - /* fragment shader samplers */ - for (i = 0; i < PIPE_MAX_SAMPLERS; i++) { - llvmpipe->tgsi.frag_samplers[i].base.get_samples = lp_get_samples; - llvmpipe->tgsi.frag_samplers[i].processor = TGSI_PROCESSOR_FRAGMENT; - llvmpipe->tgsi.frag_samplers[i].cache = llvmpipe->tex_cache[i]; - llvmpipe->tgsi.frag_samplers_list[i] = &llvmpipe->tgsi.frag_samplers[i]; - } - /* * Create drawing context and plug our rendering stage into it. */ @@ -279,10 +263,7 @@ llvmpipe_create( struct pipe_screen *screen ) if (!llvmpipe->draw) goto fail; - draw_texture_samplers(llvmpipe->draw, - PIPE_MAX_VERTEX_SAMPLERS, - (struct tgsi_sampler **) - llvmpipe->tgsi.vert_samplers_list); + /* FIXME: devise alternative to draw_texture_samplers */ if (debug_get_bool_option( "LP_NO_RAST", FALSE )) llvmpipe->no_rast = TRUE; diff --git a/src/gallium/drivers/llvmpipe/lp_context.h b/src/gallium/drivers/llvmpipe/lp_context.h index cc4d5ad5fd..6411797cf5 100644 --- a/src/gallium/drivers/llvmpipe/lp_context.h +++ b/src/gallium/drivers/llvmpipe/lp_context.h @@ -115,14 +115,6 @@ struct llvmpipe_context { unsigned line_stipple_counter; - /** TGSI exec things */ - struct { - struct lp_shader_sampler vert_samplers[PIPE_MAX_SAMPLERS]; - struct lp_shader_sampler *vert_samplers_list[PIPE_MAX_SAMPLERS]; - struct lp_shader_sampler frag_samplers[PIPE_MAX_SAMPLERS]; - struct lp_shader_sampler *frag_samplers_list[PIPE_MAX_SAMPLERS]; - } tgsi; - /** The primitive drawing context */ struct draw_context *draw; diff --git a/src/gallium/drivers/llvmpipe/lp_draw_arrays.c b/src/gallium/drivers/llvmpipe/lp_draw_arrays.c index a96c2cad9d..c152b4413f 100644 --- a/src/gallium/drivers/llvmpipe/lp_draw_arrays.c +++ b/src/gallium/drivers/llvmpipe/lp_draw_arrays.c @@ -45,11 +45,11 @@ -boolean +void llvmpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { - return llvmpipe_draw_elements(pipe, NULL, 0, mode, start, count); + llvmpipe_draw_elements(pipe, NULL, 0, mode, start, count); } @@ -58,7 +58,7 @@ llvmpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, * Basically, map the vertex buffers (and drawing surfaces), then hand off * the drawing to the 'draw' module. */ -boolean +void llvmpipe_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, @@ -122,20 +122,18 @@ llvmpipe_draw_range_elements(struct pipe_context *pipe, /* Note: leave drawing surfaces mapped */ lp->dirty_render_cache = TRUE; - - return TRUE; } -boolean +void llvmpipe_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) { - return llvmpipe_draw_range_elements( pipe, indexBuffer, - indexSize, - 0, 0xffffffff, - mode, start, count ); + llvmpipe_draw_range_elements( pipe, indexBuffer, + indexSize, + 0, 0xffffffff, + mode, start, count ); } diff --git a/src/gallium/drivers/llvmpipe/lp_jit.c b/src/gallium/drivers/llvmpipe/lp_jit.c index bce3baec16..4ef0783f3e 100644 --- a/src/gallium/drivers/llvmpipe/lp_jit.c +++ b/src/gallium/drivers/llvmpipe/lp_jit.c @@ -79,25 +79,22 @@ lp_jit_init_globals(struct llvmpipe_screen *screen) /* struct lp_jit_context */ { - LLVMTypeRef elem_types[5]; + LLVMTypeRef elem_types[4]; LLVMTypeRef context_type; elem_types[0] = LLVMPointerType(LLVMFloatType(), 0); /* constants */ - elem_types[1] = LLVMPointerType(LLVMInt8Type(), 0); /* samplers */ - elem_types[2] = LLVMFloatType(); /* alpha_ref_value */ - elem_types[3] = LLVMPointerType(LLVMInt8Type(), 0); /* blend_color */ - elem_types[4] = LLVMArrayType(texture_type, PIPE_MAX_SAMPLERS); /* textures */ + elem_types[1] = LLVMFloatType(); /* alpha_ref_value */ + elem_types[2] = LLVMPointerType(LLVMInt8Type(), 0); /* blend_color */ + elem_types[3] = LLVMArrayType(texture_type, PIPE_MAX_SAMPLERS); /* textures */ context_type = LLVMStructType(elem_types, Elements(elem_types), 0); LP_CHECK_MEMBER_OFFSET(struct lp_jit_context, constants, screen->target, context_type, 0); - LP_CHECK_MEMBER_OFFSET(struct lp_jit_context, samplers, - screen->target, context_type, 1); LP_CHECK_MEMBER_OFFSET(struct lp_jit_context, alpha_ref_value, - screen->target, context_type, 2); + screen->target, context_type, 1); LP_CHECK_MEMBER_OFFSET(struct lp_jit_context, blend_color, - screen->target, context_type, 3); + screen->target, context_type, 2); LP_CHECK_MEMBER_OFFSET(struct lp_jit_context, textures, screen->target, context_type, LP_JIT_CONTEXT_TEXTURES_INDEX); @@ -109,24 +106,6 @@ lp_jit_init_globals(struct llvmpipe_screen *screen) screen->context_ptr_type = LLVMPointerType(context_type, 0); } - /* fetch_texel - */ - { - LLVMTypeRef ret_type; - LLVMTypeRef arg_types[3]; - LLVMValueRef fetch_texel; - - ret_type = LLVMVoidType(); - arg_types[0] = LLVMPointerType(LLVMInt8Type(), 0); /* samplers */ - arg_types[1] = LLVMInt32Type(); /* unit */ - arg_types[2] = LLVMPointerType(LLVMVectorType(LLVMFloatType(), 4), 0); /* store */ - - fetch_texel = lp_declare_intrinsic(screen->module, "fetch_texel", - ret_type, arg_types, Elements(arg_types)); - - LLVMAddGlobalMapping(screen->engine, fetch_texel, lp_fetch_texel_soa); - } - #ifdef DEBUG LLVMDumpModule(screen->module); #endif diff --git a/src/gallium/drivers/llvmpipe/lp_jit.h b/src/gallium/drivers/llvmpipe/lp_jit.h index 58f716ede2..277b690c02 100644 --- a/src/gallium/drivers/llvmpipe/lp_jit.h +++ b/src/gallium/drivers/llvmpipe/lp_jit.h @@ -41,7 +41,6 @@ #include "pipe/p_state.h" -struct tgsi_sampler; struct llvmpipe_screen; @@ -78,8 +77,6 @@ struct lp_jit_context { const float *constants; - struct tgsi_sampler **samplers; - float alpha_ref_value; /* FIXME: store (also?) in floats */ @@ -92,16 +89,13 @@ struct lp_jit_context #define lp_jit_context_constants(_builder, _ptr) \ lp_build_struct_get(_builder, _ptr, 0, "constants") -#define lp_jit_context_samplers(_builder, _ptr) \ - lp_build_struct_get(_builder, _ptr, 1, "samplers") - #define lp_jit_context_alpha_ref_value(_builder, _ptr) \ - lp_build_struct_get(_builder, _ptr, 2, "alpha_ref_value") + lp_build_struct_get(_builder, _ptr, 1, "alpha_ref_value") #define lp_jit_context_blend_color(_builder, _ptr) \ - lp_build_struct_get(_builder, _ptr, 3, "blend_color") + lp_build_struct_get(_builder, _ptr, 2, "blend_color") -#define LP_JIT_CONTEXT_TEXTURES_INDEX 4 +#define LP_JIT_CONTEXT_TEXTURES_INDEX 3 #define lp_jit_context_textures(_builder, _ptr) \ lp_build_struct_get_ptr(_builder, _ptr, LP_JIT_CONTEXT_TEXTURES_INDEX, "textures") @@ -118,12 +112,6 @@ typedef void void *color, void *depth); -void PIPE_CDECL -lp_fetch_texel_soa( struct tgsi_sampler **samplers, - uint32_t unit, - float *store ); - - void lp_jit_screen_cleanup(struct llvmpipe_screen *screen); diff --git a/src/gallium/drivers/llvmpipe/lp_state.h b/src/gallium/drivers/llvmpipe/lp_state.h index 5cee7bf74b..7020da145f 100644 --- a/src/gallium/drivers/llvmpipe/lp_state.h +++ b/src/gallium/drivers/llvmpipe/lp_state.h @@ -56,7 +56,6 @@ #define LP_NEW_QUERY 0x4000 -struct tgsi_sampler; struct vertex_info; struct pipe_context; struct llvmpipe_context; @@ -197,14 +196,14 @@ void llvmpipe_update_fs(struct llvmpipe_context *lp); void llvmpipe_update_derived( struct llvmpipe_context *llvmpipe ); -boolean llvmpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, +void llvmpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count); -boolean llvmpipe_draw_elements(struct pipe_context *pipe, +void llvmpipe_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count); -boolean +void llvmpipe_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, diff --git a/src/gallium/drivers/llvmpipe/lp_state_derived.c b/src/gallium/drivers/llvmpipe/lp_state_derived.c index acfd7be5f7..6c1ef6bc42 100644 --- a/src/gallium/drivers/llvmpipe/lp_state_derived.c +++ b/src/gallium/drivers/llvmpipe/lp_state_derived.c @@ -192,36 +192,6 @@ compute_cliprect(struct llvmpipe_context *lp) } -static void -update_tgsi_samplers( struct llvmpipe_context *llvmpipe ) -{ - unsigned i; - - /* vertex shader samplers */ - for (i = 0; i < PIPE_MAX_VERTEX_SAMPLERS; i++) { - llvmpipe->tgsi.vert_samplers[i].sampler = llvmpipe->vertex_samplers[i]; - llvmpipe->tgsi.vert_samplers[i].texture = llvmpipe->vertex_textures[i]; - llvmpipe->tgsi.vert_samplers[i].base.get_samples = lp_get_samples; - } - - for (i = 0; i < PIPE_MAX_VERTEX_SAMPLERS; i++) { - lp_tex_tile_cache_validate_texture( llvmpipe->vertex_tex_cache[i] ); - } - - /* fragment shader samplers */ - for (i = 0; i < PIPE_MAX_SAMPLERS; i++) { - llvmpipe->tgsi.frag_samplers[i].sampler = llvmpipe->sampler[i]; - llvmpipe->tgsi.frag_samplers[i].texture = llvmpipe->texture[i]; - llvmpipe->tgsi.frag_samplers[i].base.get_samples = lp_get_samples; - } - - for (i = 0; i < PIPE_MAX_SAMPLERS; i++) { - lp_tex_tile_cache_validate_texture( llvmpipe->tex_cache[i] ); - } - - llvmpipe->jit_context.samplers = (struct tgsi_sampler **)llvmpipe->tgsi.frag_samplers_list; -} - /* Hopefully this will remain quite simple, otherwise need to pull in * something like the state tracker mechanism. */ @@ -237,8 +207,9 @@ void llvmpipe_update_derived( struct llvmpipe_context *llvmpipe ) } if (llvmpipe->dirty & (LP_NEW_SAMPLER | - LP_NEW_TEXTURE)) - update_tgsi_samplers( llvmpipe ); + LP_NEW_TEXTURE)) { + /* TODO */ + } if (llvmpipe->dirty & (LP_NEW_RASTERIZER | LP_NEW_FS | diff --git a/src/gallium/drivers/llvmpipe/lp_state_fs.c b/src/gallium/drivers/llvmpipe/lp_state_fs.c index f2b8c36264..b73ca2d41e 100644 --- a/src/gallium/drivers/llvmpipe/lp_state_fs.c +++ b/src/gallium/drivers/llvmpipe/lp_state_fs.c @@ -453,8 +453,8 @@ generate_fragment(struct llvmpipe_context *lp, debug_dump_tex_mipfilter(key->sampler[i].min_mip_filter, TRUE)); debug_printf(" .mag_img_filter = %s\n", debug_dump_tex_filter(key->sampler[i].mag_img_filter, TRUE)); - if(key->sampler[i].compare_mode) - debug_printf(" .compare_mode = %s\n", debug_dump_func(key->sampler[i].compare_func, TRUE)); + if(key->sampler[i].compare_mode != PIPE_TEX_COMPARE_NONE) + debug_printf(" .compare_func = %s\n", debug_dump_func(key->sampler[i].compare_func, TRUE)); debug_printf(" .normalized_coords = %u\n", key->sampler[i].normalized_coords); debug_printf(" .prefilter = %u\n", key->sampler[i].prefilter); } @@ -550,13 +550,8 @@ generate_fragment(struct llvmpipe_context *lp, a0_ptr, dadx_ptr, dady_ptr, x0, y0, 2, 0); -#if 0 - /* C texture sampling */ - sampler = lp_c_sampler_soa_create(context_ptr); -#else /* code generated texture sampling */ sampler = lp_llvm_sampler_soa_create(key->sampler, context_ptr); -#endif for(i = 0; i < num_fs; ++i) { LLVMValueRef index = LLVMConstInt(LLVMInt32Type(), i, 0); diff --git a/src/gallium/drivers/llvmpipe/lp_test_conv.c b/src/gallium/drivers/llvmpipe/lp_test_conv.c index 968c7a2d4a..faddfb9677 100644 --- a/src/gallium/drivers/llvmpipe/lp_test_conv.c +++ b/src/gallium/drivers/llvmpipe/lp_test_conv.c @@ -330,7 +330,7 @@ test_one(unsigned verbose, fprintf(stderr, "conv.bc written\n"); fprintf(stderr, "Invoke as \"llc -o - conv.bc\"\n"); firsttime = FALSE; - //abort(); + /* abort(); */ } } diff --git a/src/gallium/drivers/llvmpipe/lp_tex_sample.h b/src/gallium/drivers/llvmpipe/lp_tex_sample.h index 9ad1bde956..cb59a94464 100644 --- a/src/gallium/drivers/llvmpipe/lp_tex_sample.h +++ b/src/gallium/drivers/llvmpipe/lp_tex_sample.h @@ -31,64 +31,11 @@ #include <llvm-c/Core.h> -#include "tgsi/tgsi_exec.h" - -struct llvmpipe_tex_tile_cache; struct lp_sampler_static_state; /** - * Subclass of tgsi_sampler - */ -struct lp_shader_sampler -{ - struct tgsi_sampler base; /**< base class */ - - unsigned processor; - - /* For lp_get_samples_2d_linear_POT: - */ - unsigned xpot; - unsigned ypot; - unsigned level; - - const struct pipe_texture *texture; - const struct pipe_sampler_state *sampler; - - struct llvmpipe_tex_tile_cache *cache; -}; - - - -static INLINE struct lp_shader_sampler * -lp_shader_sampler(const struct tgsi_sampler *sampler) -{ - return (struct lp_shader_sampler *) sampler; -} - - - -extern void -lp_get_samples(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]); - - -/** - * Texture sampling code generator that just calls lp_get_samples C function - * for the actual sampling computation. - * - * @param context_ptr LLVM value with the pointer to the struct lp_jit_context. - */ -struct lp_build_sampler_soa * -lp_c_sampler_soa_create(LLVMValueRef context_ptr); - - -/** * Pure-LLVM texture sampling code generator. * * @param context_ptr LLVM value with the pointer to the struct lp_jit_context. diff --git a/src/gallium/drivers/llvmpipe/lp_tex_sample_c.c b/src/gallium/drivers/llvmpipe/lp_tex_sample_c.c deleted file mode 100644 index 68520fa4f0..0000000000 --- a/src/gallium/drivers/llvmpipe/lp_tex_sample_c.c +++ /dev/null @@ -1,1713 +0,0 @@ -/************************************************************************** - * - * Copyright 2007 Tungsten Graphics, Inc., Cedar Park, Texas. - * All Rights Reserved. - * Copyright 2008 VMware, Inc. All rights reserved. - * - * Permission is hereby granted, free of charge, to any person obtaining a - * copy of this software and associated documentation files (the - * "Software"), to deal in the Software without restriction, including - * without limitation the rights to use, copy, modify, merge, publish, - * distribute, sub license, and/or sell copies of the Software, and to - * permit persons to whom the Software is furnished to do so, subject to - * the following conditions: - * - * The above copyright notice and this permission notice (including the - * next paragraph) shall be included in all copies or substantial portions - * of the Software. - * - * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS - * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF - * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. - * IN NO EVENT SHALL TUNGSTEN GRAPHICS AND/OR ITS SUPPLIERS BE LIABLE FOR - * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, - * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE - * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - * - **************************************************************************/ - -/** - * Texture sampling - * - * Authors: - * Brian Paul - */ - -#include "lp_context.h" -#include "lp_quad.h" -#include "lp_surface.h" -#include "lp_texture.h" -#include "lp_tex_sample.h" -#include "lp_tex_cache.h" -#include "pipe/p_context.h" -#include "pipe/p_defines.h" -#include "pipe/p_shader_tokens.h" -#include "util/u_math.h" -#include "util/u_memory.h" - - - -/* - * Note, the FRAC macro has to work perfectly. Otherwise you'll sometimes - * see 1-pixel bands of improperly weighted linear-filtered textures. - * The tests/texwrap.c demo is a good test. - * Also note, FRAC(x) doesn't truly return the fractional part of x for x < 0. - * Instead, if x < 0 then FRAC(x) = 1 - true_frac(x). - */ -#define FRAC(f) ((f) - util_ifloor(f)) - - -/** - * Linear interpolation macro - */ -static INLINE float -lerp(float a, float v0, float v1) -{ - return v0 + a * (v1 - v0); -} - - -/** - * Do 2D/biliner interpolation of float values. - * v00, v10, v01 and v11 are typically four texture samples in a square/box. - * a and b are the horizontal and vertical interpolants. - * It's important that this function is inlined when compiled with - * optimization! If we find that's not true on some systems, convert - * to a macro. - */ -static INLINE float -lerp_2d(float a, float b, - float v00, float v10, float v01, float v11) -{ - const float temp0 = lerp(a, v00, v10); - const float temp1 = lerp(a, v01, v11); - return lerp(b, temp0, temp1); -} - - -/** - * As above, but 3D interpolation of 8 values. - */ -static INLINE float -lerp_3d(float a, float b, float c, - float v000, float v100, float v010, float v110, - float v001, float v101, float v011, float v111) -{ - const float temp0 = lerp_2d(a, b, v000, v100, v010, v110); - const float temp1 = lerp_2d(a, b, v001, v101, v011, v111); - return lerp(c, temp0, temp1); -} - - - -/** - * If A is a signed integer, A % B doesn't give the right value for A < 0 - * (in terms of texture repeat). Just casting to unsigned fixes that. - */ -#define REMAINDER(A, B) ((unsigned) (A) % (unsigned) (B)) - - -/** - * Apply texture coord wrapping mode and return integer texture indexes - * for a vector of four texcoords (S or T or P). - * \param wrapMode PIPE_TEX_WRAP_x - * \param s the incoming texcoords - * \param size the texture image size - * \param icoord returns the integer texcoords - * \return integer texture index - */ -static INLINE void -nearest_texcoord_4(unsigned wrapMode, const float s[4], unsigned size, - int icoord[4]) -{ - uint ch; - switch (wrapMode) { - case PIPE_TEX_WRAP_REPEAT: - /* s limited to [0,1) */ - /* i limited to [0,size-1] */ - for (ch = 0; ch < 4; ch++) { - int i = util_ifloor(s[ch] * size); - icoord[ch] = REMAINDER(i, size); - } - return; - case PIPE_TEX_WRAP_CLAMP: - /* s limited to [0,1] */ - /* i limited to [0,size-1] */ - for (ch = 0; ch < 4; ch++) { - if (s[ch] <= 0.0F) - icoord[ch] = 0; - else if (s[ch] >= 1.0F) - icoord[ch] = size - 1; - else - icoord[ch] = util_ifloor(s[ch] * size); - } - return; - case PIPE_TEX_WRAP_CLAMP_TO_EDGE: - { - /* s limited to [min,max] */ - /* i limited to [0, size-1] */ - const float min = 1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - if (s[ch] < min) - icoord[ch] = 0; - else if (s[ch] > max) - icoord[ch] = size - 1; - else - icoord[ch] = util_ifloor(s[ch] * size); - } - } - return; - case PIPE_TEX_WRAP_CLAMP_TO_BORDER: - { - /* s limited to [min,max] */ - /* i limited to [-1, size] */ - const float min = -1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - if (s[ch] <= min) - icoord[ch] = -1; - else if (s[ch] >= max) - icoord[ch] = size; - else - icoord[ch] = util_ifloor(s[ch] * size); - } - } - return; - case PIPE_TEX_WRAP_MIRROR_REPEAT: - { - const float min = 1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - const int flr = util_ifloor(s[ch]); - float u; - if (flr & 1) - u = 1.0F - (s[ch] - (float) flr); - else - u = s[ch] - (float) flr; - if (u < min) - icoord[ch] = 0; - else if (u > max) - icoord[ch] = size - 1; - else - icoord[ch] = util_ifloor(u * size); - } - } - return; - case PIPE_TEX_WRAP_MIRROR_CLAMP: - for (ch = 0; ch < 4; ch++) { - /* s limited to [0,1] */ - /* i limited to [0,size-1] */ - const float u = fabsf(s[ch]); - if (u <= 0.0F) - icoord[ch] = 0; - else if (u >= 1.0F) - icoord[ch] = size - 1; - else - icoord[ch] = util_ifloor(u * size); - } - return; - case PIPE_TEX_WRAP_MIRROR_CLAMP_TO_EDGE: - { - /* s limited to [min,max] */ - /* i limited to [0, size-1] */ - const float min = 1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - const float u = fabsf(s[ch]); - if (u < min) - icoord[ch] = 0; - else if (u > max) - icoord[ch] = size - 1; - else - icoord[ch] = util_ifloor(u * size); - } - } - return; - case PIPE_TEX_WRAP_MIRROR_CLAMP_TO_BORDER: - { - /* s limited to [min,max] */ - /* i limited to [0, size-1] */ - const float min = -1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - const float u = fabsf(s[ch]); - if (u < min) - icoord[ch] = -1; - else if (u > max) - icoord[ch] = size; - else - icoord[ch] = util_ifloor(u * size); - } - } - return; - default: - assert(0); - } -} - - -/** - * Used to compute texel locations for linear sampling for four texcoords. - * \param wrapMode PIPE_TEX_WRAP_x - * \param s the texcoords - * \param size the texture image size - * \param icoord0 returns first texture indexes - * \param icoord1 returns second texture indexes (usually icoord0 + 1) - * \param w returns blend factor/weight between texture indexes - * \param icoord returns the computed integer texture coords - */ -static INLINE void -linear_texcoord_4(unsigned wrapMode, const float s[4], unsigned size, - int icoord0[4], int icoord1[4], float w[4]) -{ - uint ch; - - switch (wrapMode) { - case PIPE_TEX_WRAP_REPEAT: - for (ch = 0; ch < 4; ch++) { - float u = s[ch] * size - 0.5F; - icoord0[ch] = REMAINDER(util_ifloor(u), size); - icoord1[ch] = REMAINDER(icoord0[ch] + 1, size); - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_CLAMP: - for (ch = 0; ch < 4; ch++) { - float u = CLAMP(s[ch], 0.0F, 1.0F); - u = u * size - 0.5f; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_CLAMP_TO_EDGE: - for (ch = 0; ch < 4; ch++) { - float u = CLAMP(s[ch], 0.0F, 1.0F); - u = u * size - 0.5f; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - if (icoord0[ch] < 0) - icoord0[ch] = 0; - if (icoord1[ch] >= (int) size) - icoord1[ch] = size - 1; - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_CLAMP_TO_BORDER: - { - const float min = -1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - float u = CLAMP(s[ch], min, max); - u = u * size - 0.5f; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - w[ch] = FRAC(u); - } - } - break;; - case PIPE_TEX_WRAP_MIRROR_REPEAT: - for (ch = 0; ch < 4; ch++) { - const int flr = util_ifloor(s[ch]); - float u; - if (flr & 1) - u = 1.0F - (s[ch] - (float) flr); - else - u = s[ch] - (float) flr; - u = u * size - 0.5F; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - if (icoord0[ch] < 0) - icoord0[ch] = 0; - if (icoord1[ch] >= (int) size) - icoord1[ch] = size - 1; - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_MIRROR_CLAMP: - for (ch = 0; ch < 4; ch++) { - float u = fabsf(s[ch]); - if (u >= 1.0F) - u = (float) size; - else - u *= size; - u -= 0.5F; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_MIRROR_CLAMP_TO_EDGE: - for (ch = 0; ch < 4; ch++) { - float u = fabsf(s[ch]); - if (u >= 1.0F) - u = (float) size; - else - u *= size; - u -= 0.5F; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - if (icoord0[ch] < 0) - icoord0[ch] = 0; - if (icoord1[ch] >= (int) size) - icoord1[ch] = size - 1; - w[ch] = FRAC(u); - } - break;; - case PIPE_TEX_WRAP_MIRROR_CLAMP_TO_BORDER: - { - const float min = -1.0F / (2.0F * size); - const float max = 1.0F - min; - for (ch = 0; ch < 4; ch++) { - float u = fabsf(s[ch]); - if (u <= min) - u = min * size; - else if (u >= max) - u = max * size; - else - u *= size; - u -= 0.5F; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - w[ch] = FRAC(u); - } - } - break;; - default: - assert(0); - } -} - - -/** - * For RECT textures / unnormalized texcoords - * Only a subset of wrap modes supported. - */ -static INLINE void -nearest_texcoord_unnorm_4(unsigned wrapMode, const float s[4], unsigned size, - int icoord[4]) -{ - uint ch; - switch (wrapMode) { - case PIPE_TEX_WRAP_CLAMP: - for (ch = 0; ch < 4; ch++) { - int i = util_ifloor(s[ch]); - icoord[ch]= CLAMP(i, 0, (int) size-1); - } - return; - case PIPE_TEX_WRAP_CLAMP_TO_EDGE: - /* fall-through */ - case PIPE_TEX_WRAP_CLAMP_TO_BORDER: - for (ch = 0; ch < 4; ch++) { - icoord[ch]= util_ifloor( CLAMP(s[ch], 0.5F, (float) size - 0.5F) ); - } - return; - default: - assert(0); - } -} - - -/** - * For RECT textures / unnormalized texcoords. - * Only a subset of wrap modes supported. - */ -static INLINE void -linear_texcoord_unnorm_4(unsigned wrapMode, const float s[4], unsigned size, - int icoord0[4], int icoord1[4], float w[4]) -{ - uint ch; - switch (wrapMode) { - case PIPE_TEX_WRAP_CLAMP: - for (ch = 0; ch < 4; ch++) { - /* Not exactly what the spec says, but it matches NVIDIA output */ - float u = CLAMP(s[ch] - 0.5F, 0.0f, (float) size - 1.0f); - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - w[ch] = FRAC(u); - } - return; - case PIPE_TEX_WRAP_CLAMP_TO_EDGE: - /* fall-through */ - case PIPE_TEX_WRAP_CLAMP_TO_BORDER: - for (ch = 0; ch < 4; ch++) { - float u = CLAMP(s[ch], 0.5F, (float) size - 0.5F); - u -= 0.5F; - icoord0[ch] = util_ifloor(u); - icoord1[ch] = icoord0[ch] + 1; - if (icoord1[ch] > (int) size - 1) - icoord1[ch] = size - 1; - w[ch] = FRAC(u); - } - break; - default: - assert(0); - } -} - - -static unsigned -choose_cube_face(float rx, float ry, float rz, float *newS, float *newT) -{ - /* - major axis - direction target sc tc ma - ---------- ------------------------------- --- --- --- - +rx TEXTURE_CUBE_MAP_POSITIVE_X_EXT -rz -ry rx - -rx TEXTURE_CUBE_MAP_NEGATIVE_X_EXT +rz -ry rx - +ry TEXTURE_CUBE_MAP_POSITIVE_Y_EXT +rx +rz ry - -ry TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT +rx -rz ry - +rz TEXTURE_CUBE_MAP_POSITIVE_Z_EXT +rx -ry rz - -rz TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT -rx -ry rz - */ - const float arx = fabsf(rx), ary = fabsf(ry), arz = fabsf(rz); - unsigned face; - float sc, tc, ma; - - if (arx > ary && arx > arz) { - if (rx >= 0.0F) { - face = PIPE_TEX_FACE_POS_X; - sc = -rz; - tc = -ry; - ma = arx; - } - else { - face = PIPE_TEX_FACE_NEG_X; - sc = rz; - tc = -ry; - ma = arx; - } - } - else if (ary > arx && ary > arz) { - if (ry >= 0.0F) { - face = PIPE_TEX_FACE_POS_Y; - sc = rx; - tc = rz; - ma = ary; - } - else { - face = PIPE_TEX_FACE_NEG_Y; - sc = rx; - tc = -rz; - ma = ary; - } - } - else { - if (rz > 0.0F) { - face = PIPE_TEX_FACE_POS_Z; - sc = rx; - tc = -ry; - ma = arz; - } - else { - face = PIPE_TEX_FACE_NEG_Z; - sc = -rx; - tc = -ry; - ma = arz; - } - } - - *newS = ( sc / ma + 1.0F ) * 0.5F; - *newT = ( tc / ma + 1.0F ) * 0.5F; - - return face; -} - - -/** - * Examine the quad's texture coordinates to compute the partial - * derivatives w.r.t X and Y, then compute lambda (level of detail). - * - * This is only done for fragment shaders, not vertex shaders. - */ -static float -compute_lambda(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - float rho, lambda; - - if (samp->processor == TGSI_PROCESSOR_VERTEX) - return lodbias; - - assert(sampler->normalized_coords); - - assert(s); - { - float dsdx = s[QUAD_BOTTOM_RIGHT] - s[QUAD_BOTTOM_LEFT]; - float dsdy = s[QUAD_TOP_LEFT] - s[QUAD_BOTTOM_LEFT]; - dsdx = fabsf(dsdx); - dsdy = fabsf(dsdy); - rho = MAX2(dsdx, dsdy) * texture->width0; - } - if (t) { - float dtdx = t[QUAD_BOTTOM_RIGHT] - t[QUAD_BOTTOM_LEFT]; - float dtdy = t[QUAD_TOP_LEFT] - t[QUAD_BOTTOM_LEFT]; - float max; - dtdx = fabsf(dtdx); - dtdy = fabsf(dtdy); - max = MAX2(dtdx, dtdy) * texture->height0; - rho = MAX2(rho, max); - } - if (p) { - float dpdx = p[QUAD_BOTTOM_RIGHT] - p[QUAD_BOTTOM_LEFT]; - float dpdy = p[QUAD_TOP_LEFT] - p[QUAD_BOTTOM_LEFT]; - float max; - dpdx = fabsf(dpdx); - dpdy = fabsf(dpdy); - max = MAX2(dpdx, dpdy) * texture->depth0; - rho = MAX2(rho, max); - } - - lambda = util_fast_log2(rho); - lambda += lodbias + sampler->lod_bias; - lambda = CLAMP(lambda, sampler->min_lod, sampler->max_lod); - - return lambda; -} - - -/** - * Do several things here: - * 1. Compute lambda from the texcoords, if needed - * 2. Determine if we're minifying or magnifying - * 3. If minifying, choose mipmap levels - * 4. Return image filter to use within mipmap images - * \param level0 Returns first mipmap level to sample from - * \param level1 Returns second mipmap level to sample from - * \param levelBlend Returns blend factor between levels, in [0,1] - * \param imgFilter Returns either the min or mag filter, depending on lambda - */ -static void -choose_mipmap_levels(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - unsigned *level0, unsigned *level1, float *levelBlend, - unsigned *imgFilter) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - - if (sampler->min_mip_filter == PIPE_TEX_MIPFILTER_NONE) { - /* no mipmap selection needed */ - *level0 = *level1 = CLAMP((int) sampler->min_lod, - 0, (int) texture->last_level); - - if (sampler->min_img_filter != sampler->mag_img_filter) { - /* non-mipmapped texture, but still need to determine if doing - * minification or magnification. - */ - float lambda = compute_lambda(tgsi_sampler, s, t, p, lodbias); - if (lambda <= 0.0) { - *imgFilter = sampler->mag_img_filter; - } - else { - *imgFilter = sampler->min_img_filter; - } - } - else { - *imgFilter = sampler->mag_img_filter; - } - } - else { - float lambda = compute_lambda(tgsi_sampler, s, t, p, lodbias); - - if (lambda <= 0.0) { /* XXX threshold depends on the filter */ - /* magnifying */ - *imgFilter = sampler->mag_img_filter; - *level0 = *level1 = 0; - } - else { - /* minifying */ - *imgFilter = sampler->min_img_filter; - - /* choose mipmap level(s) and compute the blend factor between them */ - if (sampler->min_mip_filter == PIPE_TEX_MIPFILTER_NEAREST) { - /* Nearest mipmap level */ - const int lvl = (int) (lambda + 0.5); - *level0 = - *level1 = CLAMP(lvl, 0, (int) texture->last_level); - } - else { - /* Linear interpolation between mipmap levels */ - const int lvl = (int) lambda; - *level0 = CLAMP(lvl, 0, (int) texture->last_level); - *level1 = CLAMP(lvl + 1, 0, (int) texture->last_level); - *levelBlend = FRAC(lambda); /* blending weight between levels */ - } - } - } -} - - -/** - * Get a texel from a texture, using the texture tile cache. - * - * \param face the cube face in 0..5 - * \param level the mipmap level - * \param x the x coord of texel within 2D image - * \param y the y coord of texel within 2D image - * \param z which slice of a 3D texture - * \param rgba the quad to put the texel/color into - * \param j which element of the rgba quad to write to - * - * XXX maybe move this into lp_tile_cache.c and merge with the - * lp_get_cached_tile_tex() function. Also, get 4 texels instead of 1... - */ -static void -get_texel_quad_2d(const struct tgsi_sampler *tgsi_sampler, - unsigned face, unsigned level, int x, int y, - const uint8_t *out[4]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - - const struct llvmpipe_cached_tex_tile *tile - = lp_get_cached_tex_tile(samp->cache, - tex_tile_address(x, y, 0, face, level)); - - y %= TEX_TILE_SIZE; - x %= TEX_TILE_SIZE; - - out[0] = &tile->color[y ][x ][0]; - out[1] = &tile->color[y ][x+1][0]; - out[2] = &tile->color[y+1][x ][0]; - out[3] = &tile->color[y+1][x+1][0]; -} - -static INLINE const uint8_t * -get_texel_2d_ptr(const struct tgsi_sampler *tgsi_sampler, - unsigned face, unsigned level, int x, int y) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - - const struct llvmpipe_cached_tex_tile *tile - = lp_get_cached_tex_tile(samp->cache, - tex_tile_address(x, y, 0, face, level)); - - y %= TEX_TILE_SIZE; - x %= TEX_TILE_SIZE; - - return &tile->color[y][x][0]; -} - - -static void -get_texel_quad_2d_mt(const struct tgsi_sampler *tgsi_sampler, - unsigned face, unsigned level, - int x0, int y0, - int x1, int y1, - const uint8_t *out[4]) -{ - unsigned i; - - for (i = 0; i < 4; i++) { - unsigned tx = (i & 1) ? x1 : x0; - unsigned ty = (i >> 1) ? y1 : y0; - - out[i] = get_texel_2d_ptr( tgsi_sampler, face, level, tx, ty ); - } -} - -static void -get_texel(const struct tgsi_sampler *tgsi_sampler, - unsigned face, unsigned level, int x, int y, int z, - float rgba[NUM_CHANNELS][QUAD_SIZE], unsigned j) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - - if (x < 0 || x >= (int) u_minify(texture->width0, level) || - y < 0 || y >= (int) u_minify(texture->height0, level) || - z < 0 || z >= (int) u_minify(texture->depth0, level)) { - rgba[0][j] = sampler->border_color[0]; - rgba[1][j] = sampler->border_color[1]; - rgba[2][j] = sampler->border_color[2]; - rgba[3][j] = sampler->border_color[3]; - } - else { - const unsigned tx = x % TEX_TILE_SIZE; - const unsigned ty = y % TEX_TILE_SIZE; - const struct llvmpipe_cached_tex_tile *tile; - - tile = lp_get_cached_tex_tile(samp->cache, - tex_tile_address(x, y, z, face, level)); - - rgba[0][j] = ubyte_to_float(tile->color[ty][tx][0]); - rgba[1][j] = ubyte_to_float(tile->color[ty][tx][1]); - rgba[2][j] = ubyte_to_float(tile->color[ty][tx][2]); - rgba[3][j] = ubyte_to_float(tile->color[ty][tx][3]); - if (0) - { - debug_printf("Get texel %f %f %f %f from %s\n", - rgba[0][j], rgba[1][j], rgba[2][j], rgba[3][j], - pf_name(texture->format)); - } - } -} - - -/** - * Compare texcoord 'p' (aka R) against texture value 'rgba[0]' - * When we sampled the depth texture, the depth value was put into all - * RGBA channels. We look at the red channel here. - * \param rgba quad of (depth) texel values - * \param p texture 'P' components for four pixels in quad - * \param j which pixel in the quad to test [0..3] - */ -static INLINE void -shadow_compare(const struct pipe_sampler_state *sampler, - float rgba[NUM_CHANNELS][QUAD_SIZE], - const float p[QUAD_SIZE], - uint j) -{ - int k; - switch (sampler->compare_func) { - case PIPE_FUNC_LESS: - k = p[j] < rgba[0][j]; - break; - case PIPE_FUNC_LEQUAL: - k = p[j] <= rgba[0][j]; - break; - case PIPE_FUNC_GREATER: - k = p[j] > rgba[0][j]; - break; - case PIPE_FUNC_GEQUAL: - k = p[j] >= rgba[0][j]; - break; - case PIPE_FUNC_EQUAL: - k = p[j] == rgba[0][j]; - break; - case PIPE_FUNC_NOTEQUAL: - k = p[j] != rgba[0][j]; - break; - case PIPE_FUNC_ALWAYS: - k = 1; - break; - case PIPE_FUNC_NEVER: - k = 0; - break; - default: - k = 0; - assert(0); - break; - } - - /* XXX returning result for default GL_DEPTH_TEXTURE_MODE = GL_LUMINANCE */ - rgba[0][j] = rgba[1][j] = rgba[2][j] = (float) k; - rgba[3][j] = 1.0F; -} - - -/** - * As above, but do four z/texture comparisons. - */ -static INLINE void -shadow_compare4(const struct pipe_sampler_state *sampler, - float rgba[NUM_CHANNELS][QUAD_SIZE], - const float p[QUAD_SIZE]) -{ - int j, k0, k1, k2, k3; - float val; - - /* compare four texcoords vs. four texture samples */ - switch (sampler->compare_func) { - case PIPE_FUNC_LESS: - k0 = p[0] < rgba[0][0]; - k1 = p[1] < rgba[0][1]; - k2 = p[2] < rgba[0][2]; - k3 = p[3] < rgba[0][3]; - break; - case PIPE_FUNC_LEQUAL: - k0 = p[0] <= rgba[0][0]; - k1 = p[1] <= rgba[0][1]; - k2 = p[2] <= rgba[0][2]; - k3 = p[3] <= rgba[0][3]; - break; - case PIPE_FUNC_GREATER: - k0 = p[0] > rgba[0][0]; - k1 = p[1] > rgba[0][1]; - k2 = p[2] > rgba[0][2]; - k3 = p[3] > rgba[0][3]; - break; - case PIPE_FUNC_GEQUAL: - k0 = p[0] >= rgba[0][0]; - k1 = p[1] >= rgba[0][1]; - k2 = p[2] >= rgba[0][2]; - k3 = p[3] >= rgba[0][3]; - break; - case PIPE_FUNC_EQUAL: - k0 = p[0] == rgba[0][0]; - k1 = p[1] == rgba[0][1]; - k2 = p[2] == rgba[0][2]; - k3 = p[3] == rgba[0][3]; - break; - case PIPE_FUNC_NOTEQUAL: - k0 = p[0] != rgba[0][0]; - k1 = p[1] != rgba[0][1]; - k2 = p[2] != rgba[0][2]; - k3 = p[3] != rgba[0][3]; - break; - case PIPE_FUNC_ALWAYS: - k0 = k1 = k2 = k3 = 1; - break; - case PIPE_FUNC_NEVER: - k0 = k1 = k2 = k3 = 0; - break; - default: - k0 = k1 = k2 = k3 = 0; - assert(0); - break; - } - - /* convert four pass/fail values to an intensity in [0,1] */ - val = 0.25F * (k0 + k1 + k2 + k3); - - /* XXX returning result for default GL_DEPTH_TEXTURE_MODE = GL_LUMINANCE */ - for (j = 0; j < 4; j++) { - rgba[0][j] = rgba[1][j] = rgba[2][j] = val; - rgba[3][j] = 1.0F; - } -} - - - -static void -lp_get_samples_2d_linear_repeat_POT(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - unsigned j; - unsigned level = samp->level; - unsigned xpot = 1 << (samp->xpot - level); - unsigned ypot = 1 << (samp->ypot - level); - unsigned xmax = (xpot - 1) & (TEX_TILE_SIZE - 1); /* MIN2(TEX_TILE_SIZE, xpot) - 1; */ - unsigned ymax = (ypot - 1) & (TEX_TILE_SIZE - 1); /* MIN2(TEX_TILE_SIZE, ypot) - 1; */ - - for (j = 0; j < QUAD_SIZE; j++) { - int c; - - float u = s[j] * xpot - 0.5F; - float v = t[j] * ypot - 0.5F; - - int uflr = util_ifloor(u); - int vflr = util_ifloor(v); - - float xw = u - (float)uflr; - float yw = v - (float)vflr; - - int x0 = uflr & (xpot - 1); - int y0 = vflr & (ypot - 1); - - const uint8_t *tx[4]; - - - /* Can we fetch all four at once: - */ - if (x0 < xmax && y0 < ymax) - { - get_texel_quad_2d(tgsi_sampler, 0, level, x0, y0, tx); - } - else - { - unsigned x1 = (x0 + 1) & (xpot - 1); - unsigned y1 = (y0 + 1) & (ypot - 1); - get_texel_quad_2d_mt(tgsi_sampler, 0, level, - x0, y0, x1, y1, tx); - } - - - /* interpolate R, G, B, A */ - for (c = 0; c < 4; c++) { - rgba[c][j] = lerp_2d(xw, yw, - ubyte_to_float(tx[0][c]), ubyte_to_float(tx[1][c]), - ubyte_to_float(tx[2][c]), ubyte_to_float(tx[3][c])); - } - } -} - - -static void -lp_get_samples_2d_nearest_repeat_POT(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - unsigned j; - unsigned level = samp->level; - unsigned xpot = 1 << (samp->xpot - level); - unsigned ypot = 1 << (samp->ypot - level); - - for (j = 0; j < QUAD_SIZE; j++) { - int c; - - float u = s[j] * xpot; - float v = t[j] * ypot; - - int uflr = util_ifloor(u); - int vflr = util_ifloor(v); - - int x0 = uflr & (xpot - 1); - int y0 = vflr & (ypot - 1); - - const uint8_t *out = get_texel_2d_ptr(tgsi_sampler, 0, level, x0, y0); - - for (c = 0; c < 4; c++) { - rgba[c][j] = ubyte_to_float(out[c]); - } - } -} - - -static void -lp_get_samples_2d_nearest_clamp_POT(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - unsigned j; - unsigned level = samp->level; - unsigned xpot = 1 << (samp->xpot - level); - unsigned ypot = 1 << (samp->ypot - level); - - for (j = 0; j < QUAD_SIZE; j++) { - int c; - - float u = s[j] * xpot; - float v = t[j] * ypot; - - int x0, y0; - const uint8_t *out; - - x0 = util_ifloor(u); - if (x0 < 0) - x0 = 0; - else if (x0 > xpot - 1) - x0 = xpot - 1; - - y0 = util_ifloor(v); - if (y0 < 0) - y0 = 0; - else if (y0 > ypot - 1) - y0 = ypot - 1; - - out = get_texel_2d_ptr(tgsi_sampler, 0, level, x0, y0); - - for (c = 0; c < 4; c++) { - rgba[c][j] = ubyte_to_float(out[c]); - } - } -} - - -static void -lp_get_samples_2d_linear_mip_linear_repeat_POT(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - int level0; - float lambda; - - lambda = compute_lambda(tgsi_sampler, s, t, p, lodbias); - level0 = (int)lambda; - - if (lambda < 0.0) { - samp->level = 0; - lp_get_samples_2d_linear_repeat_POT( tgsi_sampler, - s, t, p, 0, rgba ); - } - else if (level0 >= texture->last_level) { - samp->level = texture->last_level; - lp_get_samples_2d_linear_repeat_POT( tgsi_sampler, - s, t, p, 0, rgba ); - } - else { - float levelBlend = lambda - level0; - float rgba0[4][4]; - float rgba1[4][4]; - int c,j; - - samp->level = level0; - lp_get_samples_2d_linear_repeat_POT( tgsi_sampler, - s, t, p, 0, rgba0 ); - - samp->level = level0+1; - lp_get_samples_2d_linear_repeat_POT( tgsi_sampler, - s, t, p, 0, rgba1 ); - - for (j = 0; j < QUAD_SIZE; j++) { - for (c = 0; c < 4; c++) { - rgba[c][j] = lerp(levelBlend, rgba0[c][j], rgba1[c][j]); - } - } - } -} - -/** - * Common code for sampling 1D/2D/cube textures. - * Could probably extend for 3D... - */ -static void -lp_get_samples_2d_common(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE], - const unsigned faces[4]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - unsigned level0, level1, j, imgFilter; - int width, height; - float levelBlend = 0.0f; - - choose_mipmap_levels(tgsi_sampler, s, t, p, - lodbias, - &level0, &level1, &levelBlend, &imgFilter); - - assert(sampler->normalized_coords); - - width = u_minify(texture->width0, level0); - height = u_minify(texture->height0, level0); - - assert(width > 0); - - switch (imgFilter) { - case PIPE_TEX_FILTER_NEAREST: - { - int x[4], y[4]; - nearest_texcoord_4(sampler->wrap_s, s, width, x); - nearest_texcoord_4(sampler->wrap_t, t, height, y); - - for (j = 0; j < QUAD_SIZE; j++) { - get_texel(tgsi_sampler, faces[j], level0, x[j], y[j], 0, rgba, j); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE) { - shadow_compare(sampler, rgba, p, j); - } - - if (level0 != level1) { - /* get texels from second mipmap level and blend */ - float rgba2[4][4]; - unsigned c; - x[j] /= 2; - y[j] /= 2; - get_texel(tgsi_sampler, faces[j], level1, x[j], y[j], 0, - rgba2, j); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE){ - shadow_compare(sampler, rgba2, p, j); - } - - for (c = 0; c < NUM_CHANNELS; c++) { - rgba[c][j] = lerp(levelBlend, rgba[c][j], rgba2[c][j]); - } - } - } - } - break; - case PIPE_TEX_FILTER_LINEAR: - case PIPE_TEX_FILTER_ANISO: - { - int x0[4], y0[4], x1[4], y1[4]; - float xw[4], yw[4]; /* weights */ - - linear_texcoord_4(sampler->wrap_s, s, width, x0, x1, xw); - linear_texcoord_4(sampler->wrap_t, t, height, y0, y1, yw); - - for (j = 0; j < QUAD_SIZE; j++) { - float tx[4][4]; /* texels */ - int c; - get_texel(tgsi_sampler, faces[j], level0, x0[j], y0[j], 0, tx, 0); - get_texel(tgsi_sampler, faces[j], level0, x1[j], y0[j], 0, tx, 1); - get_texel(tgsi_sampler, faces[j], level0, x0[j], y1[j], 0, tx, 2); - get_texel(tgsi_sampler, faces[j], level0, x1[j], y1[j], 0, tx, 3); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE) { - shadow_compare4(sampler, tx, p); - } - - /* interpolate R, G, B, A */ - for (c = 0; c < 4; c++) { - rgba[c][j] = lerp_2d(xw[j], yw[j], - tx[c][0], tx[c][1], - tx[c][2], tx[c][3]); - } - - if (level0 != level1) { - /* get texels from second mipmap level and blend */ - float rgba2[4][4]; - - /* XXX: This is incorrect -- will often end up with (x0 - * == x1 && y0 == y1), meaning that we fetch the same - * texel four times and linearly interpolate between - * identical values. The correct approach would be to - * call linear_texcoord again for the second level. - */ - x0[j] /= 2; - y0[j] /= 2; - x1[j] /= 2; - y1[j] /= 2; - get_texel(tgsi_sampler, faces[j], level1, x0[j], y0[j], 0, tx, 0); - get_texel(tgsi_sampler, faces[j], level1, x1[j], y0[j], 0, tx, 1); - get_texel(tgsi_sampler, faces[j], level1, x0[j], y1[j], 0, tx, 2); - get_texel(tgsi_sampler, faces[j], level1, x1[j], y1[j], 0, tx, 3); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE){ - shadow_compare4(sampler, tx, p); - } - - /* interpolate R, G, B, A */ - for (c = 0; c < 4; c++) { - rgba2[c][j] = lerp_2d(xw[j], yw[j], - tx[c][0], tx[c][1], tx[c][2], tx[c][3]); - } - - for (c = 0; c < NUM_CHANNELS; c++) { - rgba[c][j] = lerp(levelBlend, rgba[c][j], rgba2[c][j]); - } - } - } - } - break; - default: - assert(0); - } -} - - -static INLINE void -lp_get_samples_1d(struct tgsi_sampler *sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - static const unsigned faces[4] = {0, 0, 0, 0}; - static const float tzero[4] = {0, 0, 0, 0}; - lp_get_samples_2d_common(sampler, s, tzero, NULL, - lodbias, rgba, faces); -} - - -static INLINE void -lp_get_samples_2d(struct tgsi_sampler *sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - static const unsigned faces[4] = {0, 0, 0, 0}; - lp_get_samples_2d_common(sampler, s, t, p, - lodbias, rgba, faces); -} - - -static INLINE void -lp_get_samples_3d(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - /* get/map pipe_surfaces corresponding to 3D tex slices */ - unsigned level0, level1, j, imgFilter; - int width, height, depth; - float levelBlend = 0.0f; - const uint face = 0; - - choose_mipmap_levels(tgsi_sampler, s, t, p, - lodbias, - &level0, &level1, &levelBlend, &imgFilter); - - assert(sampler->normalized_coords); - - width = u_minify(texture->width0, level0); - height = u_minify(texture->height0, level0); - depth = u_minify(texture->depth0, level0); - - assert(width > 0); - assert(height > 0); - assert(depth > 0); - - switch (imgFilter) { - case PIPE_TEX_FILTER_NEAREST: - { - int x[4], y[4], z[4]; - nearest_texcoord_4(sampler->wrap_s, s, width, x); - nearest_texcoord_4(sampler->wrap_t, t, height, y); - nearest_texcoord_4(sampler->wrap_r, p, depth, z); - for (j = 0; j < QUAD_SIZE; j++) { - get_texel(tgsi_sampler, face, level0, x[j], y[j], z[j], rgba, j); - if (level0 != level1) { - /* get texels from second mipmap level and blend */ - float rgba2[4][4]; - unsigned c; - x[j] /= 2; - y[j] /= 2; - z[j] /= 2; - get_texel(tgsi_sampler, face, level1, x[j], y[j], z[j], rgba2, j); - for (c = 0; c < NUM_CHANNELS; c++) { - rgba[c][j] = lerp(levelBlend, rgba2[c][j], rgba[c][j]); - } - } - } - } - break; - case PIPE_TEX_FILTER_LINEAR: - case PIPE_TEX_FILTER_ANISO: - { - int x0[4], x1[4], y0[4], y1[4], z0[4], z1[4]; - float xw[4], yw[4], zw[4]; /* interpolation weights */ - linear_texcoord_4(sampler->wrap_s, s, width, x0, x1, xw); - linear_texcoord_4(sampler->wrap_t, t, height, y0, y1, yw); - linear_texcoord_4(sampler->wrap_r, p, depth, z0, z1, zw); - - for (j = 0; j < QUAD_SIZE; j++) { - int c; - float tx0[4][4], tx1[4][4]; - get_texel(tgsi_sampler, face, level0, x0[j], y0[j], z0[j], tx0, 0); - get_texel(tgsi_sampler, face, level0, x1[j], y0[j], z0[j], tx0, 1); - get_texel(tgsi_sampler, face, level0, x0[j], y1[j], z0[j], tx0, 2); - get_texel(tgsi_sampler, face, level0, x1[j], y1[j], z0[j], tx0, 3); - get_texel(tgsi_sampler, face, level0, x0[j], y0[j], z1[j], tx1, 0); - get_texel(tgsi_sampler, face, level0, x1[j], y0[j], z1[j], tx1, 1); - get_texel(tgsi_sampler, face, level0, x0[j], y1[j], z1[j], tx1, 2); - get_texel(tgsi_sampler, face, level0, x1[j], y1[j], z1[j], tx1, 3); - - /* interpolate R, G, B, A */ - for (c = 0; c < 4; c++) { - rgba[c][j] = lerp_3d(xw[j], yw[j], zw[j], - tx0[c][0], tx0[c][1], - tx0[c][2], tx0[c][3], - tx1[c][0], tx1[c][1], - tx1[c][2], tx1[c][3]); - } - - if (level0 != level1) { - /* get texels from second mipmap level and blend */ - float rgba2[4][4]; - x0[j] /= 2; - y0[j] /= 2; - z0[j] /= 2; - x1[j] /= 2; - y1[j] /= 2; - z1[j] /= 2; - get_texel(tgsi_sampler, face, level1, x0[j], y0[j], z0[j], tx0, 0); - get_texel(tgsi_sampler, face, level1, x1[j], y0[j], z0[j], tx0, 1); - get_texel(tgsi_sampler, face, level1, x0[j], y1[j], z0[j], tx0, 2); - get_texel(tgsi_sampler, face, level1, x1[j], y1[j], z0[j], tx0, 3); - get_texel(tgsi_sampler, face, level1, x0[j], y0[j], z1[j], tx1, 0); - get_texel(tgsi_sampler, face, level1, x1[j], y0[j], z1[j], tx1, 1); - get_texel(tgsi_sampler, face, level1, x0[j], y1[j], z1[j], tx1, 2); - get_texel(tgsi_sampler, face, level1, x1[j], y1[j], z1[j], tx1, 3); - - /* interpolate R, G, B, A */ - for (c = 0; c < 4; c++) { - rgba2[c][j] = lerp_3d(xw[j], yw[j], zw[j], - tx0[c][0], tx0[c][1], - tx0[c][2], tx0[c][3], - tx1[c][0], tx1[c][1], - tx1[c][2], tx1[c][3]); - } - - /* blend mipmap levels */ - for (c = 0; c < NUM_CHANNELS; c++) { - rgba[c][j] = lerp(levelBlend, rgba[c][j], rgba2[c][j]); - } - } - } - } - break; - default: - assert(0); - } -} - - -static void -lp_get_samples_cube(struct tgsi_sampler *sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - unsigned faces[QUAD_SIZE], j; - float ssss[4], tttt[4]; - for (j = 0; j < QUAD_SIZE; j++) { - faces[j] = choose_cube_face(s[j], t[j], p[j], ssss + j, tttt + j); - } - lp_get_samples_2d_common(sampler, ssss, tttt, NULL, - lodbias, rgba, faces); -} - - -static void -lp_get_samples_rect(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - const struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - const uint face = 0; - unsigned level0, level1, j, imgFilter; - int width, height; - float levelBlend; - - choose_mipmap_levels(tgsi_sampler, s, t, p, - lodbias, - &level0, &level1, &levelBlend, &imgFilter); - - /* texture RECTS cannot be mipmapped */ - assert(level0 == level1); - - width = u_minify(texture->width0, level0); - height = u_minify(texture->height0, level0); - - assert(width > 0); - - switch (imgFilter) { - case PIPE_TEX_FILTER_NEAREST: - { - int x[4], y[4]; - nearest_texcoord_unnorm_4(sampler->wrap_s, s, width, x); - nearest_texcoord_unnorm_4(sampler->wrap_t, t, height, y); - for (j = 0; j < QUAD_SIZE; j++) { - get_texel(tgsi_sampler, face, level0, x[j], y[j], 0, rgba, j); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE) { - shadow_compare(sampler, rgba, p, j); - } - } - } - break; - case PIPE_TEX_FILTER_LINEAR: - case PIPE_TEX_FILTER_ANISO: - { - int x0[4], y0[4], x1[4], y1[4]; - float xw[4], yw[4]; /* weights */ - linear_texcoord_unnorm_4(sampler->wrap_s, s, width, x0, x1, xw); - linear_texcoord_unnorm_4(sampler->wrap_t, t, height, y0, y1, yw); - for (j = 0; j < QUAD_SIZE; j++) { - float tx[4][4]; /* texels */ - int c; - get_texel(tgsi_sampler, face, level0, x0[j], y0[j], 0, tx, 0); - get_texel(tgsi_sampler, face, level0, x1[j], y0[j], 0, tx, 1); - get_texel(tgsi_sampler, face, level0, x0[j], y1[j], 0, tx, 2); - get_texel(tgsi_sampler, face, level0, x1[j], y1[j], 0, tx, 3); - if (sampler->compare_mode == PIPE_TEX_COMPARE_R_TO_TEXTURE) { - shadow_compare4(sampler, tx, p); - } - for (c = 0; c < 4; c++) { - rgba[c][j] = lerp_2d(xw[j], yw[j], - tx[c][0], tx[c][1], tx[c][2], tx[c][3]); - } - } - } - break; - default: - assert(0); - } -} - - -/** - * Error condition handler - */ -static INLINE void -lp_get_samples_null(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - int i,j; - - for (i = 0; i < 4; i++) - for (j = 0; j < 4; j++) - rgba[i][j] = 1.0; -} - -/** - * Called via tgsi_sampler::get_samples() when using a sampler for the - * first time. Determine the actual sampler function, link it in and - * call it. - */ -void -lp_get_samples(struct tgsi_sampler *tgsi_sampler, - const float s[QUAD_SIZE], - const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias, - float rgba[NUM_CHANNELS][QUAD_SIZE]) -{ - struct lp_shader_sampler *samp = lp_shader_sampler(tgsi_sampler); - const struct pipe_texture *texture = samp->texture; - const struct pipe_sampler_state *sampler = samp->sampler; - - /* Default to the 'undefined' case: - */ - tgsi_sampler->get_samples = lp_get_samples_null; - - if (!texture) { - assert(0); /* is this legal?? */ - goto out; - } - - if (!sampler->normalized_coords) { - assert (texture->target == PIPE_TEXTURE_2D); - tgsi_sampler->get_samples = lp_get_samples_rect; - goto out; - } - - switch (texture->target) { - case PIPE_TEXTURE_1D: - tgsi_sampler->get_samples = lp_get_samples_1d; - break; - case PIPE_TEXTURE_2D: - tgsi_sampler->get_samples = lp_get_samples_2d; - break; - case PIPE_TEXTURE_3D: - tgsi_sampler->get_samples = lp_get_samples_3d; - break; - case PIPE_TEXTURE_CUBE: - tgsi_sampler->get_samples = lp_get_samples_cube; - break; - default: - assert(0); - break; - } - - /* Do this elsewhere: - */ - samp->xpot = util_unsigned_logbase2( samp->texture->width0 ); - samp->ypot = util_unsigned_logbase2( samp->texture->height0 ); - - /* Try to hook in a faster sampler. Ultimately we'll have to - * code-generate these. Luckily most of this looks like it is - * orthogonal state within the sampler. - */ - if (texture->target == PIPE_TEXTURE_2D && - sampler->min_img_filter == sampler->mag_img_filter && - sampler->wrap_s == sampler->wrap_t && - sampler->compare_mode == FALSE && - sampler->normalized_coords) - { - if (sampler->min_mip_filter == PIPE_TEX_MIPFILTER_NONE) { - samp->level = CLAMP((int) sampler->min_lod, - 0, (int) texture->last_level); - - if (sampler->wrap_s == PIPE_TEX_WRAP_REPEAT) { - switch (sampler->min_img_filter) { - case PIPE_TEX_FILTER_NEAREST: - tgsi_sampler->get_samples = lp_get_samples_2d_nearest_repeat_POT; - break; - case PIPE_TEX_FILTER_LINEAR: - tgsi_sampler->get_samples = lp_get_samples_2d_linear_repeat_POT; - break; - default: - break; - } - } - else if (sampler->wrap_s == PIPE_TEX_WRAP_CLAMP) { - switch (sampler->min_img_filter) { - case PIPE_TEX_FILTER_NEAREST: - tgsi_sampler->get_samples = lp_get_samples_2d_nearest_clamp_POT; - break; - default: - break; - } - } - } - else if (sampler->min_mip_filter == PIPE_TEX_MIPFILTER_LINEAR) { - if (sampler->wrap_s == PIPE_TEX_WRAP_REPEAT) { - switch (sampler->min_img_filter) { - case PIPE_TEX_FILTER_LINEAR: - tgsi_sampler->get_samples = lp_get_samples_2d_linear_mip_linear_repeat_POT; - break; - default: - break; - } - } - } - } - else if (0) { - _debug_printf("target %d/%d min_mip %d/%d min_img %d/%d wrap %d/%d compare %d/%d norm %d/%d\n", - texture->target, PIPE_TEXTURE_2D, - sampler->min_mip_filter, PIPE_TEX_MIPFILTER_NONE, - sampler->min_img_filter, sampler->mag_img_filter, - sampler->wrap_s, sampler->wrap_t, - sampler->compare_mode, FALSE, - sampler->normalized_coords, TRUE); - } - -out: - tgsi_sampler->get_samples( tgsi_sampler, s, t, p, lodbias, rgba ); -} - - -void PIPE_CDECL -lp_fetch_texel_soa( struct tgsi_sampler **samplers, - uint32_t unit, - float *store ) -{ - struct tgsi_sampler *sampler = samplers[unit]; - -#if 0 - uint j; - - debug_printf("%s sampler: %p (%p) store: %p\n", - __FUNCTION__, - sampler, *sampler, - store ); - - debug_printf("lodbias %f\n", store[12]); - - for (j = 0; j < 4; j++) - debug_printf("sample %d texcoord %f %f\n", - j, - store[0+j], - store[4+j]); -#endif - - { - float rgba[NUM_CHANNELS][QUAD_SIZE]; - sampler->get_samples(sampler, - &store[0], - &store[4], - &store[8], - 0.0f, /*store[12], lodbias */ - rgba); - memcpy(store, rgba, sizeof rgba); - } - -#if 0 - for (j = 0; j < 4; j++) - debug_printf("sample %d result %f %f %f %f\n", - j, - store[0+j], - store[4+j], - store[8+j], - store[12+j]); -#endif -} - - -#include "lp_bld_type.h" -#include "lp_bld_intr.h" -#include "lp_bld_tgsi.h" - - -struct lp_c_sampler_soa -{ - struct lp_build_sampler_soa base; - - LLVMValueRef context_ptr; - - LLVMValueRef samplers_ptr; - - /** Coords/texels store */ - LLVMValueRef store_ptr; -}; - - -static void -lp_c_sampler_soa_destroy(struct lp_build_sampler_soa *sampler) -{ - FREE(sampler); -} - - -static void -lp_c_sampler_soa_emit_fetch_texel(struct lp_build_sampler_soa *_sampler, - LLVMBuilderRef builder, - struct lp_type type, - unsigned unit, - unsigned num_coords, - const LLVMValueRef *coords, - LLVMValueRef lodbias, - LLVMValueRef *texel) -{ - struct lp_c_sampler_soa *sampler = (struct lp_c_sampler_soa *)_sampler; - LLVMTypeRef vec_type = LLVMTypeOf(coords[0]); - LLVMValueRef args[3]; - unsigned i; - - if(!sampler->samplers_ptr) - sampler->samplers_ptr = lp_jit_context_samplers(builder, sampler->context_ptr); - - if(!sampler->store_ptr) - sampler->store_ptr = LLVMBuildArrayAlloca(builder, - vec_type, - LLVMConstInt(LLVMInt32Type(), 4, 0), - "texel_store"); - - for (i = 0; i < num_coords; i++) { - LLVMValueRef index = LLVMConstInt(LLVMInt32Type(), i, 0); - LLVMValueRef coord_ptr = LLVMBuildGEP(builder, sampler->store_ptr, &index, 1, ""); - LLVMBuildStore(builder, coords[i], coord_ptr); - } - - args[0] = sampler->samplers_ptr; - args[1] = LLVMConstInt(LLVMInt32Type(), unit, 0); - args[2] = sampler->store_ptr; - - lp_build_intrinsic(builder, "fetch_texel", LLVMVoidType(), args, 3); - - for (i = 0; i < NUM_CHANNELS; ++i) { - LLVMValueRef index = LLVMConstInt(LLVMInt32Type(), i, 0); - LLVMValueRef texel_ptr = LLVMBuildGEP(builder, sampler->store_ptr, &index, 1, ""); - texel[i] = LLVMBuildLoad(builder, texel_ptr, ""); - } -} - - -struct lp_build_sampler_soa * -lp_c_sampler_soa_create(LLVMValueRef context_ptr) -{ - struct lp_c_sampler_soa *sampler; - - sampler = CALLOC_STRUCT(lp_c_sampler_soa); - if(!sampler) - return NULL; - - sampler->base.destroy = lp_c_sampler_soa_destroy; - sampler->base.emit_fetch_texel = lp_c_sampler_soa_emit_fetch_texel; - sampler->context_ptr = context_ptr; - - return &sampler->base; -} - diff --git a/src/gallium/drivers/nouveau/nouveau_push.h b/src/gallium/drivers/nouveau/nouveau_push.h deleted file mode 100644 index 9c235080a5..0000000000 --- a/src/gallium/drivers/nouveau/nouveau_push.h +++ /dev/null @@ -1,93 +0,0 @@ -#ifndef __NOUVEAU_PUSH_H__ -#define __NOUVEAU_PUSH_H__ - -#include "nouveau/nouveau_winsys.h" - -#ifndef NOUVEAU_PUSH_CONTEXT -#error undefined push context -#endif - -#define OUT_RING(data) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - (*pc->base.channel->pushbuf->cur++) = (data); \ -} while(0) - -#define OUT_RINGp(src,size) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - memcpy(pc->base.channel->pushbuf->cur, (src), (size) * 4); \ - pc->base.channel->pushbuf->cur += (size); \ -} while(0) - -#define OUT_RINGf(data) do { \ - union { float v; uint32_t u; } c; \ - c.v = (data); \ - OUT_RING(c.u); \ -} while(0) - -#define BEGIN_RING(obj,mthd,size) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - struct nouveau_channel *chan = pc->base.channel; \ - if (chan->pushbuf->remaining < ((size) + 1)) \ - nouveau_pushbuf_flush(chan, ((size) + 1)); \ - OUT_RING((pc->obj->subc << 13) | ((size) << 18) | (mthd)); \ - chan->pushbuf->remaining -= ((size) + 1); \ -} while(0) - -#define BEGIN_RING_NI(obj,mthd,size) do { \ - BEGIN_RING(obj, (mthd) | 0x40000000, (size)); \ -} while(0) - -static inline void -DO_FIRE_RING(struct nouveau_channel *chan, struct pipe_fence_handle **fence) -{ - nouveau_pushbuf_flush(chan, 0); - if (fence) - *fence = NULL; -} - -#define FIRE_RING(fence) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - DO_FIRE_RING(pc->base.channel, fence); \ -} while(0) - -#define OUT_RELOC(bo,data,flags,vor,tor) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - struct nouveau_channel *chan = pc->base.channel; \ - nouveau_pushbuf_emit_reloc(chan, chan->pushbuf->cur++, nouveau_bo(bo), \ - (data), 0, (flags), (vor), (tor)); \ -} while(0) - -/* Raw data + flags depending on FB/TT buffer */ -#define OUT_RELOCd(bo,data,flags,vor,tor) do { \ - OUT_RELOC((bo), (data), (flags) | NOUVEAU_BO_OR, (vor), (tor)); \ -} while(0) - -/* FB/TT object handle */ -#define OUT_RELOCo(bo,flags) do { \ - OUT_RELOC((bo), 0, (flags) | NOUVEAU_BO_OR, \ - pc->base.channel->vram->handle, \ - pc->base.channel->gart->handle); \ -} while(0) - -/* Low 32-bits of offset */ -#define OUT_RELOCl(bo,delta,flags) do { \ - OUT_RELOC((bo), (delta), (flags) | NOUVEAU_BO_LOW, 0, 0); \ -} while(0) - -/* High 32-bits of offset */ -#define OUT_RELOCh(bo,delta,flags) do { \ - OUT_RELOC((bo), (delta), (flags) | NOUVEAU_BO_HIGH, 0, 0); \ -} while(0) - -/* A reloc which'll recombine into a NV_DMA_METHOD packet header */ -#define OUT_RELOCm(bo, flags, obj, mthd, size) do { \ - NOUVEAU_PUSH_CONTEXT(pc); \ - struct nouveau_channel *chan = pc->base.channel; \ - if (chan->pushbuf->remaining < ((size) + 1)) \ - nouveau_pushbuf_flush(chan, ((size) + 1)); \ - OUT_RELOCd((bo), (pc->obj->subc << 13) | ((size) << 18) | (mthd), \ - (flags), 0, 0); \ - chan->pushbuf->remaining -= ((size) + 1); \ -} while(0) - -#endif diff --git a/src/gallium/drivers/nouveau/nouveau_screen.c b/src/gallium/drivers/nouveau/nouveau_screen.c index 0437af3725..7ebc94ed6c 100644 --- a/src/gallium/drivers/nouveau/nouveau_screen.c +++ b/src/gallium/drivers/nouveau/nouveau_screen.c @@ -127,8 +127,18 @@ nouveau_screen_bo_map(struct pipe_screen *pscreen, struct pipe_buffer *pb, unsigned usage) { struct nouveau_bo *bo = nouveau_bo(pb); + struct nouveau_screen *nscreen = nouveau_screen(pscreen); int ret; + if (nscreen->pre_pipebuffer_map_callback) { + ret = nscreen->pre_pipebuffer_map_callback(pscreen, pb, usage); + if (ret) { + debug_printf("pre_pipebuffer_map_callback failed %d\n", + ret); + return NULL; + } + } + ret = nouveau_bo_map(bo, nouveau_screen_map_flags(usage)); if (ret) { debug_printf("map failed: %d\n", ret); @@ -143,11 +153,22 @@ nouveau_screen_bo_map_range(struct pipe_screen *pscreen, struct pipe_buffer *pb, unsigned offset, unsigned length, unsigned usage) { struct nouveau_bo *bo = nouveau_bo(pb); + struct nouveau_screen *nscreen = nouveau_screen(pscreen); uint32_t flags = nouveau_screen_map_flags(usage); int ret; + if (nscreen->pre_pipebuffer_map_callback) { + ret = nscreen->pre_pipebuffer_map_callback(pscreen, pb, usage); + if (ret) { + debug_printf("pre_pipebuffer_map_callback failed %d\n", + ret); + return NULL; + } + } + ret = nouveau_bo_map_range(bo, offset, length, flags); if (ret) { + nouveau_bo_unmap(bo); if (!(flags & NOUVEAU_BO_NOWAIT) || ret != -EBUSY) debug_printf("map_range failed: %d\n", ret); return NULL; diff --git a/src/gallium/drivers/nouveau/nouveau_screen.h b/src/gallium/drivers/nouveau/nouveau_screen.h index ebfc67ad1c..a7927d88df 100644 --- a/src/gallium/drivers/nouveau/nouveau_screen.h +++ b/src/gallium/drivers/nouveau/nouveau_screen.h @@ -5,6 +5,9 @@ struct nouveau_screen { struct pipe_screen base; struct nouveau_device *device; struct nouveau_channel *channel; + + int (*pre_pipebuffer_map_callback) (struct pipe_screen *pscreen, + struct pipe_buffer *pb, unsigned usage); }; static inline struct nouveau_screen * diff --git a/src/gallium/drivers/nouveau/nouveau_stateobj.h b/src/gallium/drivers/nouveau/nouveau_stateobj.h index 9aee9e4956..e844f6abb3 100644 --- a/src/gallium/drivers/nouveau/nouveau_stateobj.h +++ b/src/gallium/drivers/nouveau/nouveau_stateobj.h @@ -3,41 +3,95 @@ #include "util/u_debug.h" +#ifdef DEBUG +#define DEBUG_NOUVEAU_STATEOBJ +#endif /* DEBUG */ + struct nouveau_stateobj_reloc { struct nouveau_bo *bo; - unsigned offset; - unsigned packet; + struct nouveau_grobj *gr; + uint32_t push_offset; + uint32_t mthd; - unsigned data; + uint32_t data; unsigned flags; unsigned vor; unsigned tor; }; +struct nouveau_stateobj_start { + struct nouveau_grobj *gr; + uint32_t mthd; + uint32_t size; + unsigned offset; +}; + struct nouveau_stateobj { struct pipe_reference reference; - unsigned *push; + struct nouveau_stateobj_start *start; struct nouveau_stateobj_reloc *reloc; - unsigned *cur; - unsigned cur_packet; + /* Common memory pool for data. */ + uint32_t *pool; + unsigned pool_cur; + +#ifdef DEBUG_NOUVEAU_STATEOBJ + unsigned start_alloc; + unsigned reloc_alloc; + unsigned pool_alloc; +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + unsigned total; /* includes begin_ring */ + unsigned cur; /* excludes begin_ring, offset from "cur_start" */ + unsigned cur_start; unsigned cur_reloc; }; +static INLINE void +so_dump(struct nouveau_stateobj *so) +{ + unsigned i, nr, total = 0; + + for (i = 0; i < so->cur_start; i++) { + if (so->start[i].gr->subc > -1) + debug_printf("+0x%04x: 0x%08x\n", total++, + (so->start[i].size << 18) | (so->start[i].gr->subc << 13) + | so->start[i].mthd); + else + debug_printf("+0x%04x: 0x%08x\n", total++, + (so->start[i].size << 18) | so->start[i].mthd); + for (nr = 0; nr < so->start[i].size; nr++, total++) + debug_printf("+0x%04x: 0x%08x\n", total, + so->pool[so->start[i].offset + nr]); + } +} + static INLINE struct nouveau_stateobj * -so_new(unsigned push, unsigned reloc) +so_new(unsigned start, unsigned push, unsigned reloc) { struct nouveau_stateobj *so; so = MALLOC(sizeof(struct nouveau_stateobj)); pipe_reference_init(&so->reference, 1); - so->push = MALLOC(sizeof(unsigned) * push); - so->reloc = MALLOC(sizeof(struct nouveau_stateobj_reloc) * reloc); + so->total = so->cur = so->cur_start = so->cur_reloc = 0; - so->cur = so->push; - so->cur_reloc = so->cur_packet = 0; +#ifdef DEBUG_NOUVEAU_STATEOBJ + so->start_alloc = start; + so->reloc_alloc = reloc; + so->pool_alloc = push; +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + so->start = MALLOC(start * sizeof(struct nouveau_stateobj_start)); + so->reloc = MALLOC(reloc * sizeof(struct nouveau_stateobj_reloc)); + so->pool = MALLOC(push * sizeof(uint32_t)); + so->pool_cur = 0; + + if (!so->start || !so->reloc || !so->pool) { + debug_printf("malloc failed\n"); + assert(0); + } return so; } @@ -48,63 +102,128 @@ so_ref(struct nouveau_stateobj *ref, struct nouveau_stateobj **pso) struct nouveau_stateobj *so = *pso; int i; - if (pipe_reference(&(*pso)->reference, &ref->reference)) { - free(so->push); + if (pipe_reference(&(*pso)->reference, &ref->reference)) { + FREE(so->start); for (i = 0; i < so->cur_reloc; i++) nouveau_bo_ref(NULL, &so->reloc[i].bo); - free(so->reloc); - free(so); + FREE(so->reloc); + FREE(so->pool); + FREE(so); } *pso = ref; } static INLINE void -so_data(struct nouveau_stateobj *so, unsigned data) +so_data(struct nouveau_stateobj *so, uint32_t data) { - (*so->cur++) = (data); - so->cur_packet += 4; +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->cur >= so->start[so->cur_start - 1].size) { + debug_printf("exceeding specified size\n"); + assert(0); + } +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + so->pool[so->start[so->cur_start - 1].offset + so->cur++] = data; } static INLINE void -so_datap(struct nouveau_stateobj *so, unsigned *data, unsigned size) +so_datap(struct nouveau_stateobj *so, uint32_t *data, unsigned size) { - so->cur_packet += (4 * size); +#ifdef DEBUG_NOUVEAU_STATEOBJ + if ((so->cur + size) > so->start[so->cur_start - 1].size) { + debug_printf("exceeding specified size\n"); + assert(0); + } +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + while (size--) - (*so->cur++) = (*data++); + so->pool[so->start[so->cur_start - 1].offset + so->cur++] = + *data++; } static INLINE void so_method(struct nouveau_stateobj *so, struct nouveau_grobj *gr, unsigned mthd, unsigned size) { - so->cur_packet = (gr->subc << 13) | (1 << 18) | (mthd - 4); - so_data(so, (gr->subc << 13) | (size << 18) | mthd); + struct nouveau_stateobj_start *start; + +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->start_alloc <= so->cur_start) { + debug_printf("exceeding num_start size\n"); + assert(0); + } else +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + start = so->start; + +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->cur_start > 0 && start[so->cur_start - 1].size > so->cur) { + debug_printf("previous so_method was not filled\n"); + assert(0); + } +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + so->start = start; + start[so->cur_start].gr = gr; + start[so->cur_start].mthd = mthd; + start[so->cur_start].size = size; + +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->pool_alloc < (size + so->pool_cur)) { + debug_printf("exceeding num_pool size\n"); + assert(0); + } +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + start[so->cur_start].offset = so->pool_cur; + so->pool_cur += size; + + so->cur_start++; + /* The 1 is for *this* begin_ring. */ + so->total += so->cur + 1; + so->cur = 0; } static INLINE void so_reloc(struct nouveau_stateobj *so, struct nouveau_bo *bo, unsigned data, unsigned flags, unsigned vor, unsigned tor) { - struct nouveau_stateobj_reloc *r = &so->reloc[so->cur_reloc++]; - - r->bo = NULL; - nouveau_bo_ref(bo, &r->bo); - r->offset = so->cur - so->push; - r->packet = so->cur_packet; - r->data = data; - r->flags = flags; - r->vor = vor; - r->tor = tor; + struct nouveau_stateobj_reloc *r; + +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->reloc_alloc <= so->cur_reloc) { + debug_printf("exceeding num_reloc size\n"); + assert(0); + } else +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + r = so->reloc; + + so->reloc = r; + r[so->cur_reloc].bo = NULL; + nouveau_bo_ref(bo, &(r[so->cur_reloc].bo)); + r[so->cur_reloc].gr = so->start[so->cur_start-1].gr; + r[so->cur_reloc].push_offset = so->total + so->cur; + r[so->cur_reloc].data = data; + r[so->cur_reloc].flags = flags; + r[so->cur_reloc].mthd = so->start[so->cur_start-1].mthd + + (so->cur << 2); + r[so->cur_reloc].vor = vor; + r[so->cur_reloc].tor = tor; + so_data(so, data); + so->cur_reloc++; } -static INLINE void -so_dump(struct nouveau_stateobj *so) +/* Determine if this buffer object is referenced by this state object. */ +static INLINE boolean +so_bo_is_reloc(struct nouveau_stateobj *so, struct nouveau_bo *bo) { - unsigned i, nr = so->cur - so->push; + int i; + + for (i = 0; i < so->cur_reloc; i++) + if (so->reloc[i].bo == bo) + return true; - for (i = 0; i < nr; i++) - debug_printf("+0x%04x: 0x%08x\n", i, so->push[i]); + return false; } static INLINE void @@ -114,75 +233,93 @@ so_emit(struct nouveau_channel *chan, struct nouveau_stateobj *so) unsigned nr, i; int ret = 0; - nr = so->cur - so->push; +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (so->start[so->cur_start - 1].size > so->cur) { + debug_printf("emit: previous so_method was not filled\n"); + assert(0); + } +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + /* We cannot update total in case we so_emit again. */ + nr = so->total + so->cur; + /* This will flush if we need space. * We don't actually need the marker. */ if ((ret = nouveau_pushbuf_marker_emit(chan, nr, so->cur_reloc))) { debug_printf("so_emit failed marker emit with error %d\n", ret); - return; + assert(0); + } + + /* Submit data. This will ensure proper binding of objects. */ + for (i = 0; i < so->cur_start; i++) { + BEGIN_RING(chan, so->start[i].gr, so->start[i].mthd, so->start[i].size); + OUT_RINGp(chan, &(so->pool[so->start[i].offset]), so->start[i].size); } - pb->remaining -= nr; - memcpy(pb->cur, so->push, nr * 4); for (i = 0; i < so->cur_reloc; i++) { struct nouveau_stateobj_reloc *r = &so->reloc[i]; - if ((ret = nouveau_pushbuf_emit_reloc(chan, pb->cur + r->offset, - r->bo, r->data, 0, r->flags, - r->vor, r->tor))) { + if ((ret = nouveau_pushbuf_emit_reloc(chan, pb->cur - nr + + r->push_offset, r->bo, r->data, + 0, r->flags, r->vor, r->tor))) { debug_printf("so_emit failed reloc with error %d\n", ret); - goto out; + assert(0); } } -out: - pb->cur += nr; } static INLINE void so_emit_reloc_markers(struct nouveau_channel *chan, struct nouveau_stateobj *so) { struct nouveau_pushbuf *pb = chan->pushbuf; + struct nouveau_grobj *gr = NULL; unsigned i; int ret = 0; if (!so) return; - i = so->cur_reloc << 1; - /* This will flush if we need space. - * We don't actually need the marker. - */ - if ((ret = nouveau_pushbuf_marker_emit(chan, i, i))) { - debug_printf("so_emit_reloc_markers failed marker emit with" \ - "error %d\n", ret); - return; - } - pb->remaining -= i; - + /* If we need to flush in flush notify, then we have a problem anyway. */ for (i = 0; i < so->cur_reloc; i++) { struct nouveau_stateobj_reloc *r = &so->reloc[i]; - if ((ret = nouveau_pushbuf_emit_reloc(chan, pb->cur++, r->bo, - r->packet, 0, - (r->flags & (NOUVEAU_BO_VRAM | - NOUVEAU_BO_GART | - NOUVEAU_BO_RDWR)) | - NOUVEAU_BO_DUMMY, 0, 0))) { - debug_printf("so_emit_reloc_markers failed reloc" \ - "with error %d\n", ret); - pb->remaining += ((so->cur_reloc - i) << 1); - return; +#ifdef DEBUG_NOUVEAU_STATEOBJ + if (r->mthd & 0x40000000) { + debug_printf("error: NI mthd 0x%08X\n", r->mthd); + continue; } - if ((ret = nouveau_pushbuf_emit_reloc(chan, pb->cur++, r->bo, - r->data, 0, - r->flags | NOUVEAU_BO_DUMMY, - r->vor, r->tor))) { - debug_printf("so_emit_reloc_markers failed reloc" \ - "with error %d\n", ret); - pb->remaining += ((so->cur_reloc - i) << 1) - 1; - return; +#endif /* DEBUG_NOUVEAU_STATEOBJ */ + + /* The object needs to be bound and the system must know the + * subchannel is being used. Otherwise it will discard it. + */ + if (gr != r->gr) { + BEGIN_RING(chan, r->gr, 0x100, 1); + OUT_RING(chan, 0); + gr = r->gr; + } + + /* Some relocs really don't like to be hammered, + * NOUVEAU_BO_DUMMY makes sure it only + * happens when needed. + */ + ret = OUT_RELOC(chan, r->bo, (r->gr->subc << 13) | (1<< 18) | + r->mthd, (r->flags & (NOUVEAU_BO_VRAM | NOUVEAU_BO_GART + | NOUVEAU_BO_RDWR)) | NOUVEAU_BO_DUMMY, 0, 0); + if (ret) { + debug_printf("OUT_RELOC failed %d\n", ret); + assert(0); } + + ret = OUT_RELOC(chan, r->bo, r->data, r->flags | + NOUVEAU_BO_DUMMY, r->vor, r->tor); + if (ret) { + debug_printf("OUT_RELOC failed %d\n", ret); + assert(0); + } + + pb->remaining -= 2; } } diff --git a/src/gallium/drivers/nv04/nv04_context.c b/src/gallium/drivers/nv04/nv04_context.c index 770733a4a1..edd96859cf 100644 --- a/src/gallium/drivers/nv04/nv04_context.c +++ b/src/gallium/drivers/nv04/nv04_context.c @@ -10,10 +10,14 @@ nv04_flush(struct pipe_context *pipe, unsigned flags, struct pipe_fence_handle **fence) { struct nv04_context *nv04 = nv04_context(pipe); + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; draw_flush(nv04->draw); - FIRE_RING(fence); + FIRE_RING(chan); + if (fence) + *fence = NULL; } static void @@ -30,32 +34,36 @@ nv04_destroy(struct pipe_context *pipe) static boolean nv04_init_hwctx(struct nv04_context *nv04) { + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + // requires a valid handle -// BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_NOTIFY, 1); +// BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_NOTIFY, 1); // OUT_RING(0); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_NOP, 1); - OUT_RING(0); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_NOP, 1); + OUT_RING(chan, 0); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); - OUT_RING(0x40182800); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); + OUT_RING(chan, 0x40182800); // OUT_RING(1<<20/*no cull*/); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_BLEND, 1); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_BLEND, 1); // OUT_RING(0x24|(1<<6)|(1<<8)); - OUT_RING(0x120001a4); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_FORMAT, 1); - OUT_RING(0x332213a1); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_FILTER, 1); - OUT_RING(0x11001010); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_COLORKEY, 1); - OUT_RING(0x0); -// BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 1); + OUT_RING(chan, 0x120001a4); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_FORMAT, 1); + OUT_RING(chan, 0x332213a1); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_FILTER, 1); + OUT_RING(chan, 0x11001010); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_COLORKEY, 1); + OUT_RING(chan, 0x0); +// BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 1); // OUT_RING(SCREEN_OFFSET); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_FOGCOLOR, 1); - OUT_RING(0xff000000); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_FOGCOLOR, 1); + OUT_RING(chan, 0xff000000); - FIRE_RING (NULL); + FIRE_RING (chan); return TRUE; } diff --git a/src/gallium/drivers/nv04/nv04_context.h b/src/gallium/drivers/nv04/nv04_context.h index 55326c787a..fe3b527423 100644 --- a/src/gallium/drivers/nv04/nv04_context.h +++ b/src/gallium/drivers/nv04/nv04_context.h @@ -15,10 +15,6 @@ #include "nouveau/nouveau_gldefs.h" #include "nouveau/nouveau_context.h" -#define NOUVEAU_PUSH_CONTEXT(ctx) \ - struct nv04_screen *ctx = nv04->screen -#include "nouveau/nouveau_push.h" - #include "nv04_state.h" #define NOUVEAU_ERR(fmt, args...) \ @@ -141,9 +137,9 @@ extern void nv04_emit_hw_state(struct nv04_context *nv04); extern void nv04_state_tex_update(struct nv04_context *nv04); /* nv04_vbo.c */ -extern boolean nv04_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv04_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv04_draw_elements( struct pipe_context *pipe, +extern void nv04_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count); diff --git a/src/gallium/drivers/nv04/nv04_prim_vbuf.c b/src/gallium/drivers/nv04/nv04_prim_vbuf.c index 25395edfd7..0b795ea243 100644 --- a/src/gallium/drivers/nv04/nv04_prim_vbuf.c +++ b/src/gallium/drivers/nv04/nv04_prim_vbuf.c @@ -93,33 +93,45 @@ nv04_vbuf_render_set_primitive( struct vbuf_render *render, static INLINE void nv04_2triangles(struct nv04_context* nv04, unsigned char* buffer, ushort v0, ushort v1, ushort v2, ushort v3, ushort v4, ushort v5) { - BEGIN_RING(fahrenheit,NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xA),49); - OUT_RINGp(buffer + VERTEX_SIZE * v0,8); - OUT_RINGp(buffer + VERTEX_SIZE * v1,8); - OUT_RINGp(buffer + VERTEX_SIZE * v2,8); - OUT_RINGp(buffer + VERTEX_SIZE * v3,8); - OUT_RINGp(buffer + VERTEX_SIZE * v4,8); - OUT_RINGp(buffer + VERTEX_SIZE * v5,8); - OUT_RING(0xFEDCBA); + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xA), 49); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v0,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v1,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v2,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v3,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v4,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v5,8); + OUT_RING(chan, 0xFEDCBA); } static INLINE void nv04_1triangle(struct nv04_context* nv04, unsigned char* buffer, ushort v0, ushort v1, ushort v2) { - BEGIN_RING(fahrenheit,NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xD),25); - OUT_RINGp(buffer + VERTEX_SIZE * v0,8); - OUT_RINGp(buffer + VERTEX_SIZE * v1,8); - OUT_RINGp(buffer + VERTEX_SIZE * v2,8); - OUT_RING(0xFED); + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xD), 25); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v0,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v1,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v2,8); + OUT_RING(chan, 0xFED); } static INLINE void nv04_1quad(struct nv04_context* nv04, unsigned char* buffer, ushort v0, ushort v1, ushort v2, ushort v3) { - BEGIN_RING(fahrenheit,NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xC),33); - OUT_RINGp(buffer + VERTEX_SIZE * v0,8); - OUT_RINGp(buffer + VERTEX_SIZE * v1,8); - OUT_RINGp(buffer + VERTEX_SIZE * v2,8); - OUT_RINGp(buffer + VERTEX_SIZE * v3,8); - OUT_RING(0xFECEDC); + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0xC), 33); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v0,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v1,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v2,8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * v3,8); + OUT_RING(chan, 0xFECEDC); } static void nv04_vbuf_render_triangles_elts(struct nv04_vbuf_render * render, const ushort * indices, uint nr_indices) @@ -156,7 +168,10 @@ static void nv04_vbuf_render_tri_strip_elts(struct nv04_vbuf_render* render, con { const uint32_t striptbl[]={0x321210,0x543432,0x765654,0x987876,0xBA9A98,0xDCBCBA,0xFEDEDC}; unsigned char* buffer = render->buffer; - struct nv04_context* nv04 = render->nv04; + struct nv04_context *nv04 = render->nv04; + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; int i,j; for(i = 0; i<nr_indices; i+=14) @@ -166,15 +181,15 @@ static void nv04_vbuf_render_tri_strip_elts(struct nv04_vbuf_render* render, con if (numvert<3) break; - BEGIN_RING( fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x0), numvert*8 ); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x0), numvert*8); for(j = 0; j<numvert; j++) - OUT_RINGp( buffer + VERTEX_SIZE * indices [i+j], 8 ); + OUT_RINGp(chan, buffer + VERTEX_SIZE * indices [i+j], 8 ); - BEGIN_RING_NI( fahrenheit, NV04_TEXTURED_TRIANGLE_DRAWPRIMITIVE(0), (numtri+1)/2 ); + BEGIN_RING_NI(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_DRAWPRIMITIVE(0), (numtri+1)/2 ); for(j = 0; j<numtri/2; j++ ) - OUT_RING(striptbl[j]); + OUT_RING(chan, striptbl[j]); if (numtri%2) - OUT_RING(striptbl[numtri/2]&0xFFF); + OUT_RING(chan, striptbl[numtri/2]&0xFFF); } } @@ -182,11 +197,14 @@ static void nv04_vbuf_render_tri_fan_elts(struct nv04_vbuf_render* render, const { const uint32_t fantbl[]={0x320210,0x540430,0x760650,0x980870,0xBA0A90,0xDC0CB0,0xFE0ED0}; unsigned char* buffer = render->buffer; - struct nv04_context* nv04 = render->nv04; + struct nv04_context *nv04 = render->nv04; + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; int i,j; - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x0), 8); - OUT_RINGp(buffer + VERTEX_SIZE * indices[0], 8); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x0), 8); + OUT_RINGp(chan, buffer + VERTEX_SIZE * indices[0], 8); for(i = 1; i<nr_indices; i+=14) { @@ -195,16 +213,16 @@ static void nv04_vbuf_render_tri_fan_elts(struct nv04_vbuf_render* render, const if (numvert < 3) break; - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x1), numvert*8); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_TLVERTEX_SX(0x1), numvert*8); for(j=0;j<numvert;j++) - OUT_RINGp( buffer + VERTEX_SIZE * indices[ i+j ], 8 ); + OUT_RINGp(chan, buffer + VERTEX_SIZE * indices[ i+j ], 8 ); - BEGIN_RING_NI(fahrenheit, NV04_TEXTURED_TRIANGLE_DRAWPRIMITIVE(0), (numtri+1)/2); + BEGIN_RING_NI(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_DRAWPRIMITIVE(0), (numtri+1)/2); for(j = 0; j<numtri/2; j++) - OUT_RING(fantbl[j]); + OUT_RING(chan, fantbl[j]); if (numtri%2) - OUT_RING(fantbl[numtri/2]&0xFFF); + OUT_RING(chan, fantbl[numtri/2]&0xFFF); } } diff --git a/src/gallium/drivers/nv04/nv04_state_emit.c b/src/gallium/drivers/nv04/nv04_state_emit.c index bd98ae091f..b8d6dc560f 100644 --- a/src/gallium/drivers/nv04/nv04_state_emit.c +++ b/src/gallium/drivers/nv04/nv04_state_emit.c @@ -57,13 +57,19 @@ static uint32_t nv04_blend_func(uint32_t f) static void nv04_emit_control(struct nv04_context* nv04) { uint32_t control = nv04->dsa->control; + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); - OUT_RING(control); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); + OUT_RING(chan, control); } static void nv04_emit_blend(struct nv04_context* nv04) { + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; uint32_t blend; blend=0x4; // texture MODULATE_ALPHA @@ -75,19 +81,23 @@ static void nv04_emit_blend(struct nv04_context* nv04) blend|=(nv04_blend_func(nv04->blend->b_src)<<24); blend|=(nv04_blend_func(nv04->blend->b_dst)<<28); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_BLEND, 1); - OUT_RING(blend); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_BLEND, 1); + OUT_RING(chan, blend); } static void nv04_emit_sampler(struct nv04_context *nv04, int unit) { struct nv04_miptree *nv04mt = nv04->tex_miptree[unit]; struct pipe_texture *pt = &nv04mt->base; + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + struct nouveau_bo *bo = nouveau_bo(nv04mt->buffer); - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 3); - OUT_RELOCl(nv04mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - OUT_RELOCd(nv04mt->buffer, (nv04->fragtex.format | nv04->sampler[unit]->format), NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); - OUT_RING(nv04->sampler[unit]->filter); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 3); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); + OUT_RELOCd(chan, bo, (nv04->fragtex.format | nv04->sampler[unit]->format), NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); + OUT_RING(chan, nv04->sampler[unit]->filter); } static void nv04_state_emit_framebuffer(struct nv04_context* nv04) @@ -97,6 +107,10 @@ static void nv04_state_emit_framebuffer(struct nv04_context* nv04) uint32_t rt_format, w, h; int colour_format = 0, zeta_format = 0; struct nv04_miptree *nv04mt = 0; + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *context_surfaces_3d = screen->context_surfaces_3d; + struct nouveau_bo *bo; w = fb->cbufs[0]->width; h = fb->cbufs[0]->height; @@ -128,24 +142,29 @@ static void nv04_state_emit_framebuffer(struct nv04_context* nv04) assert(0); } - BEGIN_RING(context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_FORMAT, 1); - OUT_RING(rt_format); + BEGIN_RING(chan, context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_FORMAT, 1); + OUT_RING(chan, rt_format); nv04mt = (struct nv04_miptree *)rt->base.texture; + bo = nouveau_bo(nv04mt->buffer); /* FIXME pitches have to be aligned ! */ - BEGIN_RING(context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_PITCH, 2); - OUT_RING(rt->pitch|(zeta->pitch<<16)); - OUT_RELOCl(nv04mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_PITCH, 2); + OUT_RING(chan, rt->pitch|(zeta->pitch<<16)); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); if (fb->zsbuf) { nv04mt = (struct nv04_miptree *)zeta->base.texture; - BEGIN_RING(context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_OFFSET_ZETA, 1); - OUT_RELOCl(nv04mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_OFFSET_ZETA, 1); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); } } void nv04_emit_hw_state(struct nv04_context *nv04) { + struct nv04_screen *screen = nv04->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *fahrenheit = screen->fahrenheit; + struct nouveau_grobj *context_surfaces_3d = screen->context_surfaces_3d; int i; if (nv04->dirty & NV04_NEW_VERTPROG) { @@ -163,8 +182,8 @@ nv04_emit_hw_state(struct nv04_context *nv04) if (nv04->dirty & NV04_NEW_CONTROL) { nv04->dirty &= ~NV04_NEW_CONTROL; - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); - OUT_RING(nv04->dsa->control); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_CONTROL, 1); + OUT_RING(chan, nv04->dsa->control); } if (nv04->dirty & NV04_NEW_BLEND) { @@ -205,12 +224,12 @@ nv04_emit_hw_state(struct nv04_context *nv04) unsigned rt_pitch = ((struct nv04_surface *)nv04->rt)->pitch; unsigned zeta_pitch = ((struct nv04_surface *)nv04->zeta)->pitch; - BEGIN_RING(context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_PITCH, 2); - OUT_RING(rt_pitch|(zeta_pitch<<16)); - OUT_RELOCl(nv04->rt, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_PITCH, 2); + OUT_RING(chan, rt_pitch|(zeta_pitch<<16)); + OUT_RELOCl(chan, nouveau_bo(nv04->rt), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); if (nv04->zeta) { - BEGIN_RING(context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_OFFSET_ZETA, 1); - OUT_RELOCl(nv04->zeta, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, context_surfaces_3d, NV04_CONTEXT_SURFACES_3D_OFFSET_ZETA, 1); + OUT_RELOCl(chan, nouveau_bo(nv04->zeta), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); } /* Texture images */ @@ -218,9 +237,10 @@ nv04_emit_hw_state(struct nv04_context *nv04) if (!(nv04->fp_samplers & (1 << i))) continue; struct nv04_miptree *nv04mt = nv04->tex_miptree[i]; - BEGIN_RING(fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 2); - OUT_RELOCl(nv04mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - OUT_RELOCd(nv04mt->buffer, (nv04->fragtex.format | nv04->sampler[i]->format), NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); + struct nouveau_bo *bo = nouveau_bo(nv04mt->buffer); + BEGIN_RING(chan, fahrenheit, NV04_TEXTURED_TRIANGLE_OFFSET, 2); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); + OUT_RELOCd(chan, bo, (nv04->fragtex.format | nv04->sampler[i]->format), NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); } } diff --git a/src/gallium/drivers/nv04/nv04_vbo.c b/src/gallium/drivers/nv04/nv04_vbo.c index 099ab10043..3484771814 100644 --- a/src/gallium/drivers/nv04/nv04_vbo.c +++ b/src/gallium/drivers/nv04/nv04_vbo.c @@ -9,7 +9,7 @@ #include "nouveau/nouveau_channel.h" #include "nouveau/nouveau_pushbuf.h" -boolean nv04_draw_elements( struct pipe_context *pipe, +void nv04_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count) @@ -65,15 +65,13 @@ boolean nv04_draw_elements( struct pipe_context *pipe, pipe_buffer_unmap(pscreen, indexBuffer); draw_set_mapped_element_buffer(draw, 0, NULL); } - - return TRUE; } -boolean nv04_draw_arrays( struct pipe_context *pipe, - unsigned prim, unsigned start, unsigned count) +void nv04_draw_arrays( struct pipe_context *pipe, + unsigned prim, unsigned start, unsigned count) { printf("coucou in draw arrays\n"); - return nv04_draw_elements(pipe, NULL, 0, prim, start, count); + nv04_draw_elements(pipe, NULL, 0, prim, start, count); } diff --git a/src/gallium/drivers/nv10/nv10_context.c b/src/gallium/drivers/nv10/nv10_context.c index 0dadeb03dd..1ecb73d06e 100644 --- a/src/gallium/drivers/nv10/nv10_context.c +++ b/src/gallium/drivers/nv10/nv10_context.c @@ -10,10 +10,14 @@ nv10_flush(struct pipe_context *pipe, unsigned flags, struct pipe_fence_handle **fence) { struct nv10_context *nv10 = nv10_context(pipe); + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; draw_flush(nv10->draw); - FIRE_RING(fence); + FIRE_RING(chan); + if (fence) + *fence = NULL; } static void @@ -31,225 +35,226 @@ static void nv10_init_hwctx(struct nv10_context *nv10) { struct nv10_screen *screen = nv10->screen; struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; int i; float projectionmatrix[16]; - BEGIN_RING(celsius, NV10TCL_DMA_NOTIFY, 1); - OUT_RING (screen->sync->handle); - BEGIN_RING(celsius, NV10TCL_DMA_IN_MEMORY0, 2); - OUT_RING (chan->vram->handle); - OUT_RING (chan->gart->handle); - BEGIN_RING(celsius, NV10TCL_DMA_IN_MEMORY2, 2); - OUT_RING (chan->vram->handle); - OUT_RING (chan->vram->handle); + BEGIN_RING(chan, celsius, NV10TCL_DMA_NOTIFY, 1); + OUT_RING (chan, screen->sync->handle); + BEGIN_RING(chan, celsius, NV10TCL_DMA_IN_MEMORY0, 2); + OUT_RING (chan, chan->vram->handle); + OUT_RING (chan, chan->gart->handle); + BEGIN_RING(chan, celsius, NV10TCL_DMA_IN_MEMORY2, 2); + OUT_RING (chan, chan->vram->handle); + OUT_RING (chan, chan->vram->handle); - BEGIN_RING(celsius, NV10TCL_NOP, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_NOP, 1); + OUT_RING (chan, 0); - BEGIN_RING(celsius, NV10TCL_RT_HORIZ, 2); - OUT_RING (0); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_RT_HORIZ, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); - BEGIN_RING(celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(0), 1); - OUT_RING ((0x7ff<<16)|0x800); - BEGIN_RING(celsius, NV10TCL_VIEWPORT_CLIP_VERT(0), 1); - OUT_RING ((0x7ff<<16)|0x800); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(0), 1); + OUT_RING (chan, (0x7ff<<16)|0x800); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_CLIP_VERT(0), 1); + OUT_RING (chan, (0x7ff<<16)|0x800); for (i=1;i<8;i++) { - BEGIN_RING(celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(i), 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_VIEWPORT_CLIP_VERT(i), 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(i), 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_CLIP_VERT(i), 1); + OUT_RING (chan, 0); } - BEGIN_RING(celsius, 0x290, 1); - OUT_RING ((0x10<<16)|1); - BEGIN_RING(celsius, 0x3f4, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, 0x290, 1); + OUT_RING (chan, (0x10<<16)|1); + BEGIN_RING(chan, celsius, 0x3f4, 1); + OUT_RING (chan, 0); - BEGIN_RING(celsius, NV10TCL_NOP, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_NOP, 1); + OUT_RING (chan, 0); if (nv10->screen->celsius->grclass != NV10TCL) { /* For nv11, nv17 */ - BEGIN_RING(celsius, 0x120, 3); - OUT_RING (0); - OUT_RING (1); - OUT_RING (2); + BEGIN_RING(chan, celsius, 0x120, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 1); + OUT_RING (chan, 2); - BEGIN_RING(celsius, NV10TCL_NOP, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_NOP, 1); + OUT_RING (chan, 0); } - BEGIN_RING(celsius, NV10TCL_NOP, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_NOP, 1); + OUT_RING (chan, 0); /* Set state */ - BEGIN_RING(celsius, NV10TCL_FOG_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_ALPHA_FUNC_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_ALPHA_FUNC_FUNC, 2); - OUT_RING (0x207); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_TX_ENABLE(0), 2); - OUT_RING (0); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_FOG_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_ALPHA_FUNC_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_ALPHA_FUNC_FUNC, 2); + OUT_RING (chan, 0x207); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_TX_ENABLE(0), 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); - BEGIN_RING(celsius, NV10TCL_RC_IN_ALPHA(0), 12); - OUT_RING (0x30141010); - OUT_RING (0); - OUT_RING (0x20040000); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0x00000c00); - OUT_RING (0); - OUT_RING (0x00000c00); - OUT_RING (0x18000000); - OUT_RING (0x300e0300); - OUT_RING (0x0c091c80); + BEGIN_RING(chan, celsius, NV10TCL_RC_IN_ALPHA(0), 12); + OUT_RING (chan, 0x30141010); + OUT_RING (chan, 0); + OUT_RING (chan, 0x20040000); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0x00000c00); + OUT_RING (chan, 0); + OUT_RING (chan, 0x00000c00); + OUT_RING (chan, 0x18000000); + OUT_RING (chan, 0x300e0300); + OUT_RING (chan, 0x0c091c80); - BEGIN_RING(celsius, NV10TCL_BLEND_FUNC_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_DITHER_ENABLE, 2); - OUT_RING (1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_LINE_SMOOTH_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_VERTEX_WEIGHT_ENABLE, 2); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_BLEND_FUNC_SRC, 4); - OUT_RING (1); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0x8006); - BEGIN_RING(celsius, NV10TCL_STENCIL_MASK, 8); - OUT_RING (0xff); - OUT_RING (0x207); - OUT_RING (0); - OUT_RING (0xff); - OUT_RING (0x1e00); - OUT_RING (0x1e00); - OUT_RING (0x1e00); - OUT_RING (0x1d01); - BEGIN_RING(celsius, NV10TCL_NORMALIZE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_FOG_ENABLE, 2); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_LIGHT_MODEL, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_COLOR_CONTROL, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_ENABLED_LIGHTS, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_POLYGON_OFFSET_POINT_ENABLE, 3); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_DEPTH_FUNC, 1); - OUT_RING (0x201); - BEGIN_RING(celsius, NV10TCL_DEPTH_WRITE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_DEPTH_TEST_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_POLYGON_OFFSET_FACTOR, 2); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_POINT_SIZE, 1); - OUT_RING (8); - BEGIN_RING(celsius, NV10TCL_POINT_PARAMETERS_ENABLE, 2); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_LINE_WIDTH, 1); - OUT_RING (8); - BEGIN_RING(celsius, NV10TCL_LINE_SMOOTH_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_POLYGON_MODE_FRONT, 2); - OUT_RING (0x1b02); - OUT_RING (0x1b02); - BEGIN_RING(celsius, NV10TCL_CULL_FACE, 2); - OUT_RING (0x405); - OUT_RING (0x901); - BEGIN_RING(celsius, NV10TCL_POLYGON_SMOOTH_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_CULL_FACE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_TX_GEN_S(0), 8); + BEGIN_RING(chan, celsius, NV10TCL_BLEND_FUNC_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_DITHER_ENABLE, 2); + OUT_RING (chan, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_LINE_SMOOTH_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_WEIGHT_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_BLEND_FUNC_SRC, 4); + OUT_RING (chan, 1); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0x8006); + BEGIN_RING(chan, celsius, NV10TCL_STENCIL_MASK, 8); + OUT_RING (chan, 0xff); + OUT_RING (chan, 0x207); + OUT_RING (chan, 0); + OUT_RING (chan, 0xff); + OUT_RING (chan, 0x1e00); + OUT_RING (chan, 0x1e00); + OUT_RING (chan, 0x1e00); + OUT_RING (chan, 0x1d01); + BEGIN_RING(chan, celsius, NV10TCL_NORMALIZE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_FOG_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_LIGHT_MODEL, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_COLOR_CONTROL, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_ENABLED_LIGHTS, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_POLYGON_OFFSET_POINT_ENABLE, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_FUNC, 1); + OUT_RING (chan, 0x201); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_WRITE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_TEST_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_POLYGON_OFFSET_FACTOR, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_POINT_SIZE, 1); + OUT_RING (chan, 8); + BEGIN_RING(chan, celsius, NV10TCL_POINT_PARAMETERS_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_LINE_WIDTH, 1); + OUT_RING (chan, 8); + BEGIN_RING(chan, celsius, NV10TCL_LINE_SMOOTH_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_POLYGON_MODE_FRONT, 2); + OUT_RING (chan, 0x1b02); + OUT_RING (chan, 0x1b02); + BEGIN_RING(chan, celsius, NV10TCL_CULL_FACE, 2); + OUT_RING (chan, 0x405); + OUT_RING (chan, 0x901); + BEGIN_RING(chan, celsius, NV10TCL_POLYGON_SMOOTH_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_CULL_FACE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_TX_GEN_S(0), 8); for (i=0;i<8;i++) { - OUT_RING (0); + OUT_RING (chan, 0); } - BEGIN_RING(celsius, NV10TCL_FOG_EQUATION_CONSTANT, 3); - OUT_RING (0x3fc00000); /* -1.50 */ - OUT_RING (0xbdb8aa0a); /* -0.09 */ - OUT_RING (0); /* 0.00 */ + BEGIN_RING(chan, celsius, NV10TCL_FOG_EQUATION_CONSTANT, 3); + OUT_RING (chan, 0x3fc00000); /* -1.50 */ + OUT_RING (chan, 0xbdb8aa0a); /* -0.09 */ + OUT_RING (chan, 0); /* 0.00 */ - BEGIN_RING(celsius, NV10TCL_NOP, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_NOP, 1); + OUT_RING (chan, 0); - BEGIN_RING(celsius, NV10TCL_FOG_MODE, 2); - OUT_RING (0x802); - OUT_RING (2); + BEGIN_RING(chan, celsius, NV10TCL_FOG_MODE, 2); + OUT_RING (chan, 0x802); + OUT_RING (chan, 2); /* for some reason VIEW_MATRIX_ENABLE need to be 6 instead of 4 when * using texturing, except when using the texture matrix */ - BEGIN_RING(celsius, NV10TCL_VIEW_MATRIX_ENABLE, 1); - OUT_RING (6); - BEGIN_RING(celsius, NV10TCL_COLOR_MASK, 1); - OUT_RING (0x01010101); + BEGIN_RING(chan, celsius, NV10TCL_VIEW_MATRIX_ENABLE, 1); + OUT_RING (chan, 6); + BEGIN_RING(chan, celsius, NV10TCL_COLOR_MASK, 1); + OUT_RING (chan, 0x01010101); /* Set vertex component */ - BEGIN_RING(celsius, NV10TCL_VERTEX_COL_4F_R, 4); - OUT_RINGf (1.0); - OUT_RINGf (1.0); - OUT_RINGf (1.0); - OUT_RINGf (1.0); - BEGIN_RING(celsius, NV10TCL_VERTEX_COL2_3F_R, 3); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(celsius, NV10TCL_VERTEX_NOR_3F_X, 3); - OUT_RING (0); - OUT_RING (0); - OUT_RINGf (1.0); - BEGIN_RING(celsius, NV10TCL_VERTEX_TX0_4F_S, 4); - OUT_RINGf (0.0); - OUT_RINGf (0.0); - OUT_RINGf (0.0); - OUT_RINGf (1.0); - BEGIN_RING(celsius, NV10TCL_VERTEX_TX1_4F_S, 4); - OUT_RINGf (0.0); - OUT_RINGf (0.0); - OUT_RINGf (0.0); - OUT_RINGf (1.0); - BEGIN_RING(celsius, NV10TCL_VERTEX_FOG_1F, 1); - OUT_RINGf (0.0); - BEGIN_RING(celsius, NV10TCL_EDGEFLAG_ENABLE, 1); - OUT_RING (1); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_COL_4F_R, 4); + OUT_RINGf (chan, 1.0); + OUT_RINGf (chan, 1.0); + OUT_RINGf (chan, 1.0); + OUT_RINGf (chan, 1.0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_COL2_3F_R, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_NOR_3F_X, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RINGf (chan, 1.0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_TX0_4F_S, 4); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 1.0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_TX1_4F_S, 4); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 1.0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_FOG_1F, 1); + OUT_RINGf (chan, 0.0); + BEGIN_RING(chan, celsius, NV10TCL_EDGEFLAG_ENABLE, 1); + OUT_RING (chan, 1); memset(projectionmatrix, 0, sizeof(projectionmatrix)); - BEGIN_RING(celsius, NV10TCL_PROJECTION_MATRIX(0), 16); + BEGIN_RING(chan, celsius, NV10TCL_PROJECTION_MATRIX(0), 16); projectionmatrix[0*4+0] = 1.0; projectionmatrix[1*4+1] = 1.0; projectionmatrix[2*4+2] = 1.0; projectionmatrix[3*4+3] = 1.0; for (i=0;i<16;i++) { - OUT_RINGf (projectionmatrix[i]); + OUT_RINGf (chan, projectionmatrix[i]); } - BEGIN_RING(celsius, NV10TCL_DEPTH_RANGE_NEAR, 2); - OUT_RING (0.0); - OUT_RINGf (16777216.0); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_RANGE_NEAR, 2); + OUT_RING (chan, 0.0); + OUT_RINGf (chan, 16777216.0); - BEGIN_RING(celsius, NV10TCL_VIEWPORT_TRANSLATE_X, 4); - OUT_RINGf (-2048.0); - OUT_RINGf (-2048.0); - OUT_RINGf (16777215.0 * 0.5); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_TRANSLATE_X, 4); + OUT_RINGf (chan, -2048.0); + OUT_RINGf (chan, -2048.0); + OUT_RINGf (chan, 16777215.0 * 0.5); + OUT_RING (chan, 0); - FIRE_RING (NULL); + FIRE_RING (chan); } struct pipe_context * diff --git a/src/gallium/drivers/nv10/nv10_context.h b/src/gallium/drivers/nv10/nv10_context.h index 36a6aa7a74..ab4b825487 100644 --- a/src/gallium/drivers/nv10/nv10_context.h +++ b/src/gallium/drivers/nv10/nv10_context.h @@ -15,10 +15,6 @@ #include "nouveau/nouveau_gldefs.h" #include "nouveau/nouveau_context.h" -#define NOUVEAU_PUSH_CONTEXT(ctx) \ - struct nv10_screen *ctx = nv10->screen -#include "nouveau/nouveau_push.h" - #include "nv10_state.h" #define NOUVEAU_ERR(fmt, args...) \ @@ -144,9 +140,9 @@ extern void nv10_emit_hw_state(struct nv10_context *nv10); extern void nv10_state_tex_update(struct nv10_context *nv10); /* nv10_vbo.c */ -extern boolean nv10_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv10_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv10_draw_elements( struct pipe_context *pipe, +extern void nv10_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count); diff --git a/src/gallium/drivers/nv10/nv10_fragtex.c b/src/gallium/drivers/nv10/nv10_fragtex.c index 906fdfeeb9..c1f7ccb9ab 100644 --- a/src/gallium/drivers/nv10/nv10_fragtex.c +++ b/src/gallium/drivers/nv10/nv10_fragtex.c @@ -52,6 +52,9 @@ nv10_fragtex_build(struct nv10_context *nv10, int unit) struct nv10_miptree *nv10mt = nv10->tex_miptree[unit]; struct pipe_texture *pt = &nv10mt->base; struct nv10_texture_format *tf; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; uint32_t txf, txs, txp; tf = nv10_fragtex_format(pt->format); @@ -82,15 +85,15 @@ nv10_fragtex_build(struct nv10_context *nv10, int unit) return; } - BEGIN_RING(celsius, NV10TCL_TX_OFFSET(unit), 8); - OUT_RELOCl(nv10mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - OUT_RELOCd(nv10mt->buffer,txf,NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); - OUT_RING (ps->wrap); - OUT_RING (0x40000000); /* enable */ - OUT_RING (txs); - OUT_RING (ps->filt | 0x2000 /* magic */); - OUT_RING ((pt->width0 << 16) | pt->height0); - OUT_RING (ps->bcol); + BEGIN_RING(chan, celsius, NV10TCL_TX_OFFSET(unit), 8); + OUT_RELOCl(chan, nouveau_bo(nv10mt->buffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); + OUT_RELOCd(chan, nouveau_bo(nv10mt->buffer),txf,NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); + OUT_RING (chan, ps->wrap); + OUT_RING (chan, 0x40000000); /* enable */ + OUT_RING (chan, txs); + OUT_RING (chan, ps->filt | 0x2000 /* magic */); + OUT_RING (chan, (pt->width0 << 16) | pt->height0); + OUT_RING (chan, ps->bcol); #endif } @@ -99,6 +102,9 @@ nv10_fragtex_bind(struct nv10_context *nv10) { #if 0 struct nv10_fragment_program *fp = nv10->fragprog.active; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; unsigned samplers, unit; samplers = nv10->fp_samplers & ~fp->samplers; @@ -106,8 +112,8 @@ nv10_fragtex_bind(struct nv10_context *nv10) unit = ffs(samplers) - 1; samplers &= ~(1 << unit); - BEGIN_RING(celsius, NV10TCL_TX_ENABLE(unit), 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_TX_ENABLE(unit), 1); + OUT_RING (chan, 0); } samplers = nv10->dirty_samplers & fp->samplers; diff --git a/src/gallium/drivers/nv10/nv10_prim_vbuf.c b/src/gallium/drivers/nv10/nv10_prim_vbuf.c index 7ba9777a22..c5dbe43dbc 100644 --- a/src/gallium/drivers/nv10/nv10_prim_vbuf.c +++ b/src/gallium/drivers/nv10/nv10_prim_vbuf.c @@ -67,12 +67,15 @@ struct nv10_vbuf_render { void nv10_vtxbuf_bind( struct nv10_context* nv10 ) { + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; int i; for(i = 0; i < 8; i++) { - BEGIN_RING(celsius, NV10TCL_VTXBUF_ADDRESS(i), 1); - OUT_RING(0/*nv10->vtxbuf*/); - BEGIN_RING(celsius, NV10TCL_VTXFMT(i), 1); - OUT_RING(0/*XXX*/); + BEGIN_RING(chan, celsius, NV10TCL_VTXBUF_ADDRESS(i), 1); + OUT_RING(chan, 0/*nv10->vtxbuf*/); + BEGIN_RING(chan, celsius, NV10TCL_VTXFMT(i), 1); + OUT_RING(chan, 0/*XXX*/); } } @@ -163,19 +166,22 @@ nv10_vbuf_render_draw( struct vbuf_render *render, { struct nv10_vbuf_render *nv10_render = nv10_vbuf_render(render); struct nv10_context *nv10 = nv10_render->nv10; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; int push, i; nv10_emit_hw_state(nv10); - BEGIN_RING(celsius, NV10TCL_VERTEX_ARRAY_OFFSET_POS, 1); - OUT_RELOCl(nv10_render->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_ARRAY_OFFSET_POS, 1); + OUT_RELOCl(chan, nouveau_bo(nv10_render->buffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - BEGIN_RING(celsius, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); - OUT_RING(nv10_render->hwprim); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); + OUT_RING(chan, nv10_render->hwprim); if (nr_indices & 1) { - BEGIN_RING(celsius, NV10TCL_VB_ELEMENT_U32, 1); - OUT_RING (indices[0]); + BEGIN_RING(chan, celsius, NV10TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, indices[0]); indices++; nr_indices--; } @@ -183,16 +189,16 @@ nv10_vbuf_render_draw( struct vbuf_render *render, // XXX too big/small ? check the size push = MIN2(nr_indices, 1200 * 2); - BEGIN_RING_NI(celsius, NV10TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, celsius, NV10TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((indices[i+1] << 16) | indices[i]); + OUT_RING(chan, (indices[i+1] << 16) | indices[i]); nr_indices -= push; indices += push; } - BEGIN_RING(celsius, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, celsius, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); + OUT_RING (chan, 0); } diff --git a/src/gallium/drivers/nv10/nv10_screen.c b/src/gallium/drivers/nv10/nv10_screen.c index 6a39ddeaac..69a6dab866 100644 --- a/src/gallium/drivers/nv10/nv10_screen.c +++ b/src/gallium/drivers/nv10/nv10_screen.c @@ -180,7 +180,6 @@ nv10_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) NOUVEAU_ERR("Error creating 3D object: %d\n", ret); return FALSE; } - BIND_RING(chan, screen->celsius, 7); /* 2D engine setup */ screen->eng2d = nv04_surface_2d_init(&screen->base); diff --git a/src/gallium/drivers/nv10/nv10_state_emit.c b/src/gallium/drivers/nv10/nv10_state_emit.c index 2577ab73b5..30a596ca60 100644 --- a/src/gallium/drivers/nv10/nv10_state_emit.c +++ b/src/gallium/drivers/nv10/nv10_state_emit.c @@ -4,25 +4,32 @@ static void nv10_state_emit_blend(struct nv10_context* nv10) { struct nv10_blend_state *b = nv10->blend; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; - BEGIN_RING(celsius, NV10TCL_DITHER_ENABLE, 1); - OUT_RING (b->d_enable); + BEGIN_RING(chan, celsius, NV10TCL_DITHER_ENABLE, 1); + OUT_RING (chan, b->d_enable); - BEGIN_RING(celsius, NV10TCL_BLEND_FUNC_ENABLE, 3); - OUT_RING (b->b_enable); - OUT_RING (b->b_srcfunc); - OUT_RING (b->b_dstfunc); + BEGIN_RING(chan, celsius, NV10TCL_BLEND_FUNC_ENABLE, 3); + OUT_RING (chan, b->b_enable); + OUT_RING (chan, b->b_srcfunc); + OUT_RING (chan, b->b_dstfunc); - BEGIN_RING(celsius, NV10TCL_COLOR_MASK, 1); - OUT_RING (b->c_mask); + BEGIN_RING(chan, celsius, NV10TCL_COLOR_MASK, 1); + OUT_RING (chan, b->c_mask); } static void nv10_state_emit_blend_color(struct nv10_context* nv10) { struct pipe_blend_color *c = nv10->blend_color; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; - BEGIN_RING(celsius, NV10TCL_BLEND_COLOR, 1); - OUT_RING ((float_to_ubyte(c->color[3]) << 24)| + BEGIN_RING(chan, celsius, NV10TCL_BLEND_COLOR, 1); + OUT_RING (chan, + (float_to_ubyte(c->color[3]) << 24)| (float_to_ubyte(c->color[0]) << 16)| (float_to_ubyte(c->color[1]) << 8) | (float_to_ubyte(c->color[2]) << 0)); @@ -31,60 +38,66 @@ static void nv10_state_emit_blend_color(struct nv10_context* nv10) static void nv10_state_emit_rast(struct nv10_context* nv10) { struct nv10_rasterizer_state *r = nv10->rast; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; - BEGIN_RING(celsius, NV10TCL_SHADE_MODEL, 2); - OUT_RING (r->shade_model); - OUT_RING (r->line_width); + BEGIN_RING(chan, celsius, NV10TCL_SHADE_MODEL, 2); + OUT_RING (chan, r->shade_model); + OUT_RING (chan, r->line_width); - BEGIN_RING(celsius, NV10TCL_POINT_SIZE, 1); - OUT_RING (r->point_size); + BEGIN_RING(chan, celsius, NV10TCL_POINT_SIZE, 1); + OUT_RING (chan, r->point_size); - BEGIN_RING(celsius, NV10TCL_POLYGON_MODE_FRONT, 2); - OUT_RING (r->poly_mode_front); - OUT_RING (r->poly_mode_back); + BEGIN_RING(chan, celsius, NV10TCL_POLYGON_MODE_FRONT, 2); + OUT_RING (chan, r->poly_mode_front); + OUT_RING (chan, r->poly_mode_back); - BEGIN_RING(celsius, NV10TCL_CULL_FACE, 2); - OUT_RING (r->cull_face); - OUT_RING (r->front_face); + BEGIN_RING(chan, celsius, NV10TCL_CULL_FACE, 2); + OUT_RING (chan, r->cull_face); + OUT_RING (chan, r->front_face); - BEGIN_RING(celsius, NV10TCL_LINE_SMOOTH_ENABLE, 2); - OUT_RING (r->line_smooth_en); - OUT_RING (r->poly_smooth_en); + BEGIN_RING(chan, celsius, NV10TCL_LINE_SMOOTH_ENABLE, 2); + OUT_RING (chan, r->line_smooth_en); + OUT_RING (chan, r->poly_smooth_en); - BEGIN_RING(celsius, NV10TCL_CULL_FACE_ENABLE, 1); - OUT_RING (r->cull_face_en); + BEGIN_RING(chan, celsius, NV10TCL_CULL_FACE_ENABLE, 1); + OUT_RING (chan, r->cull_face_en); } static void nv10_state_emit_dsa(struct nv10_context* nv10) { struct nv10_depth_stencil_alpha_state *d = nv10->dsa; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; - BEGIN_RING(celsius, NV10TCL_DEPTH_FUNC, 1); - OUT_RING (d->depth.func); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_FUNC, 1); + OUT_RING (chan, d->depth.func); - BEGIN_RING(celsius, NV10TCL_DEPTH_WRITE_ENABLE, 1); - OUT_RING (d->depth.write_enable); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_WRITE_ENABLE, 1); + OUT_RING (chan, d->depth.write_enable); - BEGIN_RING(celsius, NV10TCL_DEPTH_TEST_ENABLE, 1); - OUT_RING (d->depth.test_enable); + BEGIN_RING(chan, celsius, NV10TCL_DEPTH_TEST_ENABLE, 1); + OUT_RING (chan, d->depth.test_enable); #if 0 - BEGIN_RING(celsius, NV10TCL_STENCIL_ENABLE, 1); - OUT_RING (d->stencil.enable); - BEGIN_RING(celsius, NV10TCL_STENCIL_MASK, 7); - OUT_RINGp ((uint32_t *)&(d->stencil.wmask), 7); + BEGIN_RING(chan, celsius, NV10TCL_STENCIL_ENABLE, 1); + OUT_RING (chan, d->stencil.enable); + BEGIN_RING(chan, celsius, NV10TCL_STENCIL_MASK, 7); + OUT_RINGp (chan, (uint32_t *)&(d->stencil.wmask), 7); #endif - BEGIN_RING(celsius, NV10TCL_ALPHA_FUNC_ENABLE, 1); - OUT_RING (d->alpha.enabled); + BEGIN_RING(chan, celsius, NV10TCL_ALPHA_FUNC_ENABLE, 1); + OUT_RING (chan, d->alpha.enabled); - BEGIN_RING(celsius, NV10TCL_ALPHA_FUNC_FUNC, 1); - OUT_RING (d->alpha.func); + BEGIN_RING(chan, celsius, NV10TCL_ALPHA_FUNC_FUNC, 1); + OUT_RING (chan, d->alpha.func); - BEGIN_RING(celsius, NV10TCL_ALPHA_FUNC_REF, 1); - OUT_RING (d->alpha.ref); + BEGIN_RING(chan, celsius, NV10TCL_ALPHA_FUNC_REF, 1); + OUT_RING (chan, d->alpha.ref); } static void nv10_state_emit_viewport(struct nv10_context* nv10) @@ -108,6 +121,10 @@ static void nv10_state_emit_framebuffer(struct nv10_context* nv10) int colour_format = 0, zeta_format = 0; struct nv10_miptree *nv10mt = 0; + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; + w = fb->cbufs[0]->width; h = fb->cbufs[0]->height; colour_format = fb->cbufs[0]->format; @@ -144,11 +161,11 @@ static void nv10_state_emit_framebuffer(struct nv10_context* nv10) } if (zeta) { - BEGIN_RING(celsius, NV10TCL_RT_PITCH, 1); - OUT_RING (rt->pitch | (zeta->pitch << 16)); + BEGIN_RING(chan, celsius, NV10TCL_RT_PITCH, 1); + OUT_RING (chan, rt->pitch | (zeta->pitch << 16)); } else { - BEGIN_RING(celsius, NV10TCL_RT_PITCH, 1); - OUT_RING (rt->pitch | (rt->pitch << 16)); + BEGIN_RING(chan, celsius, NV10TCL_RT_PITCH, 1); + OUT_RING (chan, rt->pitch | (rt->pitch << 16)); } nv10mt = (struct nv10_miptree *)rt->base.texture; @@ -160,13 +177,13 @@ static void nv10_state_emit_framebuffer(struct nv10_context* nv10) nv10->zeta = nv10mt->buffer; } - BEGIN_RING(celsius, NV10TCL_RT_HORIZ, 3); - OUT_RING ((w << 16) | 0); - OUT_RING ((h << 16) | 0); - OUT_RING (rt_format); - BEGIN_RING(celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(0), 2); - OUT_RING (((w - 1) << 16) | 0 | 0x08000800); - OUT_RING (((h - 1) << 16) | 0 | 0x08000800); + BEGIN_RING(chan, celsius, NV10TCL_RT_HORIZ, 3); + OUT_RING (chan, (w << 16) | 0); + OUT_RING (chan, (h << 16) | 0); + OUT_RING (chan, rt_format); + BEGIN_RING(chan, celsius, NV10TCL_VIEWPORT_CLIP_HORIZ(0), 2); + OUT_RING (chan, ((w - 1) << 16) | 0 | 0x08000800); + OUT_RING (chan, ((h - 1) << 16) | 0 | 0x08000800); } static void nv10_vertex_layout(struct nv10_context *nv10) @@ -201,6 +218,10 @@ static void nv10_vertex_layout(struct nv10_context *nv10) void nv10_emit_hw_state(struct nv10_context *nv10) { + struct nv10_screen *screen = nv10->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *celsius = screen->celsius; + struct nouveau_bo *rt_bo; int i; if (nv10->dirty & NV10_NEW_VERTPROG) { @@ -269,38 +290,41 @@ nv10_emit_hw_state(struct nv10_context *nv10) */ /* Render target */ + rt_bo = nouveau_bo(nv10->rt[0]); // XXX figre out who's who for NV10TCL_DMA_* and fill accordingly -// BEGIN_RING(celsius, NV10TCL_DMA_COLOR0, 1); -// OUT_RELOCo(nv10->rt[0], NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(celsius, NV10TCL_COLOR_OFFSET, 1); - OUT_RELOCl(nv10->rt[0], 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); +// BEGIN_RING(chan, celsius, NV10TCL_DMA_COLOR0, 1); +// OUT_RELOCo(chan, rt_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, celsius, NV10TCL_COLOR_OFFSET, 1); + OUT_RELOCl(chan, rt_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); if (nv10->zeta) { + struct nouveau_bo *zeta_bo = nouveau_bo(nv10->zeta); // XXX -// BEGIN_RING(celsius, NV10TCL_DMA_ZETA, 1); -// OUT_RELOCo(nv10->zeta, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(celsius, NV10TCL_ZETA_OFFSET, 1); - OUT_RELOCl(nv10->zeta, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); +// BEGIN_RING(chan, celsius, NV10TCL_DMA_ZETA, 1); +// OUT_RELOCo(chan, zeta_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, celsius, NV10TCL_ZETA_OFFSET, 1); + OUT_RELOCl(chan, zeta_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); /* XXX for when we allocate LMA on nv17 */ -/* BEGIN_RING(celsius, NV10TCL_LMA_DEPTH_BUFFER_OFFSET, 1); - OUT_RELOCl(nv10->zeta + lma_offset);*/ +/* BEGIN_RING(chan, celsius, NV10TCL_LMA_DEPTH_BUFFER_OFFSET, 1); + OUT_RELOCl(chan, nouveau_bo(nv10->zeta + lma_offset));*/ } /* Vertex buffer */ - BEGIN_RING(celsius, NV10TCL_DMA_VTXBUF0, 1); - OUT_RELOCo(nv10->rt[0], NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(celsius, NV10TCL_COLOR_OFFSET, 1); - OUT_RELOCl(nv10->rt[0], 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, celsius, NV10TCL_DMA_VTXBUF0, 1); + OUT_RELOCo(chan, rt_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, celsius, NV10TCL_COLOR_OFFSET, 1); + OUT_RELOCl(chan, rt_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); /* Texture images */ for (i = 0; i < 2; i++) { if (!(nv10->fp_samplers & (1 << i))) continue; - BEGIN_RING(celsius, NV10TCL_TX_OFFSET(i), 1); - OUT_RELOCl(nv10->tex[i].buffer, 0, NOUVEAU_BO_VRAM | + struct nouveau_bo *bo = nouveau_bo(nv10->tex[i].buffer); + BEGIN_RING(chan, celsius, NV10TCL_TX_OFFSET(i), 1); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - BEGIN_RING(celsius, NV10TCL_TX_FORMAT(i), 1); - OUT_RELOCd(nv10->tex[i].buffer, nv10->tex[i].format, + BEGIN_RING(chan, celsius, NV10TCL_TX_FORMAT(i), 1); + OUT_RELOCd(chan, bo, nv10->tex[i].format, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD | NOUVEAU_BO_OR, NV10TCL_TX_FORMAT_DMA0, NV10TCL_TX_FORMAT_DMA1); diff --git a/src/gallium/drivers/nv10/nv10_vbo.c b/src/gallium/drivers/nv10/nv10_vbo.c index 0d26141248..9180c72c9b 100644 --- a/src/gallium/drivers/nv10/nv10_vbo.c +++ b/src/gallium/drivers/nv10/nv10_vbo.c @@ -9,7 +9,7 @@ #include "nouveau/nouveau_channel.h" #include "nouveau/nouveau_pushbuf.h" -boolean nv10_draw_elements( struct pipe_context *pipe, +void nv10_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count) @@ -65,14 +65,12 @@ boolean nv10_draw_elements( struct pipe_context *pipe, pipe_buffer_unmap(pscreen, indexBuffer); draw_set_mapped_element_buffer(draw, 0, NULL); } - - return TRUE; } -boolean nv10_draw_arrays( struct pipe_context *pipe, - unsigned prim, unsigned start, unsigned count) +void nv10_draw_arrays( struct pipe_context *pipe, + unsigned prim, unsigned start, unsigned count) { - return nv10_draw_elements(pipe, NULL, 0, prim, start, count); + nv10_draw_elements(pipe, NULL, 0, prim, start, count); } diff --git a/src/gallium/drivers/nv20/nv20_context.c b/src/gallium/drivers/nv20/nv20_context.c index 6a147a4159..5b80af2d22 100644 --- a/src/gallium/drivers/nv20/nv20_context.c +++ b/src/gallium/drivers/nv20/nv20_context.c @@ -10,10 +10,14 @@ nv20_flush(struct pipe_context *pipe, unsigned flags, struct pipe_fence_handle **fence) { struct nv20_context *nv20 = nv20_context(pipe); + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; draw_flush(nv20->draw); - FIRE_RING(fence); + FIRE_RING(chan); + if (fence) + *fence = NULL; } static void @@ -31,348 +35,352 @@ static void nv20_init_hwctx(struct nv20_context *nv20) { struct nv20_screen *screen = nv20->screen; struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; int i; float projectionmatrix[16]; - const boolean is_nv25tcl = (nv20->screen->kelvin->grclass == NV25TCL); + const boolean is_nv25tcl = (kelvin->grclass == NV25TCL); - BEGIN_RING(kelvin, NV20TCL_DMA_NOTIFY, 1); - OUT_RING (screen->sync->handle); - BEGIN_RING(kelvin, NV20TCL_DMA_TEXTURE0, 2); - OUT_RING (chan->vram->handle); - OUT_RING (chan->gart->handle); /* TEXTURE1 */ - BEGIN_RING(kelvin, NV20TCL_DMA_COLOR, 2); - OUT_RING (chan->vram->handle); - OUT_RING (chan->vram->handle); /* ZETA */ + BEGIN_RING(chan, kelvin, NV20TCL_DMA_NOTIFY, 1); + OUT_RING (chan, screen->sync->handle); + BEGIN_RING(chan, kelvin, NV20TCL_DMA_TEXTURE0, 2); + OUT_RING (chan, chan->vram->handle); + OUT_RING (chan, chan->gart->handle); /* TEXTURE1 */ + BEGIN_RING(chan, kelvin, NV20TCL_DMA_COLOR, 2); + OUT_RING (chan, chan->vram->handle); + OUT_RING (chan, chan->vram->handle); /* ZETA */ - BEGIN_RING(kelvin, NV20TCL_DMA_QUERY, 1); - OUT_RING (0); /* renouveau: beef0351, unique */ + BEGIN_RING(chan, kelvin, NV20TCL_DMA_QUERY, 1); + OUT_RING (chan, 0); /* renouveau: beef0351, unique */ - BEGIN_RING(kelvin, NV20TCL_RT_HORIZ, 2); - OUT_RING (0); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_RT_HORIZ, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(0), 1); - OUT_RING ((0xfff << 16) | 0x0); - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_VERT(0), 1); - OUT_RING ((0xfff << 16) | 0x0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(0), 1); + OUT_RING (chan, (0xfff << 16) | 0x0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_VERT(0), 1); + OUT_RING (chan, (0xfff << 16) | 0x0); for (i = 1; i < NV20TCL_VIEWPORT_CLIP_HORIZ__SIZE; i++) { - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(i), 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_VERT(i), 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(i), 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_VERT(i), 1); + OUT_RING (chan, 0); } - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_MODE, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_MODE, 1); + OUT_RING (chan, 0); - BEGIN_RING(kelvin, 0x17e0, 3); - OUT_RINGf (0.0); - OUT_RINGf (0.0); - OUT_RINGf (1.0); + BEGIN_RING(chan, kelvin, 0x17e0, 3); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 1.0); if (is_nv25tcl) { - BEGIN_RING(kelvin, NV20TCL_TX_RCOMP, 1); - OUT_RING (NV20TCL_TX_RCOMP_LEQUAL | 0xdb0); + BEGIN_RING(chan, kelvin, NV20TCL_TX_RCOMP, 1); + OUT_RING (chan, NV20TCL_TX_RCOMP_LEQUAL | 0xdb0); } else { - BEGIN_RING(kelvin, 0x1e68, 1); - OUT_RING (0x4b800000); /* 16777216.000000 */ - BEGIN_RING(kelvin, NV20TCL_TX_RCOMP, 1); - OUT_RING (NV20TCL_TX_RCOMP_LEQUAL); + BEGIN_RING(chan, kelvin, 0x1e68, 1); + OUT_RING (chan, 0x4b800000); /* 16777216.000000 */ + BEGIN_RING(chan, kelvin, NV20TCL_TX_RCOMP, 1); + OUT_RING (chan, NV20TCL_TX_RCOMP_LEQUAL); } - BEGIN_RING(kelvin, 0x290, 1); - OUT_RING ((0x10 << 16) | 1); - BEGIN_RING(kelvin, 0x9fc, 1); - OUT_RING (0); - BEGIN_RING(kelvin, 0x1d80, 1); - OUT_RING (1); - BEGIN_RING(kelvin, 0x9f8, 1); - OUT_RING (4); - BEGIN_RING(kelvin, 0x17ec, 3); - OUT_RINGf (0.0); - OUT_RINGf (1.0); - OUT_RINGf (0.0); + BEGIN_RING(chan, kelvin, 0x290, 1); + OUT_RING (chan, (0x10 << 16) | 1); + BEGIN_RING(chan, kelvin, 0x9fc, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, 0x1d80, 1); + OUT_RING (chan, 1); + BEGIN_RING(chan, kelvin, 0x9f8, 1); + OUT_RING (chan, 4); + BEGIN_RING(chan, kelvin, 0x17ec, 3); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 1.0); + OUT_RINGf (chan, 0.0); if (is_nv25tcl) { - BEGIN_RING(kelvin, 0x1d88, 1); - OUT_RING (3); + BEGIN_RING(chan, kelvin, 0x1d88, 1); + OUT_RING (chan, 3); - BEGIN_RING(kelvin, NV25TCL_DMA_IN_MEMORY9, 1); - OUT_RING (chan->vram->handle); - BEGIN_RING(kelvin, NV25TCL_DMA_IN_MEMORY8, 1); - OUT_RING (chan->vram->handle); + BEGIN_RING(chan, kelvin, NV25TCL_DMA_IN_MEMORY9, 1); + OUT_RING (chan, chan->vram->handle); + BEGIN_RING(chan, kelvin, NV25TCL_DMA_IN_MEMORY8, 1); + OUT_RING (chan, chan->vram->handle); } - BEGIN_RING(kelvin, NV20TCL_DMA_FENCE, 1); - OUT_RING (0); /* renouveau: beef1e10 */ + BEGIN_RING(chan, kelvin, NV20TCL_DMA_FENCE, 1); + OUT_RING (chan, 0); /* renouveau: beef1e10 */ - BEGIN_RING(kelvin, 0x1e98, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, 0x1e98, 1); + OUT_RING (chan, 0); #if 0 if (is_nv25tcl) { - BEGIN_RING(NvSub3D, NV25TCL_DMA_IN_MEMORY4, 2); - OUT_RING (NvDmaTT); /* renouveau: beef0202 */ - OUT_RING (NvDmaFB); /* renouveau: beef0201 */ + BEGIN_RING(chan, NvSub3D, NV25TCL_DMA_IN_MEMORY4, 2); + OUT_RING (chan, NvDmaTT); /* renouveau: beef0202 */ + OUT_RING (chan, NvDmaFB); /* renouveau: beef0201 */ - BEGIN_RING(NvSub3D, NV20TCL_DMA_TEXTURE1, 1); - OUT_RING (NvDmaTT); /* renouveau: beef0202 */ + BEGIN_RING(chan, NvSub3D, NV20TCL_DMA_TEXTURE1, 1); + OUT_RING (chan, NvDmaTT); /* renouveau: beef0202 */ } #endif - BEGIN_RING(kelvin, NV20TCL_NOTIFY, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_NOTIFY, 1); + OUT_RING (chan, 0); - BEGIN_RING(kelvin, 0x120, 3); - OUT_RING (0); - OUT_RING (1); - OUT_RING (2); + BEGIN_RING(chan, kelvin, 0x120, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 1); + OUT_RING (chan, 2); /* error: ILLEGAL_MTHD, PROTECTION_FAULT - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_TRANSLATE_X, 4); - OUT_RINGf (0.0); - OUT_RINGf (512.0); - OUT_RINGf (0.0); - OUT_RINGf (0.0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_TRANSLATE_X, 4); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 512.0); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); */ if (is_nv25tcl) { - BEGIN_RING(kelvin, 0x022c, 2); - OUT_RING (0x280); - OUT_RING (0x07d28000); + BEGIN_RING(chan, kelvin, 0x022c, 2); + OUT_RING (chan, 0x280); + OUT_RING (chan, 0x07d28000); } /* * illegal method, protection fault - BEGIN_RING(NvSub3D, 0x1c2c, 1); - OUT_RING (0); */ + BEGIN_RING(chan, NvSub3D, 0x1c2c, 1); + OUT_RING (chan, 0); */ if (is_nv25tcl) { - BEGIN_RING(kelvin, 0x1da4, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, 0x1da4, 1); + OUT_RING (chan, 0); } /* * crashes with illegal method, protection fault - BEGIN_RING(NvSub3D, 0x1c18, 1); - OUT_RING (0x200); */ + BEGIN_RING(chan, NvSub3D, 0x1c18, 1); + OUT_RING (chan, 0x200); */ - BEGIN_RING(kelvin, NV20TCL_RT_HORIZ, 2); - OUT_RING ((0 << 16) | 0); - OUT_RING ((0 << 16) | 0); + BEGIN_RING(chan, kelvin, NV20TCL_RT_HORIZ, 2); + OUT_RING (chan, (0 << 16) | 0); + OUT_RING (chan, (0 << 16) | 0); /* *** Set state *** */ - BEGIN_RING(kelvin, NV20TCL_ALPHA_FUNC_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_ALPHA_FUNC_FUNC, 2); - OUT_RING (NV20TCL_ALPHA_FUNC_FUNC_ALWAYS); - OUT_RING (0); /* NV20TCL_ALPHA_FUNC_REF */ + BEGIN_RING(chan, kelvin, NV20TCL_ALPHA_FUNC_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_ALPHA_FUNC_FUNC, 2); + OUT_RING (chan, NV20TCL_ALPHA_FUNC_FUNC_ALWAYS); + OUT_RING (chan, 0); /* NV20TCL_ALPHA_FUNC_REF */ for (i = 0; i < NV20TCL_TX_ENABLE__SIZE; ++i) { - BEGIN_RING(kelvin, NV20TCL_TX_ENABLE(i), 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_TX_ENABLE(i), 1); + OUT_RING (chan, 0); } - BEGIN_RING(kelvin, NV20TCL_TX_SHADER_OP, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_TX_SHADER_CULL_MODE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_IN_ALPHA(0), 4); - OUT_RING (0x30d410d0); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_OUT_RGB(0), 4); - OUT_RING (0x00000c00); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_ENABLE, 1); - OUT_RING (0x00011101); - BEGIN_RING(kelvin, NV20TCL_RC_FINAL0, 2); - OUT_RING (0x130e0300); - OUT_RING (0x0c091c80); - BEGIN_RING(kelvin, NV20TCL_RC_OUT_ALPHA(0), 4); - OUT_RING (0x00000c00); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_IN_RGB(0), 4); - OUT_RING (0x20c400c0); - OUT_RING (0); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_COLOR0, 2); - OUT_RING (0); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_RC_CONSTANT_COLOR0(0), 4); - OUT_RING (0x035125a0); - OUT_RING (0); - OUT_RING (0x40002000); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_MULTISAMPLE_CONTROL, 1); - OUT_RING (0xffff0000); + BEGIN_RING(chan, kelvin, NV20TCL_TX_SHADER_OP, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_TX_SHADER_CULL_MODE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_IN_ALPHA(0), 4); + OUT_RING (chan, 0x30d410d0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_OUT_RGB(0), 4); + OUT_RING (chan, 0x00000c00); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_ENABLE, 1); + OUT_RING (chan, 0x00011101); + BEGIN_RING(chan, kelvin, NV20TCL_RC_FINAL0, 2); + OUT_RING (chan, 0x130e0300); + OUT_RING (chan, 0x0c091c80); + BEGIN_RING(chan, kelvin, NV20TCL_RC_OUT_ALPHA(0), 4); + OUT_RING (chan, 0x00000c00); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_IN_RGB(0), 4); + OUT_RING (chan, 0x20c400c0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_COLOR0, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_RC_CONSTANT_COLOR0(0), 4); + OUT_RING (chan, 0x035125a0); + OUT_RING (chan, 0); + OUT_RING (chan, 0x40002000); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_MULTISAMPLE_CONTROL, 1); + OUT_RING (chan, 0xffff0000); - BEGIN_RING(kelvin, NV20TCL_BLEND_FUNC_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_DITHER_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_STENCIL_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_BLEND_FUNC_SRC, 4); - OUT_RING (NV20TCL_BLEND_FUNC_SRC_ONE); - OUT_RING (NV20TCL_BLEND_FUNC_DST_ZERO); - OUT_RING (0); /* NV20TCL_BLEND_COLOR */ - OUT_RING (NV20TCL_BLEND_EQUATION_FUNC_ADD); - BEGIN_RING(kelvin, NV20TCL_STENCIL_MASK, 7); - OUT_RING (0xff); - OUT_RING (NV20TCL_STENCIL_FUNC_FUNC_ALWAYS); - OUT_RING (0); /* NV20TCL_STENCIL_FUNC_REF */ - OUT_RING (0xff); /* NV20TCL_STENCIL_FUNC_MASK */ - OUT_RING (NV20TCL_STENCIL_OP_FAIL_KEEP); - OUT_RING (NV20TCL_STENCIL_OP_ZFAIL_KEEP); - OUT_RING (NV20TCL_STENCIL_OP_ZPASS_KEEP); + BEGIN_RING(chan, kelvin, NV20TCL_BLEND_FUNC_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_DITHER_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_STENCIL_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_BLEND_FUNC_SRC, 4); + OUT_RING (chan, NV20TCL_BLEND_FUNC_SRC_ONE); + OUT_RING (chan, NV20TCL_BLEND_FUNC_DST_ZERO); + OUT_RING (chan, 0); /* NV20TCL_BLEND_COLOR */ + OUT_RING (chan, NV20TCL_BLEND_EQUATION_FUNC_ADD); + BEGIN_RING(chan, kelvin, NV20TCL_STENCIL_MASK, 7); + OUT_RING (chan, 0xff); + OUT_RING (chan, NV20TCL_STENCIL_FUNC_FUNC_ALWAYS); + OUT_RING (chan, 0); /* NV20TCL_STENCIL_FUNC_REF */ + OUT_RING (chan, 0xff); /* NV20TCL_STENCIL_FUNC_MASK */ + OUT_RING (chan, NV20TCL_STENCIL_OP_FAIL_KEEP); + OUT_RING (chan, NV20TCL_STENCIL_OP_ZFAIL_KEEP); + OUT_RING (chan, NV20TCL_STENCIL_OP_ZPASS_KEEP); - BEGIN_RING(kelvin, NV20TCL_COLOR_LOGIC_OP_ENABLE, 2); - OUT_RING (0); - OUT_RING (NV20TCL_COLOR_LOGIC_OP_OP_COPY); - BEGIN_RING(kelvin, 0x17cc, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_COLOR_LOGIC_OP_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, NV20TCL_COLOR_LOGIC_OP_OP_COPY); + BEGIN_RING(chan, kelvin, 0x17cc, 1); + OUT_RING (chan, 0); if (is_nv25tcl) { - BEGIN_RING(kelvin, 0x1d84, 1); - OUT_RING (1); + BEGIN_RING(chan, kelvin, 0x1d84, 1); + OUT_RING (chan, 1); } - BEGIN_RING(kelvin, NV20TCL_LIGHTING_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_LIGHT_CONTROL, 1); - OUT_RING (0x00020000); - BEGIN_RING(kelvin, NV20TCL_SEPARATE_SPECULAR_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_LIGHT_MODEL_TWO_SIDE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_ENABLED_LIGHTS, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_NORMALIZE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_POLYGON_STIPPLE_PATTERN(0), + BEGIN_RING(chan, kelvin, NV20TCL_LIGHTING_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_LIGHT_CONTROL, 1); + OUT_RING (chan, 0x00020000); + BEGIN_RING(chan, kelvin, NV20TCL_SEPARATE_SPECULAR_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_LIGHT_MODEL_TWO_SIDE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_ENABLED_LIGHTS, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_NORMALIZE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_STIPPLE_PATTERN(0), NV20TCL_POLYGON_STIPPLE_PATTERN__SIZE); for (i = 0; i < NV20TCL_POLYGON_STIPPLE_PATTERN__SIZE; ++i) { - OUT_RING(0xffffffff); + OUT_RING(chan, 0xffffffff); } - BEGIN_RING(kelvin, NV20TCL_POLYGON_OFFSET_POINT_ENABLE, 3); - OUT_RING (0); - OUT_RING (0); /* NV20TCL.POLYGON_OFFSET_LINE_ENABLE */ - OUT_RING (0); /* NV20TCL.POLYGON_OFFSET_FILL_ENABLE */ - BEGIN_RING(kelvin, NV20TCL_DEPTH_FUNC, 1); - OUT_RING (NV20TCL_DEPTH_FUNC_LESS); - BEGIN_RING(kelvin, NV20TCL_DEPTH_WRITE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_DEPTH_TEST_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_POLYGON_OFFSET_FACTOR, 2); - OUT_RINGf (0.0); - OUT_RINGf (0.0); /* NV20TCL.POLYGON_OFFSET_UNITS */ - BEGIN_RING(kelvin, NV20TCL_DEPTH_UNK17D8, 1); - OUT_RING (1); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_OFFSET_POINT_ENABLE, 3); + OUT_RING (chan, 0); + OUT_RING (chan, 0); /* NV20TCL.POLYGON_OFFSET_LINE_ENABLE */ + OUT_RING (chan, 0); /* NV20TCL.POLYGON_OFFSET_FILL_ENABLE */ + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_FUNC, 1); + OUT_RING (chan, NV20TCL_DEPTH_FUNC_LESS); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_WRITE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_TEST_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_OFFSET_FACTOR, 2); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 0.0); /* NV20TCL.POLYGON_OFFSET_UNITS */ + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_UNK17D8, 1); + OUT_RING (chan, 1); if (!is_nv25tcl) { - BEGIN_RING(kelvin, 0x1d84, 1); - OUT_RING (3); + BEGIN_RING(chan, kelvin, 0x1d84, 1); + OUT_RING (chan, 3); } - BEGIN_RING(kelvin, NV20TCL_POINT_SIZE, 1); + BEGIN_RING(chan, kelvin, NV20TCL_POINT_SIZE, 1); if (!is_nv25tcl) { - OUT_RING (8); + OUT_RING (chan, 8); } else { - OUT_RINGf (1.0); + OUT_RINGf (chan, 1.0); } if (!is_nv25tcl) { - BEGIN_RING(kelvin, NV20TCL_POINT_PARAMETERS_ENABLE, 2); - OUT_RING (0); - OUT_RING (0); /* NV20TCL.POINT_SMOOTH_ENABLE */ + BEGIN_RING(chan, kelvin, NV20TCL_POINT_PARAMETERS_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); /* NV20TCL.POINT_SMOOTH_ENABLE */ } else { - BEGIN_RING(kelvin, NV20TCL_POINT_PARAMETERS_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, 0x0a1c, 1); - OUT_RING (0x800); + BEGIN_RING(chan, kelvin, NV20TCL_POINT_PARAMETERS_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, 0x0a1c, 1); + OUT_RING (chan, 0x800); } - BEGIN_RING(kelvin, NV20TCL_LINE_WIDTH, 1); - OUT_RING (8); - BEGIN_RING(kelvin, NV20TCL_LINE_SMOOTH_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_POLYGON_MODE_FRONT, 2); - OUT_RING (NV20TCL_POLYGON_MODE_FRONT_FILL); - OUT_RING (NV20TCL_POLYGON_MODE_BACK_FILL); - BEGIN_RING(kelvin, NV20TCL_CULL_FACE, 2); - OUT_RING (NV20TCL_CULL_FACE_BACK); - OUT_RING (NV20TCL_FRONT_FACE_CCW); - BEGIN_RING(kelvin, NV20TCL_POLYGON_SMOOTH_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_CULL_FACE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_SHADE_MODEL, 1); - OUT_RING (NV20TCL_SHADE_MODEL_SMOOTH); - BEGIN_RING(kelvin, NV20TCL_POLYGON_STIPPLE_ENABLE, 1); - OUT_RING (0); - BEGIN_RING(kelvin, NV20TCL_TX_GEN_S(0), 4 * NV20TCL_TX_GEN_S__SIZE); + BEGIN_RING(chan, kelvin, NV20TCL_LINE_WIDTH, 1); + OUT_RING (chan, 8); + BEGIN_RING(chan, kelvin, NV20TCL_LINE_SMOOTH_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_MODE_FRONT, 2); + OUT_RING (chan, NV20TCL_POLYGON_MODE_FRONT_FILL); + OUT_RING (chan, NV20TCL_POLYGON_MODE_BACK_FILL); + BEGIN_RING(chan, kelvin, NV20TCL_CULL_FACE, 2); + OUT_RING (chan, NV20TCL_CULL_FACE_BACK); + OUT_RING (chan, NV20TCL_FRONT_FACE_CCW); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_SMOOTH_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_CULL_FACE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_SHADE_MODEL, 1); + OUT_RING (chan, NV20TCL_SHADE_MODEL_SMOOTH); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_STIPPLE_ENABLE, 1); + OUT_RING (chan, 0); + BEGIN_RING(chan, kelvin, NV20TCL_TX_GEN_S(0), 4 * NV20TCL_TX_GEN_S__SIZE); for (i=0; i < 4 * NV20TCL_TX_GEN_S__SIZE; ++i) { - OUT_RING(0); + OUT_RING(chan, 0); } - BEGIN_RING(kelvin, NV20TCL_FOG_EQUATION_CONSTANT, 3); - OUT_RINGf (1.5); - OUT_RINGf (-0.090168); /* NV20TCL.FOG_EQUATION_LINEAR */ - OUT_RINGf (0.0); /* NV20TCL.FOG_EQUATION_QUADRATIC */ - BEGIN_RING(kelvin, NV20TCL_FOG_MODE, 2); - OUT_RING (NV20TCL_FOG_MODE_EXP_2); - OUT_RING (NV20TCL_FOG_COORD_DIST_COORD_FOG); - BEGIN_RING(kelvin, NV20TCL_FOG_ENABLE, 2); - OUT_RING (0); - OUT_RING (0); /* NV20TCL.FOG_COLOR */ - BEGIN_RING(kelvin, NV20TCL_ENGINE, 1); - OUT_RING (NV20TCL_ENGINE_FIXED); + BEGIN_RING(chan, kelvin, NV20TCL_FOG_EQUATION_CONSTANT, 3); + OUT_RINGf (chan, 1.5); + OUT_RINGf (chan, -0.090168); /* NV20TCL.FOG_EQUATION_LINEAR */ + OUT_RINGf (chan, 0.0); /* NV20TCL.FOG_EQUATION_QUADRATIC */ + BEGIN_RING(chan, kelvin, NV20TCL_FOG_MODE, 2); + OUT_RING (chan, NV20TCL_FOG_MODE_EXP_SIGNED); + OUT_RING (chan, NV20TCL_FOG_COORD_FOG); + BEGIN_RING(chan, kelvin, NV20TCL_FOG_ENABLE, 2); + OUT_RING (chan, 0); + OUT_RING (chan, 0); /* NV20TCL.FOG_COLOR */ + BEGIN_RING(chan, kelvin, NV20TCL_ENGINE, 1); + OUT_RING (chan, NV20TCL_ENGINE_FIXED); for (i = 0; i < NV20TCL_TX_MATRIX_ENABLE__SIZE; ++i) { - BEGIN_RING(kelvin, NV20TCL_TX_MATRIX_ENABLE(i), 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_TX_MATRIX_ENABLE(i), 1); + OUT_RING (chan, 0); } - BEGIN_RING(kelvin, NV20TCL_VTX_ATTR_4F_X(1), 4 * 15); - OUT_RINGf(1.0); OUT_RINGf(0.0); OUT_RINGf(0.0); OUT_RINGf(1.0); - OUT_RINGf(0.0); OUT_RINGf(0.0); OUT_RINGf(1.0); OUT_RINGf(1.0); - OUT_RINGf(1.0); OUT_RINGf(1.0); OUT_RINGf(1.0); OUT_RINGf(1.0); + BEGIN_RING(chan, kelvin, NV20TCL_VTX_ATTR_4F_X(1), 4 * 15); + OUT_RINGf(chan, 1.0); OUT_RINGf(chan, 0.0); OUT_RINGf(chan, 0.0); OUT_RINGf(chan, 1.0); + OUT_RINGf(chan, 0.0); OUT_RINGf(chan, 0.0); OUT_RINGf(chan, 1.0); OUT_RINGf(chan, 1.0); + OUT_RINGf(chan, 1.0); OUT_RINGf(chan, 1.0); OUT_RINGf(chan, 1.0); OUT_RINGf(chan, 1.0); for (i = 4; i < 16; ++i) { - OUT_RINGf(0.0); OUT_RINGf(0.0); OUT_RINGf(0.0); OUT_RINGf(1.0); + OUT_RINGf(chan, 0.0); + OUT_RINGf(chan, 0.0); + OUT_RINGf(chan, 0.0); + OUT_RINGf(chan, 1.0); } - BEGIN_RING(kelvin, NV20TCL_EDGEFLAG_ENABLE, 1); - OUT_RING (1); - BEGIN_RING(kelvin, NV20TCL_COLOR_MASK, 1); - OUT_RING (0x00010101); - BEGIN_RING(kelvin, NV20TCL_CLEAR_VALUE, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV20TCL_EDGEFLAG_ENABLE, 1); + OUT_RING (chan, 1); + BEGIN_RING(chan, kelvin, NV20TCL_COLOR_MASK, 1); + OUT_RING (chan, 0x00010101); + BEGIN_RING(chan, kelvin, NV20TCL_CLEAR_VALUE, 1); + OUT_RING (chan, 0); memset(projectionmatrix, 0, sizeof(projectionmatrix)); projectionmatrix[0*4+0] = 1.0; projectionmatrix[1*4+1] = 1.0; projectionmatrix[2*4+2] = 16777215.0; projectionmatrix[3*4+3] = 1.0; - BEGIN_RING(kelvin, NV20TCL_PROJECTION_MATRIX(0), 16); + BEGIN_RING(chan, kelvin, NV20TCL_PROJECTION_MATRIX(0), 16); for (i = 0; i < 16; i++) { - OUT_RINGf (projectionmatrix[i]); + OUT_RINGf (chan, projectionmatrix[i]); } - BEGIN_RING(kelvin, NV20TCL_DEPTH_RANGE_NEAR, 2); - OUT_RINGf (0.0); - OUT_RINGf (16777216.0); /* [0, 1] scaled approx to [0, 2^24] */ + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_RANGE_NEAR, 2); + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 16777216.0); /* [0, 1] scaled approx to [0, 2^24] */ - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_TRANSLATE_X, 4); - OUT_RINGf (0.0); /* x-offset, w/2 + 1.031250 */ - OUT_RINGf (0.0); /* y-offset, h/2 + 0.030762 */ - OUT_RINGf (0.0); - OUT_RINGf (16777215.0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_TRANSLATE_X, 4); + OUT_RINGf (chan, 0.0); /* x-offset, w/2 + 1.031250 */ + OUT_RINGf (chan, 0.0); /* y-offset, h/2 + 0.030762 */ + OUT_RINGf (chan, 0.0); + OUT_RINGf (chan, 16777215.0); - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_SCALE_X, 4); - OUT_RINGf (0.0); /* no effect?, w/2 */ - OUT_RINGf (0.0); /* no effect?, h/2 */ - OUT_RINGf (16777215.0 * 0.5); - OUT_RINGf (65535.0); + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_SCALE_X, 4); + OUT_RINGf (chan, 0.0); /* no effect?, w/2 */ + OUT_RINGf (chan, 0.0); /* no effect?, h/2 */ + OUT_RINGf (chan, 16777215.0 * 0.5); + OUT_RINGf (chan, 65535.0); - FIRE_RING (NULL); + FIRE_RING (chan); } struct pipe_context * diff --git a/src/gallium/drivers/nv20/nv20_context.h b/src/gallium/drivers/nv20/nv20_context.h index a4eaa95660..c7dfadaa31 100644 --- a/src/gallium/drivers/nv20/nv20_context.h +++ b/src/gallium/drivers/nv20/nv20_context.h @@ -15,10 +15,6 @@ #include "nouveau/nouveau_gldefs.h" #include "nouveau/nouveau_context.h" -#define NOUVEAU_PUSH_CONTEXT(ctx) \ - struct nv20_screen *ctx = nv20->screen -#include "nouveau/nouveau_push.h" - #include "nv20_state.h" #define NOUVEAU_ERR(fmt, args...) \ @@ -143,9 +139,9 @@ extern void nv20_emit_hw_state(struct nv20_context *nv20); extern void nv20_state_tex_update(struct nv20_context *nv20); /* nv20_vbo.c */ -extern boolean nv20_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv20_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv20_draw_elements( struct pipe_context *pipe, +extern void nv20_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count); diff --git a/src/gallium/drivers/nv20/nv20_fragtex.c b/src/gallium/drivers/nv20/nv20_fragtex.c index 2db4a4015a..dedbec73f3 100644 --- a/src/gallium/drivers/nv20/nv20_fragtex.c +++ b/src/gallium/drivers/nv20/nv20_fragtex.c @@ -52,6 +52,9 @@ nv20_fragtex_build(struct nv20_context *nv20, int unit) struct nv20_miptree *nv20mt = nv20->tex_miptree[unit]; struct pipe_texture *pt = &nv20mt->base; struct nv20_texture_format *tf; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; uint32_t txf, txs, txp; tf = nv20_fragtex_format(pt->format); @@ -82,15 +85,15 @@ nv20_fragtex_build(struct nv20_context *nv20, int unit) return; } - BEGIN_RING(kelvin, NV10TCL_TX_OFFSET(unit), 8); - OUT_RELOCl(nv20mt->buffer, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - OUT_RELOCd(nv20mt->buffer,txf,NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); - OUT_RING (ps->wrap); - OUT_RING (0x40000000); /* enable */ - OUT_RING (txs); - OUT_RING (ps->filt | 0x2000 /* magic */); - OUT_RING ((pt->width0 << 16) | pt->height0); - OUT_RING (ps->bcol); + BEGIN_RING(chan, kelvin, NV10TCL_TX_OFFSET(unit), 8); + OUT_RELOCl(chan, nouveau_bo(nv20mt->buffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); + OUT_RELOCd(chan, nouveau_bo(nv20mt->buffer),txf,NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_OR | NOUVEAU_BO_RD, 1/*VRAM*/,2/*TT*/); + OUT_RING (chan, ps->wrap); + OUT_RING (chan, 0x40000000); /* enable */ + OUT_RING (chan, txs); + OUT_RING (chan, ps->filt | 0x2000 /* magic */); + OUT_RING (chan, (pt->width0 << 16) | pt->height0); + OUT_RING (chan, ps->bcol); #endif } @@ -99,6 +102,9 @@ nv20_fragtex_bind(struct nv20_context *nv20) { #if 0 struct nv20_fragment_program *fp = nv20->fragprog.active; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; unsigned samplers, unit; samplers = nv20->fp_samplers & ~fp->samplers; @@ -106,8 +112,8 @@ nv20_fragtex_bind(struct nv20_context *nv20) unit = ffs(samplers) - 1; samplers &= ~(1 << unit); - BEGIN_RING(kelvin, NV10TCL_TX_ENABLE(unit), 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV10TCL_TX_ENABLE(unit), 1); + OUT_RING (chan, 0); } samplers = nv20->dirty_samplers & fp->samplers; diff --git a/src/gallium/drivers/nv20/nv20_prim_vbuf.c b/src/gallium/drivers/nv20/nv20_prim_vbuf.c index ddfcdb8057..2e145672da 100644 --- a/src/gallium/drivers/nv20/nv20_prim_vbuf.c +++ b/src/gallium/drivers/nv20/nv20_prim_vbuf.c @@ -81,12 +81,15 @@ nv20_vbuf_render(struct vbuf_render *render) void nv20_vtxbuf_bind( struct nv20_context* nv20 ) { #if 0 + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; int i; for(i = 0; i < NV20TCL_VTXBUF_ADDRESS__SIZE; i++) { - BEGIN_RING(kelvin, NV20TCL_VTXBUF_ADDRESS(i), 1); - OUT_RING(0/*nv20->vtxbuf*/); - BEGIN_RING(kelvin, NV20TCL_VTXFMT(i) ,1); - OUT_RING(0/*XXX*/); + BEGIN_RING(chan, kelvin, NV20TCL_VTXBUF_ADDRESS(i), 1); + OUT_RING(chan, 0/*nv20->vtxbuf*/); + BEGIN_RING(chan, kelvin, NV20TCL_VTXFMT(i) ,1); + OUT_RING(chan, 0/*XXX*/); } #endif } @@ -202,6 +205,9 @@ nv20__vtxhwformat(unsigned stride, unsigned fields, unsigned type) static unsigned nv20__emit_format(struct nv20_context *nv20, enum attrib_emit type, int hwattr) { + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; uint32_t hwfmt = 0; unsigned fields; @@ -231,8 +237,8 @@ nv20__emit_format(struct nv20_context *nv20, enum attrib_emit type, int hwattr) return 0; } - BEGIN_RING(kelvin, NV20TCL_VTXFMT(hwattr), 1); - OUT_RING(hwfmt); + BEGIN_RING(chan, kelvin, NV20TCL_VTXFMT(hwattr), 1); + OUT_RING(chan, hwfmt); return fields; } @@ -262,6 +268,9 @@ nv20__draw_mbuffer(struct nv20_vbuf_render *nv20_render, uint nr_indices) { struct nv20_context *nv20 = nv20_render->nv20; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; struct vertex_info *vinfo = &nv20->vertex_info; unsigned nr_fields; int max_push; @@ -270,29 +279,29 @@ nv20__draw_mbuffer(struct nv20_vbuf_render *nv20_render, nr_fields = nv20__emit_vertex_array_format(nv20); - BEGIN_RING(kelvin, NV20TCL_VERTEX_BEGIN_END, 1); - OUT_RING(nv20_render->hwprim); + BEGIN_RING(chan, kelvin, NV20TCL_VERTEX_BEGIN_END, 1); + OUT_RING(chan, nv20_render->hwprim); max_push = 1200 / nr_fields; while (nr_indices) { int i; int push = MIN2(nr_indices, max_push); - BEGIN_RING_NI(kelvin, NV20TCL_VERTEX_DATA, push * nr_fields); + BEGIN_RING_NI(chan, kelvin, NV20TCL_VERTEX_DATA, push * nr_fields); for (i = 0; i < push; i++) { /* XXX: fixme to handle other than floats? */ int f = nr_fields; float *attrv = (float*)&data[indices[i] * vsz]; while (f-- > 0) - OUT_RINGf(*attrv++); + OUT_RINGf(chan, *attrv++); } nr_indices -= push; indices += push; } - BEGIN_RING(kelvin, NV20TCL_VERTEX_BEGIN_END, 1); - OUT_RING(NV20TCL_VERTEX_BEGIN_END_STOP); + BEGIN_RING(chan, kelvin, NV20TCL_VERTEX_BEGIN_END, 1); + OUT_RING(chan, NV20TCL_VERTEX_BEGIN_END_STOP); } static void @@ -301,20 +310,23 @@ nv20__draw_pbuffer(struct nv20_vbuf_render *nv20_render, uint nr_indices) { struct nv20_context *nv20 = nv20_render->nv20; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; int push, i; NOUVEAU_ERR("nv20__draw_pbuffer: this path is broken.\n"); - BEGIN_RING(kelvin, NV10TCL_VERTEX_ARRAY_OFFSET_POS, 1); - OUT_RELOCl(nv20_render->pbuffer, 0, + BEGIN_RING(chan, kelvin, NV10TCL_VERTEX_ARRAY_OFFSET_POS, 1); + OUT_RELOCl(chan, nouveau_bo(nv20_render->pbuffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - BEGIN_RING(kelvin, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); - OUT_RING(nv20_render->hwprim); + BEGIN_RING(chan, kelvin, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); + OUT_RING(chan, nv20_render->hwprim); if (nr_indices & 1) { - BEGIN_RING(kelvin, NV10TCL_VB_ELEMENT_U32, 1); - OUT_RING (indices[0]); + BEGIN_RING(chan, kelvin, NV10TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, indices[0]); indices++; nr_indices--; } @@ -322,16 +334,16 @@ nv20__draw_pbuffer(struct nv20_vbuf_render *nv20_render, // XXX too big/small ? check the size push = MIN2(nr_indices, 1200 * 2); - BEGIN_RING_NI(kelvin, NV10TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, kelvin, NV10TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((indices[i+1] << 16) | indices[i]); + OUT_RING(chan, (indices[i+1] << 16) | indices[i]); nr_indices -= push; indices += push; } - BEGIN_RING(kelvin, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, kelvin, NV10TCL_VERTEX_BUFFER_BEGIN_END, 1); + OUT_RING (chan, 0); } static void diff --git a/src/gallium/drivers/nv20/nv20_screen.c b/src/gallium/drivers/nv20/nv20_screen.c index a0973f1ebd..d091335063 100644 --- a/src/gallium/drivers/nv20/nv20_screen.c +++ b/src/gallium/drivers/nv20/nv20_screen.c @@ -176,7 +176,6 @@ nv20_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) NOUVEAU_ERR("Error creating 3D object: %d\n", ret); return FALSE; } - BIND_RING(chan, screen->kelvin, 7); /* 2D engine setup */ screen->eng2d = nv04_surface_2d_init(&screen->base); diff --git a/src/gallium/drivers/nv20/nv20_state_emit.c b/src/gallium/drivers/nv20/nv20_state_emit.c index 63cba1f412..6bbd1fdae9 100644 --- a/src/gallium/drivers/nv20/nv20_state_emit.c +++ b/src/gallium/drivers/nv20/nv20_state_emit.c @@ -5,27 +5,34 @@ static void nv20_state_emit_blend(struct nv20_context* nv20) { struct nv20_blend_state *b = nv20->blend; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; - BEGIN_RING(kelvin, NV20TCL_DITHER_ENABLE, 1); - OUT_RING (b->d_enable); + BEGIN_RING(chan, kelvin, NV20TCL_DITHER_ENABLE, 1); + OUT_RING (chan, b->d_enable); - BEGIN_RING(kelvin, NV20TCL_BLEND_FUNC_ENABLE, 1); - OUT_RING (b->b_enable); + BEGIN_RING(chan, kelvin, NV20TCL_BLEND_FUNC_ENABLE, 1); + OUT_RING (chan, b->b_enable); - BEGIN_RING(kelvin, NV20TCL_BLEND_FUNC_SRC, 2); - OUT_RING (b->b_srcfunc); - OUT_RING (b->b_dstfunc); + BEGIN_RING(chan, kelvin, NV20TCL_BLEND_FUNC_SRC, 2); + OUT_RING (chan, b->b_srcfunc); + OUT_RING (chan, b->b_dstfunc); - BEGIN_RING(kelvin, NV20TCL_COLOR_MASK, 1); - OUT_RING (b->c_mask); + BEGIN_RING(chan, kelvin, NV20TCL_COLOR_MASK, 1); + OUT_RING (chan, b->c_mask); } static void nv20_state_emit_blend_color(struct nv20_context* nv20) { struct pipe_blend_color *c = nv20->blend_color; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; - BEGIN_RING(kelvin, NV20TCL_BLEND_COLOR, 1); - OUT_RING ((float_to_ubyte(c->color[3]) << 24)| + BEGIN_RING(chan, kelvin, NV20TCL_BLEND_COLOR, 1); + OUT_RING (chan, + (float_to_ubyte(c->color[3]) << 24)| (float_to_ubyte(c->color[0]) << 16)| (float_to_ubyte(c->color[1]) << 8) | (float_to_ubyte(c->color[2]) << 0)); @@ -34,63 +41,69 @@ static void nv20_state_emit_blend_color(struct nv20_context* nv20) static void nv20_state_emit_rast(struct nv20_context* nv20) { struct nv20_rasterizer_state *r = nv20->rast; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; - BEGIN_RING(kelvin, NV20TCL_SHADE_MODEL, 2); - OUT_RING (r->shade_model); - OUT_RING (r->line_width); + BEGIN_RING(chan, kelvin, NV20TCL_SHADE_MODEL, 2); + OUT_RING (chan, r->shade_model); + OUT_RING (chan, r->line_width); - BEGIN_RING(kelvin, NV20TCL_POINT_SIZE, 1); - OUT_RING (r->point_size); + BEGIN_RING(chan, kelvin, NV20TCL_POINT_SIZE, 1); + OUT_RING (chan, r->point_size); - BEGIN_RING(kelvin, NV20TCL_POLYGON_MODE_FRONT, 2); - OUT_RING (r->poly_mode_front); - OUT_RING (r->poly_mode_back); + BEGIN_RING(chan, kelvin, NV20TCL_POLYGON_MODE_FRONT, 2); + OUT_RING (chan, r->poly_mode_front); + OUT_RING (chan, r->poly_mode_back); - BEGIN_RING(kelvin, NV20TCL_CULL_FACE, 2); - OUT_RING (r->cull_face); - OUT_RING (r->front_face); + BEGIN_RING(chan, kelvin, NV20TCL_CULL_FACE, 2); + OUT_RING (chan, r->cull_face); + OUT_RING (chan, r->front_face); - BEGIN_RING(kelvin, NV20TCL_LINE_SMOOTH_ENABLE, 2); - OUT_RING (r->line_smooth_en); - OUT_RING (r->poly_smooth_en); + BEGIN_RING(chan, kelvin, NV20TCL_LINE_SMOOTH_ENABLE, 2); + OUT_RING (chan, r->line_smooth_en); + OUT_RING (chan, r->poly_smooth_en); - BEGIN_RING(kelvin, NV20TCL_CULL_FACE_ENABLE, 1); - OUT_RING (r->cull_face_en); + BEGIN_RING(chan, kelvin, NV20TCL_CULL_FACE_ENABLE, 1); + OUT_RING (chan, r->cull_face_en); } static void nv20_state_emit_dsa(struct nv20_context* nv20) { struct nv20_depth_stencil_alpha_state *d = nv20->dsa; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; - BEGIN_RING(kelvin, NV20TCL_DEPTH_FUNC, 1); - OUT_RING (d->depth.func); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_FUNC, 1); + OUT_RING (chan, d->depth.func); - BEGIN_RING(kelvin, NV20TCL_DEPTH_WRITE_ENABLE, 1); - OUT_RING (d->depth.write_enable); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_WRITE_ENABLE, 1); + OUT_RING (chan, d->depth.write_enable); - BEGIN_RING(kelvin, NV20TCL_DEPTH_TEST_ENABLE, 1); - OUT_RING (d->depth.test_enable); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_TEST_ENABLE, 1); + OUT_RING (chan, d->depth.test_enable); - BEGIN_RING(kelvin, NV20TCL_DEPTH_UNK17D8, 1); - OUT_RING (1); + BEGIN_RING(chan, kelvin, NV20TCL_DEPTH_UNK17D8, 1); + OUT_RING (chan, 1); #if 0 - BEGIN_RING(kelvin, NV20TCL_STENCIL_ENABLE, 1); - OUT_RING (d->stencil.enable); - BEGIN_RING(kelvin, NV20TCL_STENCIL_MASK, 7); - OUT_RINGp ((uint32_t *)&(d->stencil.wmask), 7); + BEGIN_RING(chan, kelvin, NV20TCL_STENCIL_ENABLE, 1); + OUT_RING (chan, d->stencil.enable); + BEGIN_RING(chan, kelvin, NV20TCL_STENCIL_MASK, 7); + OUT_RINGp (chan, (uint32_t *)&(d->stencil.wmask), 7); #endif - BEGIN_RING(kelvin, NV20TCL_ALPHA_FUNC_ENABLE, 1); - OUT_RING (d->alpha.enabled); + BEGIN_RING(chan, kelvin, NV20TCL_ALPHA_FUNC_ENABLE, 1); + OUT_RING (chan, d->alpha.enabled); - BEGIN_RING(kelvin, NV20TCL_ALPHA_FUNC_FUNC, 1); - OUT_RING (d->alpha.func); + BEGIN_RING(chan, kelvin, NV20TCL_ALPHA_FUNC_FUNC, 1); + OUT_RING (chan, d->alpha.func); - BEGIN_RING(kelvin, NV20TCL_ALPHA_FUNC_REF, 1); - OUT_RING (d->alpha.ref); + BEGIN_RING(chan, kelvin, NV20TCL_ALPHA_FUNC_REF, 1); + OUT_RING (chan, d->alpha.ref); } static void nv20_state_emit_viewport(struct nv20_context* nv20) @@ -101,9 +114,13 @@ static void nv20_state_emit_scissor(struct nv20_context* nv20) { /* NV20TCL_SCISSOR_* is probably a software method */ /* struct pipe_scissor_state *s = nv20->scissor; - BEGIN_RING(kelvin, NV20TCL_SCISSOR_HORIZ, 2); - OUT_RING (((s->maxx - s->minx) << 16) | s->minx); - OUT_RING (((s->maxy - s->miny) << 16) | s->miny);*/ + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; + + BEGIN_RING(chan, kelvin, NV20TCL_SCISSOR_HORIZ, 2); + OUT_RING (chan, ((s->maxx - s->minx) << 16) | s->minx); + OUT_RING (chan, ((s->maxy - s->miny) << 16) | s->miny);*/ } static void nv20_state_emit_framebuffer(struct nv20_context* nv20) @@ -113,6 +130,9 @@ static void nv20_state_emit_framebuffer(struct nv20_context* nv20) uint32_t rt_format, w, h; int colour_format = 0, zeta_format = 0; struct nv20_miptree *nv20mt = 0; + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; w = fb->cbufs[0]->width; h = fb->cbufs[0]->height; @@ -150,11 +170,11 @@ static void nv20_state_emit_framebuffer(struct nv20_context* nv20) } if (zeta) { - BEGIN_RING(kelvin, NV20TCL_RT_PITCH, 1); - OUT_RING (rt->pitch | (zeta->pitch << 16)); + BEGIN_RING(chan, kelvin, NV20TCL_RT_PITCH, 1); + OUT_RING (chan, rt->pitch | (zeta->pitch << 16)); } else { - BEGIN_RING(kelvin, NV20TCL_RT_PITCH, 1); - OUT_RING (rt->pitch | (rt->pitch << 16)); + BEGIN_RING(chan, kelvin, NV20TCL_RT_PITCH, 1); + OUT_RING (chan, rt->pitch | (rt->pitch << 16)); } nv20mt = (struct nv20_miptree *)rt->base.texture; @@ -166,13 +186,13 @@ static void nv20_state_emit_framebuffer(struct nv20_context* nv20) nv20->zeta = nv20mt->buffer; } - BEGIN_RING(kelvin, NV20TCL_RT_HORIZ, 3); - OUT_RING ((w << 16) | 0); - OUT_RING ((h << 16) | 0); /*NV20TCL_RT_VERT */ - OUT_RING (rt_format); /* NV20TCL_RT_FORMAT */ - BEGIN_RING(kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(0), 2); - OUT_RING (((w - 1) << 16) | 0); - OUT_RING (((h - 1) << 16) | 0); + BEGIN_RING(chan, kelvin, NV20TCL_RT_HORIZ, 3); + OUT_RING (chan, (w << 16) | 0); + OUT_RING (chan, (h << 16) | 0); /*NV20TCL_RT_VERT */ + OUT_RING (chan, rt_format); /* NV20TCL_RT_FORMAT */ + BEGIN_RING(chan, kelvin, NV20TCL_VIEWPORT_CLIP_HORIZ(0), 2); + OUT_RING (chan, ((w - 1) << 16) | 0); + OUT_RING (chan, ((h - 1) << 16) | 0); } static void nv20_vertex_layout(struct nv20_context *nv20) @@ -293,6 +313,10 @@ static void nv20_vertex_layout(struct nv20_context *nv20) void nv20_emit_hw_state(struct nv20_context *nv20) { + struct nv20_screen *screen = nv20->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *kelvin = screen->kelvin; + struct nouveau_bo *rt_bo; int i; if (nv20->dirty & NV20_NEW_VERTPROG) { @@ -361,36 +385,39 @@ nv20_emit_hw_state(struct nv20_context *nv20) */ /* Render target */ - BEGIN_RING(kelvin, NV20TCL_DMA_COLOR, 1); - OUT_RELOCo(nv20->rt[0], NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(kelvin, NV20TCL_COLOR_OFFSET, 1); - OUT_RELOCl(nv20->rt[0], 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + rt_bo = nouveau_bo(nv20->rt[0]); + BEGIN_RING(chan, kelvin, NV20TCL_DMA_COLOR, 1); + OUT_RELOCo(chan, rt_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, kelvin, NV20TCL_COLOR_OFFSET, 1); + OUT_RELOCl(chan, rt_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); if (nv20->zeta) { - BEGIN_RING(kelvin, NV20TCL_DMA_ZETA, 1); - OUT_RELOCo(nv20->zeta, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(kelvin, NV20TCL_ZETA_OFFSET, 1); - OUT_RELOCl(nv20->zeta, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + struct nouveau_bo *zeta_bo = nouveau_bo(nv20->zeta); + BEGIN_RING(chan, kelvin, NV20TCL_DMA_ZETA, 1); + OUT_RELOCo(chan, zeta_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, kelvin, NV20TCL_ZETA_OFFSET, 1); + OUT_RELOCl(chan, zeta_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); /* XXX for when we allocate LMA on nv17 */ -/* BEGIN_RING(kelvin, NV10TCL_LMA_DEPTH_BUFFER_OFFSET, 1); - OUT_RELOCl(nv20->zeta + lma_offset);*/ +/* BEGIN_RING(chan, kelvin, NV10TCL_LMA_DEPTH_BUFFER_OFFSET, 1); + OUT_RELOCl(chan, nouveau_bo(nv20->zeta + lma_offset));*/ } /* Vertex buffer */ - BEGIN_RING(kelvin, NV20TCL_DMA_VTXBUF0, 1); - OUT_RELOCo(nv20->rt[0], NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); - BEGIN_RING(kelvin, NV20TCL_COLOR_OFFSET, 1); - OUT_RELOCl(nv20->rt[0], 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, kelvin, NV20TCL_DMA_VTXBUF0, 1); + OUT_RELOCo(chan, rt_bo, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); + BEGIN_RING(chan, kelvin, NV20TCL_COLOR_OFFSET, 1); + OUT_RELOCl(chan, rt_bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_WR); /* Texture images */ for (i = 0; i < 2; i++) { if (!(nv20->fp_samplers & (1 << i))) continue; - BEGIN_RING(kelvin, NV20TCL_TX_OFFSET(i), 1); - OUT_RELOCl(nv20->tex[i].buffer, 0, NOUVEAU_BO_VRAM | + struct nouveau_bo *bo = nouveau_bo(nv20->tex[i].buffer); + BEGIN_RING(chan, kelvin, NV20TCL_TX_OFFSET(i), 1); + OUT_RELOCl(chan, bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD); - BEGIN_RING(kelvin, NV20TCL_TX_FORMAT(i), 1); - OUT_RELOCd(nv20->tex[i].buffer, nv20->tex[i].format, + BEGIN_RING(chan, kelvin, NV20TCL_TX_FORMAT(i), 1); + OUT_RELOCd(chan, bo, nv20->tex[i].format, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD | NOUVEAU_BO_OR, NV20TCL_TX_FORMAT_DMA0, NV20TCL_TX_FORMAT_DMA1); diff --git a/src/gallium/drivers/nv20/nv20_vbo.c b/src/gallium/drivers/nv20/nv20_vbo.c index 4bf461eba9..52991a0d85 100644 --- a/src/gallium/drivers/nv20/nv20_vbo.c +++ b/src/gallium/drivers/nv20/nv20_vbo.c @@ -9,7 +9,7 @@ #include "nouveau/nouveau_channel.h" #include "nouveau/nouveau_pushbuf.h" -boolean nv20_draw_elements( struct pipe_context *pipe, +void nv20_draw_elements( struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned prim, unsigned start, unsigned count) @@ -67,13 +67,12 @@ boolean nv20_draw_elements( struct pipe_context *pipe, } draw_flush(nv20->draw); - return TRUE; } -boolean nv20_draw_arrays( struct pipe_context *pipe, +void nv20_draw_arrays( struct pipe_context *pipe, unsigned prim, unsigned start, unsigned count) { - return nv20_draw_elements(pipe, NULL, 0, prim, start, count); + nv20_draw_elements(pipe, NULL, 0, prim, start, count); } diff --git a/src/gallium/drivers/nv30/nv30_context.c b/src/gallium/drivers/nv30/nv30_context.c index 38b39159f1..54572e9ab3 100644 --- a/src/gallium/drivers/nv30/nv30_context.c +++ b/src/gallium/drivers/nv30/nv30_context.c @@ -10,15 +10,20 @@ nv30_flush(struct pipe_context *pipe, unsigned flags, struct pipe_fence_handle **fence) { struct nv30_context *nv30 = nv30_context(pipe); + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; if (flags & PIPE_FLUSH_TEXTURE_CACHE) { - BEGIN_RING(rankine, 0x1fd8, 1); - OUT_RING (2); - BEGIN_RING(rankine, 0x1fd8, 1); - OUT_RING (1); + BEGIN_RING(chan, rankine, 0x1fd8, 1); + OUT_RING (chan, 2); + BEGIN_RING(chan, rankine, 0x1fd8, 1); + OUT_RING (chan, 1); } - FIRE_RING(fence); + FIRE_RING(chan); + if (fence) + *fence = NULL; } static void diff --git a/src/gallium/drivers/nv30/nv30_context.h b/src/gallium/drivers/nv30/nv30_context.h index 864ddaeb59..e59449287b 100644 --- a/src/gallium/drivers/nv30/nv30_context.h +++ b/src/gallium/drivers/nv30/nv30_context.h @@ -14,10 +14,6 @@ #include "nouveau/nouveau_winsys.h" #include "nouveau/nouveau_gldefs.h" #include "nouveau/nouveau_context.h" - -#define NOUVEAU_PUSH_CONTEXT(ctx) \ - struct nv30_screen *ctx = nv30->screen -#include "nouveau/nouveau_push.h" #include "nouveau/nouveau_stateobj.h" #include "nv30_state.h" @@ -198,9 +194,9 @@ extern struct nv30_state_entry nv30_state_fragtex; extern struct nv30_state_entry nv30_state_vbo; /* nv30_vbo.c */ -extern boolean nv30_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv30_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv30_draw_elements(struct pipe_context *pipe, +extern void nv30_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, diff --git a/src/gallium/drivers/nv30/nv30_fragprog.c b/src/gallium/drivers/nv30/nv30_fragprog.c index d1ff18e2df..2d565cb631 100644 --- a/src/gallium/drivers/nv30/nv30_fragprog.c +++ b/src/gallium/drivers/nv30/nv30_fragprog.c @@ -837,7 +837,7 @@ nv30_fragprog_validate(struct nv30_context *nv30) fp->buffer = pscreen->buffer_create(pscreen, 0x100, 0, fp->insn_len * 4); nv30_fragprog_upload(nv30, fp); - so = so_new(8, 1); + so = so_new(4, 4, 1); so_method(so, nv30->screen->rankine, NV34TCL_FP_ACTIVE_PROGRAM, 1); so_reloc (so, nouveau_bo(fp->buffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD | NOUVEAU_BO_LOW | diff --git a/src/gallium/drivers/nv30/nv30_fragtex.c b/src/gallium/drivers/nv30/nv30_fragtex.c index b3293ee700..9893567891 100644 --- a/src/gallium/drivers/nv30/nv30_fragtex.c +++ b/src/gallium/drivers/nv30/nv30_fragtex.c @@ -106,7 +106,7 @@ nv30_fragtex_build(struct nv30_context *nv30, int unit) txs = tf->swizzle; - so = so_new(16, 2); + so = so_new(1, 8, 2); so_method(so, nv30->screen->rankine, NV34TCL_TX_OFFSET(unit), 8); so_reloc (so, bo, 0, tex_flags | NOUVEAU_BO_LOW, 0, 0); so_reloc (so, bo, txf, tex_flags | NOUVEAU_BO_OR, @@ -135,7 +135,7 @@ nv30_fragtex_validate(struct nv30_context *nv30) unit = ffs(samplers) - 1; samplers &= ~(1 << unit); - so = so_new(2, 0); + so = so_new(1, 1, 0); so_method(so, nv30->screen->rankine, NV34TCL_TX_ENABLE(unit), 1); so_data (so, 0); so_ref(so, &nv30->state.hw[NV30_STATE_FRAGTEX0 + unit]); diff --git a/src/gallium/drivers/nv30/nv30_query.c b/src/gallium/drivers/nv30/nv30_query.c index 1d1c8a484e..e27e9ccbf6 100644 --- a/src/gallium/drivers/nv30/nv30_query.c +++ b/src/gallium/drivers/nv30/nv30_query.c @@ -41,6 +41,9 @@ nv30_query_begin(struct pipe_context *pipe, struct pipe_query *pq) { struct nv30_context *nv30 = nv30_context(pipe); struct nv30_query *q = nv30_query(pq); + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; assert(q->type == PIPE_QUERY_OCCLUSION_COUNTER); @@ -57,10 +60,10 @@ nv30_query_begin(struct pipe_context *pipe, struct pipe_query *pq) assert(0); nouveau_notifier_reset(nv30->screen->query, q->object->start); - BEGIN_RING(rankine, NV34TCL_QUERY_RESET, 1); - OUT_RING (1); - BEGIN_RING(rankine, NV34TCL_QUERY_UNK17CC, 1); - OUT_RING (1); + BEGIN_RING(chan, rankine, NV34TCL_QUERY_RESET, 1); + OUT_RING (chan, 1); + BEGIN_RING(chan, rankine, NV34TCL_QUERY_UNK17CC, 1); + OUT_RING (chan, 1); q->ready = FALSE; } @@ -69,12 +72,15 @@ static void nv30_query_end(struct pipe_context *pipe, struct pipe_query *pq) { struct nv30_context *nv30 = nv30_context(pipe); + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; struct nv30_query *q = nv30_query(pq); - BEGIN_RING(rankine, NV34TCL_QUERY_GET, 1); - OUT_RING ((0x01 << NV34TCL_QUERY_GET_UNK24_SHIFT) | + BEGIN_RING(chan, rankine, NV34TCL_QUERY_GET, 1); + OUT_RING (chan, (0x01 << NV34TCL_QUERY_GET_UNK24_SHIFT) | ((q->object->start * 32) << NV34TCL_QUERY_GET_OFFSET_SHIFT)); - FIRE_RING(NULL); + FIRE_RING(chan); } static boolean diff --git a/src/gallium/drivers/nv30/nv30_screen.c b/src/gallium/drivers/nv30/nv30_screen.c index 760467f736..9ed48178dc 100644 --- a/src/gallium/drivers/nv30/nv30_screen.c +++ b/src/gallium/drivers/nv30/nv30_screen.c @@ -233,7 +233,6 @@ nv30_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) NOUVEAU_ERR("Error creating 3D object: %d\n", ret); return FALSE; } - BIND_RING(chan, screen->rankine, 7); /* 2D engine setup */ screen->eng2d = nv04_surface_2d_init(&screen->base); @@ -270,7 +269,7 @@ nv30_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) } /* Static rankine initialisation */ - so = so_new(128, 0); + so = so_new(36, 60, 0); so_method(so, screen->rankine, NV34TCL_DMA_NOTIFY, 1); so_data (so, screen->sync->handle); so_method(so, screen->rankine, NV34TCL_DMA_TEXTURE0, 2); diff --git a/src/gallium/drivers/nv30/nv30_state.c b/src/gallium/drivers/nv30/nv30_state.c index e6321b480f..a80dfb0488 100644 --- a/src/gallium/drivers/nv30/nv30_state.c +++ b/src/gallium/drivers/nv30/nv30_state.c @@ -14,7 +14,7 @@ nv30_blend_state_create(struct pipe_context *pipe, struct nv30_context *nv30 = nv30_context(pipe); struct nouveau_grobj *rankine = nv30->screen->rankine; struct nv30_blend_state *bso = CALLOC(1, sizeof(*bso)); - struct nouveau_stateobj *so = so_new(16, 0); + struct nouveau_stateobj *so = so_new(5, 8, 0); if (cso->blend_enable) { so_method(so, rankine, NV34TCL_BLEND_FUNC_ENABLE, 3); @@ -300,7 +300,7 @@ nv30_rasterizer_state_create(struct pipe_context *pipe, { struct nv30_context *nv30 = nv30_context(pipe); struct nv30_rasterizer_state *rsso = CALLOC(1, sizeof(*rsso)); - struct nouveau_stateobj *so = so_new(32, 0); + struct nouveau_stateobj *so = so_new(9, 19, 0); struct nouveau_grobj *rankine = nv30->screen->rankine; /*XXX: ignored: @@ -435,7 +435,7 @@ nv30_depth_stencil_alpha_state_create(struct pipe_context *pipe, { struct nv30_context *nv30 = nv30_context(pipe); struct nv30_zsa_state *zsaso = CALLOC(1, sizeof(*zsaso)); - struct nouveau_stateobj *so = so_new(32, 0); + struct nouveau_stateobj *so = so_new(5, 21, 0); struct nouveau_grobj *rankine = nv30->screen->rankine; so_method(so, rankine, NV34TCL_DEPTH_FUNC, 3); diff --git a/src/gallium/drivers/nv30/nv30_state_blend.c b/src/gallium/drivers/nv30/nv30_state_blend.c index 64cf9ae93a..c36d58c040 100644 --- a/src/gallium/drivers/nv30/nv30_state_blend.c +++ b/src/gallium/drivers/nv30/nv30_state_blend.c @@ -18,7 +18,7 @@ struct nv30_state_entry nv30_state_blend = { static boolean nv30_state_blend_colour_validate(struct nv30_context *nv30) { - struct nouveau_stateobj *so = so_new(2, 0); + struct nouveau_stateobj *so = so_new(1, 1, 0); struct pipe_blend_color *bcol = &nv30->blend_colour; so_method(so, nv30->screen->rankine, NV34TCL_BLEND_COLOR, 1); diff --git a/src/gallium/drivers/nv30/nv30_state_fb.c b/src/gallium/drivers/nv30/nv30_state_fb.c index 6f6d1740d6..2ed2ea55e8 100644 --- a/src/gallium/drivers/nv30/nv30_state_fb.c +++ b/src/gallium/drivers/nv30/nv30_state_fb.c @@ -10,7 +10,7 @@ nv30_state_framebuffer_validate(struct nv30_context *nv30) struct nv04_surface *rt[2], *zeta = NULL; uint32_t rt_enable = 0, rt_format = 0; int i, colour_format = 0, zeta_format = 0, depth_only = 0; - struct nouveau_stateobj *so = so_new(64, 10); + struct nouveau_stateobj *so = so_new(12, 18, 10); unsigned rt_flags = NOUVEAU_BO_RDWR | NOUVEAU_BO_VRAM; unsigned w = fb->width; unsigned h = fb->height; diff --git a/src/gallium/drivers/nv30/nv30_state_scissor.c b/src/gallium/drivers/nv30/nv30_state_scissor.c index 3ac7a8471e..ba61a9e24a 100644 --- a/src/gallium/drivers/nv30/nv30_state_scissor.c +++ b/src/gallium/drivers/nv30/nv30_state_scissor.c @@ -12,7 +12,7 @@ nv30_state_scissor_validate(struct nv30_context *nv30) return FALSE; nv30->state.scissor_enabled = rast->scissor; - so = so_new(3, 0); + so = so_new(1, 2, 0); so_method(so, nv30->screen->rankine, NV34TCL_SCISSOR_HORIZ, 2); if (nv30->state.scissor_enabled) { so_data (so, ((s->maxx - s->minx) << 16) | s->minx); diff --git a/src/gallium/drivers/nv30/nv30_state_stipple.c b/src/gallium/drivers/nv30/nv30_state_stipple.c index d0c791ac08..ed520a4f43 100644 --- a/src/gallium/drivers/nv30/nv30_state_stipple.c +++ b/src/gallium/drivers/nv30/nv30_state_stipple.c @@ -14,14 +14,14 @@ nv30_state_stipple_validate(struct nv30_context *nv30) if (rast->poly_stipple_enable) { unsigned i; - so = so_new(35, 0); + so = so_new(2, 33, 0); so_method(so, rankine, NV34TCL_POLYGON_STIPPLE_ENABLE, 1); so_data (so, 1); so_method(so, rankine, NV34TCL_POLYGON_STIPPLE_PATTERN(0), 32); for (i = 0; i < 32; i++) so_data(so, nv30->stipple[i]); } else { - so = so_new(2, 0); + so = so_new(1, 1, 0); so_method(so, rankine, NV34TCL_POLYGON_STIPPLE_ENABLE, 1); so_data (so, 0); } diff --git a/src/gallium/drivers/nv30/nv30_state_viewport.c b/src/gallium/drivers/nv30/nv30_state_viewport.c index c3eb413dac..2d7781292b 100644 --- a/src/gallium/drivers/nv30/nv30_state_viewport.c +++ b/src/gallium/drivers/nv30/nv30_state_viewport.c @@ -19,7 +19,7 @@ nv30_state_viewport_validate(struct nv30_context *nv30) return FALSE; nv30->state.viewport_bypass = bypass; - so = so_new(11, 0); + so = so_new(3, 10, 0); if (!bypass) { so_method(so, nv30->screen->rankine, NV34TCL_VIEWPORT_TRANSLATE_X, 8); diff --git a/src/gallium/drivers/nv30/nv30_vbo.c b/src/gallium/drivers/nv30/nv30_vbo.c index e32b8141af..1c5db03ea2 100644 --- a/src/gallium/drivers/nv30/nv30_vbo.c +++ b/src/gallium/drivers/nv30/nv30_vbo.c @@ -163,19 +163,21 @@ nv30_vbo_static_attrib(struct nv30_context *nv30, struct nouveau_stateobj *so, return TRUE; } -boolean +void nv30_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { struct nv30_context *nv30 = nv30_context(pipe); - struct nouveau_channel *chan = nv30->screen->base.channel; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; unsigned restart = 0; nv30_vbo_set_idxbuf(nv30, NULL, 0); if (FORCE_SWTNL || !nv30_state_validate(nv30)) { /*return nv30_draw_elements_swtnl(pipe, NULL, 0, mode, start, count);*/ - return FALSE; + return; } while (count) { @@ -186,17 +188,17 @@ nv30_draw_arrays(struct pipe_context *pipe, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 256, mode, start, count, &restart); if (!vc) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); nr = (vc & 0xff); if (nr) { - BEGIN_RING(rankine, NV34TCL_VB_VERTEX_BATCH, 1); - OUT_RING (((nr - 1) << 24) | start); + BEGIN_RING(chan, rankine, NV34TCL_VB_VERTEX_BATCH, 1); + OUT_RING (chan, ((nr - 1) << 24) | start); start += nr; } @@ -206,15 +208,15 @@ nv30_draw_arrays(struct pipe_context *pipe, nr -= push; - BEGIN_RING_NI(rankine, NV34TCL_VB_VERTEX_BATCH, push); + BEGIN_RING_NI(chan, rankine, NV34TCL_VB_VERTEX_BATCH, push); while (push--) { - OUT_RING(((0x100 - 1) << 24) | start); + OUT_RING(chan, ((0x100 - 1) << 24) | start); start += 0x100; } } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, 0); count -= vc; start = restart; @@ -228,7 +230,9 @@ static INLINE void nv30_draw_elements_u08(struct nv30_context *nv30, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv30->screen->base.channel; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; while (count) { uint8_t *elts = (uint8_t *)ib + start; @@ -239,17 +243,17 @@ nv30_draw_elements_u08(struct nv30_context *nv30, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 2, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); if (vc & 1) { - BEGIN_RING(rankine, NV34TCL_VB_ELEMENT_U32, 1); - OUT_RING (elts[0]); + BEGIN_RING(chan, rankine, NV34TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, elts[0]); elts++; vc--; } @@ -258,16 +262,16 @@ nv30_draw_elements_u08(struct nv30_context *nv30, void *ib, push = MIN2(vc, 2047 * 2); - BEGIN_RING_NI(rankine, NV34TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, rankine, NV34TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((elts[i+1] << 16) | elts[i]); + OUT_RING(chan, (elts[i+1] << 16) | elts[i]); vc -= push; elts += push; } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } @@ -277,7 +281,9 @@ static INLINE void nv30_draw_elements_u16(struct nv30_context *nv30, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv30->screen->base.channel; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; while (count) { uint16_t *elts = (uint16_t *)ib + start; @@ -288,17 +294,17 @@ nv30_draw_elements_u16(struct nv30_context *nv30, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 2, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); if (vc & 1) { - BEGIN_RING(rankine, NV34TCL_VB_ELEMENT_U32, 1); - OUT_RING (elts[0]); + BEGIN_RING(chan, rankine, NV34TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, elts[0]); elts++; vc--; } @@ -307,16 +313,16 @@ nv30_draw_elements_u16(struct nv30_context *nv30, void *ib, push = MIN2(vc, 2047 * 2); - BEGIN_RING_NI(rankine, NV34TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, rankine, NV34TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((elts[i+1] << 16) | elts[i]); + OUT_RING(chan, (elts[i+1] << 16) | elts[i]); vc -= push; elts += push; } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } @@ -326,7 +332,9 @@ static INLINE void nv30_draw_elements_u32(struct nv30_context *nv30, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv30->screen->base.channel; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; while (count) { uint32_t *elts = (uint32_t *)ib + start; @@ -337,32 +345,32 @@ nv30_draw_elements_u32(struct nv30_context *nv30, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 5, 1, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); while (vc) { push = MIN2(vc, 2047); - BEGIN_RING_NI(rankine, NV34TCL_VB_ELEMENT_U32, push); - OUT_RINGp (elts, push); + BEGIN_RING_NI(chan, rankine, NV34TCL_VB_ELEMENT_U32, push); + OUT_RINGp (chan, elts, push); vc -= push; elts += push; } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } } -static boolean +static void nv30_draw_elements_inline(struct pipe_context *pipe, struct pipe_buffer *ib, unsigned ib_size, unsigned mode, unsigned start, unsigned count) @@ -393,15 +401,16 @@ nv30_draw_elements_inline(struct pipe_context *pipe, } pipe_buffer_unmap(pscreen, ib); - return TRUE; } -static boolean +static void nv30_draw_elements_vbo(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { struct nv30_context *nv30 = nv30_context(pipe); - struct nouveau_channel *chan = nv30->screen->base.channel; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; unsigned restart = 0; while (count) { @@ -412,17 +421,17 @@ nv30_draw_elements_vbo(struct pipe_context *pipe, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 256, mode, start, count, &restart); if (!vc) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); nr = (vc & 0xff); if (nr) { - BEGIN_RING(rankine, NV34TCL_VB_INDEX_BATCH, 1); - OUT_RING (((nr - 1) << 24) | start); + BEGIN_RING(chan, rankine, NV34TCL_VB_INDEX_BATCH, 1); + OUT_RING (chan, ((nr - 1) << 24) | start); start += nr; } @@ -432,24 +441,22 @@ nv30_draw_elements_vbo(struct pipe_context *pipe, nr -= push; - BEGIN_RING_NI(rankine, NV34TCL_VB_INDEX_BATCH, push); + BEGIN_RING_NI(chan, rankine, NV34TCL_VB_INDEX_BATCH, push); while (push--) { - OUT_RING(((0x100 - 1) << 24) | start); + OUT_RING(chan, ((0x100 - 1) << 24) | start); start += 0x100; } } - BEGIN_RING(rankine, NV34TCL_VERTEX_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, rankine, NV34TCL_VERTEX_BEGIN_END, 1); + OUT_RING (chan, 0); count -= vc; start = restart; } - - return TRUE; } -boolean +void nv30_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) @@ -461,7 +468,7 @@ nv30_draw_elements(struct pipe_context *pipe, if (FORCE_SWTNL || !nv30_state_validate(nv30)) { /*return nv30_draw_elements_swtnl(pipe, NULL, 0, mode, start, count);*/ - return FALSE; + return; } if (idxbuf) { @@ -472,7 +479,6 @@ nv30_draw_elements(struct pipe_context *pipe, } pipe->flush(pipe, 0, NULL); - return TRUE; } static boolean @@ -485,9 +491,9 @@ nv30_vbo_validate(struct nv30_context *nv30) unsigned vb_flags = NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD; int hw; - vtxbuf = so_new(20, 18); + vtxbuf = so_new(3, 17, 18); so_method(vtxbuf, rankine, NV34TCL_VTXBUF_ADDRESS(0), nv30->vtxelt_nr); - vtxfmt = so_new(17, 0); + vtxfmt = so_new(1, 16, 0); so_method(vtxfmt, rankine, NV34TCL_VTXFMT(0), nv30->vtxelt_nr); for (hw = 0; hw < nv30->vtxelt_nr; hw++) { @@ -500,7 +506,7 @@ nv30_vbo_validate(struct nv30_context *nv30) if (!vb->stride) { if (!sattr) - sattr = so_new(16 * 5, 0); + sattr = so_new(16, 16 * 4, 0); if (nv30_vbo_static_attrib(nv30, sattr, hw, ve, vb)) { so_data(vtxbuf, 0); diff --git a/src/gallium/drivers/nv30/nv30_vertprog.c b/src/gallium/drivers/nv30/nv30_vertprog.c index 5d60984622..e77a5be3f2 100644 --- a/src/gallium/drivers/nv30/nv30_vertprog.c +++ b/src/gallium/drivers/nv30/nv30_vertprog.c @@ -650,7 +650,9 @@ static boolean nv30_vertprog_validate(struct nv30_context *nv30) { struct pipe_screen *pscreen = nv30->pipe.screen; - struct nouveau_grobj *rankine = nv30->screen->rankine; + struct nv30_screen *screen = nv30->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *rankine = screen->rankine; struct nv30_vertex_program *vp; struct pipe_buffer *constbuf; boolean upload_code = FALSE, upload_data = FALSE; @@ -684,7 +686,7 @@ nv30_vertprog_validate(struct nv30_context *nv30) assert(0); } - so = so_new(2, 0); + so = so_new(1, 1, 0); so_method(so, rankine, NV34TCL_VP_START_FROM_ID, 1); so_data (so, vp->exec->start); so_ref(so, &vp->so); @@ -770,9 +772,9 @@ nv30_vertprog_validate(struct nv30_context *nv30) 4 * sizeof(float)); } - BEGIN_RING(rankine, NV34TCL_VP_UPLOAD_CONST_ID, 5); - OUT_RING (i + vp->data->start); - OUT_RINGp ((uint32_t *)vpd->value, 4); + BEGIN_RING(chan, rankine, NV34TCL_VP_UPLOAD_CONST_ID, 5); + OUT_RING (chan, i + vp->data->start); + OUT_RINGp (chan, (uint32_t *)vpd->value, 4); } if (constbuf) @@ -788,11 +790,11 @@ nv30_vertprog_validate(struct nv30_context *nv30) vp->insns[i].data[2], vp->insns[i].data[3]); } #endif - BEGIN_RING(rankine, NV34TCL_VP_UPLOAD_FROM_ID, 1); - OUT_RING (vp->exec->start); + BEGIN_RING(chan, rankine, NV34TCL_VP_UPLOAD_FROM_ID, 1); + OUT_RING (chan, vp->exec->start); for (i = 0; i < vp->nr_insns; i++) { - BEGIN_RING(rankine, NV34TCL_VP_UPLOAD_INST(0), 4); - OUT_RINGp (vp->insns[i].data, 4); + BEGIN_RING(chan, rankine, NV34TCL_VP_UPLOAD_INST(0), 4); + OUT_RINGp (chan, vp->insns[i].data, 4); } } diff --git a/src/gallium/drivers/nv40/nv40_context.c b/src/gallium/drivers/nv40/nv40_context.c index d56c7a6b49..f79ae4db84 100644 --- a/src/gallium/drivers/nv40/nv40_context.c +++ b/src/gallium/drivers/nv40/nv40_context.c @@ -10,15 +10,20 @@ nv40_flush(struct pipe_context *pipe, unsigned flags, struct pipe_fence_handle **fence) { struct nv40_context *nv40 = nv40_context(pipe); + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; if (flags & PIPE_FLUSH_TEXTURE_CACHE) { - BEGIN_RING(curie, 0x1fd8, 1); - OUT_RING (2); - BEGIN_RING(curie, 0x1fd8, 1); - OUT_RING (1); + BEGIN_RING(chan, curie, 0x1fd8, 1); + OUT_RING (chan, 2); + BEGIN_RING(chan, curie, 0x1fd8, 1); + OUT_RING (chan, 1); } - FIRE_RING(fence); + FIRE_RING(chan); + if (fence) + *fence = NULL; } static void diff --git a/src/gallium/drivers/nv40/nv40_context.h b/src/gallium/drivers/nv40/nv40_context.h index 83fcf1785d..e219bb537a 100644 --- a/src/gallium/drivers/nv40/nv40_context.h +++ b/src/gallium/drivers/nv40/nv40_context.h @@ -14,10 +14,6 @@ #include "nouveau/nouveau_winsys.h" #include "nouveau/nouveau_gldefs.h" #include "nouveau/nouveau_context.h" - -#define NOUVEAU_PUSH_CONTEXT(ctx) \ - struct nv40_screen *ctx = nv40->screen -#include "nouveau/nouveau_push.h" #include "nouveau/nouveau_stateobj.h" #include "nv40_state.h" @@ -183,7 +179,7 @@ extern void nv40_screen_init_miptree_functions(struct pipe_screen *pscreen); /* nv40_draw.c */ extern struct draw_stage *nv40_draw_render_stage(struct nv40_context *nv40); -extern boolean nv40_draw_elements_swtnl(struct pipe_context *pipe, +extern void nv40_draw_elements_swtnl(struct pipe_context *pipe, struct pipe_buffer *idxbuf, unsigned ib_size, unsigned mode, unsigned start, unsigned count); @@ -219,9 +215,9 @@ extern struct nv40_state_entry nv40_state_vbo; extern struct nv40_state_entry nv40_state_vtxfmt; /* nv40_vbo.c */ -extern boolean nv40_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv40_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv40_draw_elements(struct pipe_context *pipe, +extern void nv40_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, diff --git a/src/gallium/drivers/nv40/nv40_draw.c b/src/gallium/drivers/nv40/nv40_draw.c index 3875bc3545..d826f8c2f5 100644 --- a/src/gallium/drivers/nv40/nv40_draw.c +++ b/src/gallium/drivers/nv40/nv40_draw.c @@ -31,6 +31,9 @@ nv40_render_stage(struct draw_stage *stage) static INLINE void nv40_render_vertex(struct nv40_context *nv40, const struct vertex_header *v) { + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; unsigned i; for (i = 0; i < nv40->swtnl.nr_attribs; i++) { @@ -41,30 +44,30 @@ nv40_render_vertex(struct nv40_context *nv40, const struct vertex_header *v) case EMIT_OMIT: break; case EMIT_1F: - BEGIN_RING(curie, NV40TCL_VTX_ATTR_1F(hw), 1); - OUT_RING (fui(v->data[idx][0])); + BEGIN_RING(chan, curie, NV40TCL_VTX_ATTR_1F(hw), 1); + OUT_RING (chan, fui(v->data[idx][0])); break; case EMIT_2F: - BEGIN_RING(curie, NV40TCL_VTX_ATTR_2F_X(hw), 2); - OUT_RING (fui(v->data[idx][0])); - OUT_RING (fui(v->data[idx][1])); + BEGIN_RING(chan, curie, NV40TCL_VTX_ATTR_2F_X(hw), 2); + OUT_RING (chan, fui(v->data[idx][0])); + OUT_RING (chan, fui(v->data[idx][1])); break; case EMIT_3F: - BEGIN_RING(curie, NV40TCL_VTX_ATTR_3F_X(hw), 3); - OUT_RING (fui(v->data[idx][0])); - OUT_RING (fui(v->data[idx][1])); - OUT_RING (fui(v->data[idx][2])); + BEGIN_RING(chan, curie, NV40TCL_VTX_ATTR_3F_X(hw), 3); + OUT_RING (chan, fui(v->data[idx][0])); + OUT_RING (chan, fui(v->data[idx][1])); + OUT_RING (chan, fui(v->data[idx][2])); break; case EMIT_4F: - BEGIN_RING(curie, NV40TCL_VTX_ATTR_4F_X(hw), 4); - OUT_RING (fui(v->data[idx][0])); - OUT_RING (fui(v->data[idx][1])); - OUT_RING (fui(v->data[idx][2])); - OUT_RING (fui(v->data[idx][3])); + BEGIN_RING(chan, curie, NV40TCL_VTX_ATTR_4F_X(hw), 4); + OUT_RING (chan, fui(v->data[idx][0])); + OUT_RING (chan, fui(v->data[idx][1])); + OUT_RING (chan, fui(v->data[idx][2])); + OUT_RING (chan, fui(v->data[idx][3])); break; case EMIT_4UB: - BEGIN_RING(curie, NV40TCL_VTX_ATTR_4UB(hw), 1); - OUT_RING (pack_ub4(float_to_ubyte(v->data[idx][0]), + BEGIN_RING(chan, curie, NV40TCL_VTX_ATTR_4UB(hw), 1); + OUT_RING (chan, pack_ub4(float_to_ubyte(v->data[idx][0]), float_to_ubyte(v->data[idx][1]), float_to_ubyte(v->data[idx][2]), float_to_ubyte(v->data[idx][3]))); @@ -82,7 +85,11 @@ nv40_render_prim(struct draw_stage *stage, struct prim_header *prim, { struct nv40_render_stage *rs = nv40_render_stage(stage); struct nv40_context *nv40 = rs->nv40; - struct nouveau_pushbuf *pb = nv40->screen->base.channel->pushbuf; + + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_pushbuf *pb = chan->pushbuf; + struct nouveau_grobj *curie = screen->curie; unsigned i; /* Ensure there's room for 4xfloat32 + potentially 3 begin/end */ @@ -91,19 +98,19 @@ nv40_render_prim(struct draw_stage *stage, struct prim_header *prim, NOUVEAU_ERR("AIII, missed flush\n"); assert(0); } - FIRE_RING(NULL); + FIRE_RING(chan); nv40_state_emit(nv40); } /* Switch primitive modes if necessary */ if (rs->prim != mode) { if (rs->prim != NV40TCL_BEGIN_END_STOP) { - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (NV40TCL_BEGIN_END_STOP); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, NV40TCL_BEGIN_END_STOP); } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (mode); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, mode); rs->prim = mode; } @@ -115,8 +122,8 @@ nv40_render_prim(struct draw_stage *stage, struct prim_header *prim, * off the primitive now. */ if (pb->remaining < ((count * 20) + 6)) { - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (NV40TCL_BEGIN_END_STOP); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, NV40TCL_BEGIN_END_STOP); rs->prim = NV40TCL_BEGIN_END_STOP; } } @@ -144,10 +151,13 @@ nv40_render_flush(struct draw_stage *draw, unsigned flags) { struct nv40_render_stage *rs = nv40_render_stage(draw); struct nv40_context *nv40 = rs->nv40; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; if (rs->prim != NV40TCL_BEGIN_END_STOP) { - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (NV40TCL_BEGIN_END_STOP); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, NV40TCL_BEGIN_END_STOP); rs->prim = NV40TCL_BEGIN_END_STOP; } } @@ -226,7 +236,7 @@ nv40_draw_render_stage(struct nv40_context *nv40) return &render->stage; } -boolean +void nv40_draw_elements_swtnl(struct pipe_context *pipe, struct pipe_buffer *idxbuf, unsigned idxbuf_size, unsigned mode, unsigned start, unsigned count) @@ -237,7 +247,7 @@ nv40_draw_elements_swtnl(struct pipe_context *pipe, void *map; if (!nv40_state_validate_swtnl(nv40)) - return FALSE; + return; nv40->state.dirty &= ~(1ULL << NV40_STATE_VTXBUF); nv40_state_emit(nv40); @@ -278,8 +288,6 @@ nv40_draw_elements_swtnl(struct pipe_context *pipe, draw_flush(nv40->draw); pipe->flush(pipe, 0, NULL); - - return TRUE; } static INLINE void diff --git a/src/gallium/drivers/nv40/nv40_fragprog.c b/src/gallium/drivers/nv40/nv40_fragprog.c index bb9c85cc43..1237066c39 100644 --- a/src/gallium/drivers/nv40/nv40_fragprog.c +++ b/src/gallium/drivers/nv40/nv40_fragprog.c @@ -919,7 +919,7 @@ nv40_fragprog_validate(struct nv40_context *nv40) fp->buffer = pscreen->buffer_create(pscreen, 0x100, 0, fp->insn_len * 4); nv40_fragprog_upload(nv40, fp); - so = so_new(4, 1); + so = so_new(2, 2, 1); so_method(so, nv40->screen->curie, NV40TCL_FP_ADDRESS, 1); so_reloc (so, nouveau_bo(fp->buffer), 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD | NOUVEAU_BO_LOW | diff --git a/src/gallium/drivers/nv40/nv40_fragtex.c b/src/gallium/drivers/nv40/nv40_fragtex.c index 44abc84596..aad9198210 100644 --- a/src/gallium/drivers/nv40/nv40_fragtex.c +++ b/src/gallium/drivers/nv40/nv40_fragtex.c @@ -108,7 +108,7 @@ nv40_fragtex_build(struct nv40_context *nv40, int unit) txs = tf->swizzle; - so = so_new(16, 2); + so = so_new(2, 9, 2); so_method(so, nv40->screen->curie, NV40TCL_TEX_OFFSET(unit), 8); so_reloc (so, bo, 0, tex_flags | NOUVEAU_BO_LOW, 0, 0); so_reloc (so, bo, txf, tex_flags | NOUVEAU_BO_OR, @@ -139,7 +139,7 @@ nv40_fragtex_validate(struct nv40_context *nv40) unit = ffs(samplers) - 1; samplers &= ~(1 << unit); - so = so_new(2, 0); + so = so_new(1, 1, 0); so_method(so, nv40->screen->curie, NV40TCL_TEX_ENABLE(unit), 1); so_data (so, 0); so_ref(so, &nv40->state.hw[NV40_STATE_FRAGTEX0 + unit]); diff --git a/src/gallium/drivers/nv40/nv40_query.c b/src/gallium/drivers/nv40/nv40_query.c index 7874aedd42..8ed4a67dd0 100644 --- a/src/gallium/drivers/nv40/nv40_query.c +++ b/src/gallium/drivers/nv40/nv40_query.c @@ -41,6 +41,9 @@ nv40_query_begin(struct pipe_context *pipe, struct pipe_query *pq) { struct nv40_context *nv40 = nv40_context(pipe); struct nv40_query *q = nv40_query(pq); + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; assert(q->type == PIPE_QUERY_OCCLUSION_COUNTER); @@ -57,10 +60,10 @@ nv40_query_begin(struct pipe_context *pipe, struct pipe_query *pq) assert(0); nouveau_notifier_reset(nv40->screen->query, q->object->start); - BEGIN_RING(curie, NV40TCL_QUERY_RESET, 1); - OUT_RING (1); - BEGIN_RING(curie, NV40TCL_QUERY_UNK17CC, 1); - OUT_RING (1); + BEGIN_RING(chan, curie, NV40TCL_QUERY_RESET, 1); + OUT_RING (chan, 1); + BEGIN_RING(chan, curie, NV40TCL_QUERY_UNK17CC, 1); + OUT_RING (chan, 1); q->ready = FALSE; } @@ -70,11 +73,14 @@ nv40_query_end(struct pipe_context *pipe, struct pipe_query *pq) { struct nv40_context *nv40 = nv40_context(pipe); struct nv40_query *q = nv40_query(pq); + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; - BEGIN_RING(curie, NV40TCL_QUERY_GET, 1); - OUT_RING ((0x01 << NV40TCL_QUERY_GET_UNK24_SHIFT) | + BEGIN_RING(chan, curie, NV40TCL_QUERY_GET, 1); + OUT_RING (chan, (0x01 << NV40TCL_QUERY_GET_UNK24_SHIFT) | ((q->object->start * 32) << NV40TCL_QUERY_GET_OFFSET_SHIFT)); - FIRE_RING(NULL); + FIRE_RING(chan); } static boolean diff --git a/src/gallium/drivers/nv40/nv40_screen.c b/src/gallium/drivers/nv40/nv40_screen.c index d01e712805..9e55e5a089 100644 --- a/src/gallium/drivers/nv40/nv40_screen.c +++ b/src/gallium/drivers/nv40/nv40_screen.c @@ -215,7 +215,6 @@ nv40_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) NOUVEAU_ERR("Error creating 3D object: %d\n", ret); return FALSE; } - BIND_RING(chan, screen->curie, 7); /* 2D engine setup */ screen->eng2d = nv04_surface_2d_init(&screen->base); @@ -252,7 +251,7 @@ nv40_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) } /* Static curie initialisation */ - so = so_new(128, 0); + so = so_new(16, 25, 0); so_method(so, screen->curie, NV40TCL_DMA_NOTIFY, 1); so_data (so, screen->sync->handle); so_method(so, screen->curie, NV40TCL_DMA_TEXTURE0, 2); diff --git a/src/gallium/drivers/nv40/nv40_state.c b/src/gallium/drivers/nv40/nv40_state.c index ed55d29aff..ed0ca9e02c 100644 --- a/src/gallium/drivers/nv40/nv40_state.c +++ b/src/gallium/drivers/nv40/nv40_state.c @@ -16,7 +16,7 @@ nv40_blend_state_create(struct pipe_context *pipe, struct nv40_context *nv40 = nv40_context(pipe); struct nouveau_grobj *curie = nv40->screen->curie; struct nv40_blend_state *bso = CALLOC(1, sizeof(*bso)); - struct nouveau_stateobj *so = so_new(16, 0); + struct nouveau_stateobj *so = so_new(5, 8, 0); if (cso->blend_enable) { so_method(so, curie, NV40TCL_BLEND_ENABLE, 3); @@ -310,7 +310,7 @@ nv40_rasterizer_state_create(struct pipe_context *pipe, { struct nv40_context *nv40 = nv40_context(pipe); struct nv40_rasterizer_state *rsso = CALLOC(1, sizeof(*rsso)); - struct nouveau_stateobj *so = so_new(32, 0); + struct nouveau_stateobj *so = so_new(8, 18, 0); struct nouveau_grobj *curie = nv40->screen->curie; /*XXX: ignored: @@ -445,7 +445,7 @@ nv40_depth_stencil_alpha_state_create(struct pipe_context *pipe, { struct nv40_context *nv40 = nv40_context(pipe); struct nv40_zsa_state *zsaso = CALLOC(1, sizeof(*zsaso)); - struct nouveau_stateobj *so = so_new(32, 0); + struct nouveau_stateobj *so = so_new(4, 21, 0); struct nouveau_grobj *curie = nv40->screen->curie; so_method(so, curie, NV40TCL_DEPTH_FUNC, 3); diff --git a/src/gallium/drivers/nv40/nv40_state_blend.c b/src/gallium/drivers/nv40/nv40_state_blend.c index 8cd05ce66e..3ff00a37f6 100644 --- a/src/gallium/drivers/nv40/nv40_state_blend.c +++ b/src/gallium/drivers/nv40/nv40_state_blend.c @@ -18,7 +18,7 @@ struct nv40_state_entry nv40_state_blend = { static boolean nv40_state_blend_colour_validate(struct nv40_context *nv40) { - struct nouveau_stateobj *so = so_new(2, 0); + struct nouveau_stateobj *so = so_new(1, 1, 0); struct pipe_blend_color *bcol = &nv40->blend_colour; so_method(so, nv40->screen->curie, NV40TCL_BLEND_COLOR, 1); diff --git a/src/gallium/drivers/nv40/nv40_state_emit.c b/src/gallium/drivers/nv40/nv40_state_emit.c index 789ed16126..13fe854915 100644 --- a/src/gallium/drivers/nv40/nv40_state_emit.c +++ b/src/gallium/drivers/nv40/nv40_state_emit.c @@ -54,9 +54,10 @@ nv40_state_do_validate(struct nv40_context *nv40, void nv40_state_emit(struct nv40_context *nv40) { - struct nouveau_channel *chan = nv40->screen->base.channel; struct nv40_state *state = &nv40->state; struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; unsigned i; uint64_t states; @@ -80,10 +81,10 @@ nv40_state_emit(struct nv40_context *nv40) if (state->dirty & ((1ULL << NV40_STATE_FRAGPROG) | (1ULL << NV40_STATE_FRAGTEX0))) { - BEGIN_RING(curie, NV40TCL_TEX_CACHE_CTL, 1); - OUT_RING (2); - BEGIN_RING(curie, NV40TCL_TEX_CACHE_CTL, 1); - OUT_RING (1); + BEGIN_RING(chan, curie, NV40TCL_TEX_CACHE_CTL, 1); + OUT_RING (chan, 2); + BEGIN_RING(chan, curie, NV40TCL_TEX_CACHE_CTL, 1); + OUT_RING (chan, 1); } state->dirty = 0; diff --git a/src/gallium/drivers/nv40/nv40_state_fb.c b/src/gallium/drivers/nv40/nv40_state_fb.c index 1c7a7cd64f..a58fe9ddb1 100644 --- a/src/gallium/drivers/nv40/nv40_state_fb.c +++ b/src/gallium/drivers/nv40/nv40_state_fb.c @@ -19,7 +19,7 @@ nv40_state_framebuffer_validate(struct nv40_context *nv40) struct nv04_surface *rt[4], *zeta; uint32_t rt_enable, rt_format; int i, colour_format = 0, zeta_format = 0; - struct nouveau_stateobj *so = so_new(64, 10); + struct nouveau_stateobj *so = so_new(18, 24, 10); unsigned rt_flags = NOUVEAU_BO_RDWR | NOUVEAU_BO_VRAM; unsigned w = fb->width; unsigned h = fb->height; diff --git a/src/gallium/drivers/nv40/nv40_state_scissor.c b/src/gallium/drivers/nv40/nv40_state_scissor.c index cf58d33906..753a505e93 100644 --- a/src/gallium/drivers/nv40/nv40_state_scissor.c +++ b/src/gallium/drivers/nv40/nv40_state_scissor.c @@ -12,7 +12,7 @@ nv40_state_scissor_validate(struct nv40_context *nv40) return FALSE; nv40->state.scissor_enabled = rast->scissor; - so = so_new(3, 0); + so = so_new(1, 2, 0); so_method(so, nv40->screen->curie, NV40TCL_SCISSOR_HORIZ, 2); if (nv40->state.scissor_enabled) { so_data (so, ((s->maxx - s->minx) << 16) | s->minx); diff --git a/src/gallium/drivers/nv40/nv40_state_stipple.c b/src/gallium/drivers/nv40/nv40_state_stipple.c index b51024ad9b..2b371ebfec 100644 --- a/src/gallium/drivers/nv40/nv40_state_stipple.c +++ b/src/gallium/drivers/nv40/nv40_state_stipple.c @@ -14,14 +14,14 @@ nv40_state_stipple_validate(struct nv40_context *nv40) if (rast->poly_stipple_enable) { unsigned i; - so = so_new(35, 0); + so = so_new(2, 33, 0); so_method(so, curie, NV40TCL_POLYGON_STIPPLE_ENABLE, 1); so_data (so, 1); so_method(so, curie, NV40TCL_POLYGON_STIPPLE_PATTERN(0), 32); for (i = 0; i < 32; i++) so_data(so, nv40->stipple[i]); } else { - so = so_new(2, 0); + so = so_new(1, 1, 0); so_method(so, curie, NV40TCL_POLYGON_STIPPLE_ENABLE, 1); so_data (so, 0); } diff --git a/src/gallium/drivers/nv40/nv40_state_viewport.c b/src/gallium/drivers/nv40/nv40_state_viewport.c index 665d2d5fca..9919ba1d0b 100644 --- a/src/gallium/drivers/nv40/nv40_state_viewport.c +++ b/src/gallium/drivers/nv40/nv40_state_viewport.c @@ -19,7 +19,7 @@ nv40_state_viewport_validate(struct nv40_context *nv40) return FALSE; nv40->state.viewport_bypass = bypass; - so = so_new(11, 0); + so = so_new(2, 9, 0); if (!bypass) { so_method(so, nv40->screen->curie, NV40TCL_VIEWPORT_TRANSLATE_X, 8); diff --git a/src/gallium/drivers/nv40/nv40_vbo.c b/src/gallium/drivers/nv40/nv40_vbo.c index af3fcf6a34..a777898f68 100644 --- a/src/gallium/drivers/nv40/nv40_vbo.c +++ b/src/gallium/drivers/nv40/nv40_vbo.c @@ -164,18 +164,21 @@ nv40_vbo_static_attrib(struct nv40_context *nv40, struct nouveau_stateobj *so, return TRUE; } -boolean +void nv40_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { struct nv40_context *nv40 = nv40_context(pipe); - struct nouveau_channel *chan = nv40->screen->base.channel; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; unsigned restart; nv40_vbo_set_idxbuf(nv40, NULL, 0); if (FORCE_SWTNL || !nv40_state_validate(nv40)) { - return nv40_draw_elements_swtnl(pipe, NULL, 0, - mode, start, count); + nv40_draw_elements_swtnl(pipe, NULL, 0, + mode, start, count); + return; } while (count) { @@ -186,17 +189,17 @@ nv40_draw_arrays(struct pipe_context *pipe, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 256, mode, start, count, &restart); if (!vc) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); nr = (vc & 0xff); if (nr) { - BEGIN_RING(curie, NV40TCL_VB_VERTEX_BATCH, 1); - OUT_RING (((nr - 1) << 24) | start); + BEGIN_RING(chan, curie, NV40TCL_VB_VERTEX_BATCH, 1); + OUT_RING (chan, ((nr - 1) << 24) | start); start += nr; } @@ -206,29 +209,30 @@ nv40_draw_arrays(struct pipe_context *pipe, nr -= push; - BEGIN_RING_NI(curie, NV40TCL_VB_VERTEX_BATCH, push); + BEGIN_RING_NI(chan, curie, NV40TCL_VB_VERTEX_BATCH, push); while (push--) { - OUT_RING(((0x100 - 1) << 24) | start); + OUT_RING(chan, ((0x100 - 1) << 24) | start); start += 0x100; } } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, 0); count -= vc; start = restart; } pipe->flush(pipe, 0, NULL); - return TRUE; } static INLINE void nv40_draw_elements_u08(struct nv40_context *nv40, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv40->screen->base.channel; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; while (count) { uint8_t *elts = (uint8_t *)ib + start; @@ -239,17 +243,17 @@ nv40_draw_elements_u08(struct nv40_context *nv40, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 2, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); if (vc & 1) { - BEGIN_RING(curie, NV40TCL_VB_ELEMENT_U32, 1); - OUT_RING (elts[0]); + BEGIN_RING(chan, curie, NV40TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, elts[0]); elts++; vc--; } @@ -258,16 +262,16 @@ nv40_draw_elements_u08(struct nv40_context *nv40, void *ib, push = MIN2(vc, 2047 * 2); - BEGIN_RING_NI(curie, NV40TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, curie, NV40TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((elts[i+1] << 16) | elts[i]); + OUT_RING(chan, (elts[i+1] << 16) | elts[i]); vc -= push; elts += push; } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } @@ -277,7 +281,9 @@ static INLINE void nv40_draw_elements_u16(struct nv40_context *nv40, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv40->screen->base.channel; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; while (count) { uint16_t *elts = (uint16_t *)ib + start; @@ -288,17 +294,17 @@ nv40_draw_elements_u16(struct nv40_context *nv40, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 2, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); if (vc & 1) { - BEGIN_RING(curie, NV40TCL_VB_ELEMENT_U32, 1); - OUT_RING (elts[0]); + BEGIN_RING(chan, curie, NV40TCL_VB_ELEMENT_U32, 1); + OUT_RING (chan, elts[0]); elts++; vc--; } @@ -307,16 +313,16 @@ nv40_draw_elements_u16(struct nv40_context *nv40, void *ib, push = MIN2(vc, 2047 * 2); - BEGIN_RING_NI(curie, NV40TCL_VB_ELEMENT_U16, push >> 1); + BEGIN_RING_NI(chan, curie, NV40TCL_VB_ELEMENT_U16, push >> 1); for (i = 0; i < push; i+=2) - OUT_RING((elts[i+1] << 16) | elts[i]); + OUT_RING(chan, (elts[i+1] << 16) | elts[i]); vc -= push; elts += push; } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } @@ -326,7 +332,9 @@ static INLINE void nv40_draw_elements_u32(struct nv40_context *nv40, void *ib, unsigned mode, unsigned start, unsigned count) { - struct nouveau_channel *chan = nv40->screen->base.channel; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; while (count) { uint32_t *elts = (uint32_t *)ib + start; @@ -337,32 +345,32 @@ nv40_draw_elements_u32(struct nv40_context *nv40, void *ib, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 5, 1, mode, start, count, &restart); if (vc == 0) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } count -= vc; - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); while (vc) { push = MIN2(vc, 2047); - BEGIN_RING_NI(curie, NV40TCL_VB_ELEMENT_U32, push); - OUT_RINGp (elts, push); + BEGIN_RING_NI(chan, curie, NV40TCL_VB_ELEMENT_U32, push); + OUT_RINGp (chan, elts, push); vc -= push; elts += push; } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, 0); start = restart; } } -static boolean +static void nv40_draw_elements_inline(struct pipe_context *pipe, struct pipe_buffer *ib, unsigned ib_size, unsigned mode, unsigned start, unsigned count) @@ -393,15 +401,16 @@ nv40_draw_elements_inline(struct pipe_context *pipe, } pipe_buffer_unmap(pscreen, ib); - return TRUE; } -static boolean +static void nv40_draw_elements_vbo(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { struct nv40_context *nv40 = nv40_context(pipe); - struct nouveau_channel *chan = nv40->screen->base.channel; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; unsigned restart; while (count) { @@ -412,17 +421,17 @@ nv40_draw_elements_vbo(struct pipe_context *pipe, vc = nouveau_vbuf_split(chan->pushbuf->remaining, 6, 256, mode, start, count, &restart); if (!vc) { - FIRE_RING(NULL); + FIRE_RING(chan); continue; } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (nvgl_primitive(mode)); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, nvgl_primitive(mode)); nr = (vc & 0xff); if (nr) { - BEGIN_RING(curie, NV40TCL_VB_INDEX_BATCH, 1); - OUT_RING (((nr - 1) << 24) | start); + BEGIN_RING(chan, curie, NV40TCL_VB_INDEX_BATCH, 1); + OUT_RING (chan, ((nr - 1) << 24) | start); start += nr; } @@ -432,24 +441,22 @@ nv40_draw_elements_vbo(struct pipe_context *pipe, nr -= push; - BEGIN_RING_NI(curie, NV40TCL_VB_INDEX_BATCH, push); + BEGIN_RING_NI(chan, curie, NV40TCL_VB_INDEX_BATCH, push); while (push--) { - OUT_RING(((0x100 - 1) << 24) | start); + OUT_RING(chan, ((0x100 - 1) << 24) | start); start += 0x100; } } - BEGIN_RING(curie, NV40TCL_BEGIN_END, 1); - OUT_RING (0); + BEGIN_RING(chan, curie, NV40TCL_BEGIN_END, 1); + OUT_RING (chan, 0); count -= vc; start = restart; } - - return TRUE; } -boolean +void nv40_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) @@ -459,8 +466,9 @@ nv40_draw_elements(struct pipe_context *pipe, idxbuf = nv40_vbo_set_idxbuf(nv40, indexBuffer, indexSize); if (FORCE_SWTNL || !nv40_state_validate(nv40)) { - return nv40_draw_elements_swtnl(pipe, NULL, 0, - mode, start, count); + nv40_draw_elements_swtnl(pipe, NULL, 0, + mode, start, count); + return; } if (idxbuf) { @@ -471,7 +479,6 @@ nv40_draw_elements(struct pipe_context *pipe, } pipe->flush(pipe, 0, NULL); - return TRUE; } static boolean @@ -484,9 +491,9 @@ nv40_vbo_validate(struct nv40_context *nv40) unsigned vb_flags = NOUVEAU_BO_VRAM | NOUVEAU_BO_GART | NOUVEAU_BO_RD; int hw; - vtxbuf = so_new(20, 18); + vtxbuf = so_new(3, 17, 18); so_method(vtxbuf, curie, NV40TCL_VTXBUF_ADDRESS(0), nv40->vtxelt_nr); - vtxfmt = so_new(17, 0); + vtxfmt = so_new(1, 16, 0); so_method(vtxfmt, curie, NV40TCL_VTXFMT(0), nv40->vtxelt_nr); for (hw = 0; hw < nv40->vtxelt_nr; hw++) { @@ -499,7 +506,7 @@ nv40_vbo_validate(struct nv40_context *nv40) if (!vb->stride) { if (!sattr) - sattr = so_new(16 * 5, 0); + sattr = so_new(16, 16 * 4, 0); if (nv40_vbo_static_attrib(nv40, sattr, hw, ve, vb)) { so_data(vtxbuf, 0); diff --git a/src/gallium/drivers/nv40/nv40_vertprog.c b/src/gallium/drivers/nv40/nv40_vertprog.c index d9fc31006f..8d80fcad38 100644 --- a/src/gallium/drivers/nv40/nv40_vertprog.c +++ b/src/gallium/drivers/nv40/nv40_vertprog.c @@ -834,7 +834,9 @@ static boolean nv40_vertprog_validate(struct nv40_context *nv40) { struct pipe_screen *pscreen = nv40->pipe.screen; - struct nouveau_grobj *curie = nv40->screen->curie; + struct nv40_screen *screen = nv40->screen; + struct nouveau_channel *chan = screen->base.channel; + struct nouveau_grobj *curie = screen->curie; struct nv40_vertex_program *vp; struct pipe_buffer *constbuf; boolean upload_code = FALSE, upload_data = FALSE; @@ -884,7 +886,7 @@ check_gpu_resources: assert(0); } - so = so_new(7, 0); + so = so_new(3, 4, 0); so_method(so, curie, NV40TCL_VP_START_FROM_ID, 1); so_data (so, vp->exec->start); so_method(so, curie, NV40TCL_VP_ATTRIB_EN, 2); @@ -974,9 +976,9 @@ check_gpu_resources: 4 * sizeof(float)); } - BEGIN_RING(curie, NV40TCL_VP_UPLOAD_CONST_ID, 5); - OUT_RING (i + vp->data->start); - OUT_RINGp ((uint32_t *)vpd->value, 4); + BEGIN_RING(chan, curie, NV40TCL_VP_UPLOAD_CONST_ID, 5); + OUT_RING (chan, i + vp->data->start); + OUT_RINGp (chan, (uint32_t *)vpd->value, 4); } if (constbuf) @@ -993,11 +995,11 @@ check_gpu_resources: NOUVEAU_MSG("VP %d: 0x%08x\n", i, vp->insns[i].data[3]); } #endif - BEGIN_RING(curie, NV40TCL_VP_UPLOAD_FROM_ID, 1); - OUT_RING (vp->exec->start); + BEGIN_RING(chan, curie, NV40TCL_VP_UPLOAD_FROM_ID, 1); + OUT_RING (chan, vp->exec->start); for (i = 0; i < vp->nr_insns; i++) { - BEGIN_RING(curie, NV40TCL_VP_UPLOAD_INST(0), 4); - OUT_RINGp (vp->insns[i].data, 4); + BEGIN_RING(chan, curie, NV40TCL_VP_UPLOAD_INST(0), 4); + OUT_RINGp (chan, vp->insns[i].data, 4); } } diff --git a/src/gallium/drivers/nv50/nv50_context.h b/src/gallium/drivers/nv50/nv50_context.h index 5578a5838f..cbd4c3ff86 100644 --- a/src/gallium/drivers/nv50/nv50_context.h +++ b/src/gallium/drivers/nv50/nv50_context.h @@ -191,9 +191,9 @@ nv50_surface_do_copy(struct nv50_screen *screen, struct pipe_surface *dst, extern struct draw_stage *nv50_draw_render_stage(struct nv50_context *nv50); /* nv50_vbo.c */ -extern boolean nv50_draw_arrays(struct pipe_context *, unsigned mode, +extern void nv50_draw_arrays(struct pipe_context *, unsigned mode, unsigned start, unsigned count); -extern boolean nv50_draw_elements(struct pipe_context *pipe, +extern void nv50_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, diff --git a/src/gallium/drivers/nv50/nv50_program.c b/src/gallium/drivers/nv50/nv50_program.c index 2d0b1818ef..e16fa479e5 100644 --- a/src/gallium/drivers/nv50/nv50_program.c +++ b/src/gallium/drivers/nv50/nv50_program.c @@ -96,7 +96,11 @@ struct nv50_reg { #define NV50_MOD_NEG 1 #define NV50_MOD_ABS 2 +#define NV50_MOD_NEG_ABS (NV50_MOD_NEG | NV50_MOD_ABS) #define NV50_MOD_SAT 4 +#define NV50_MOD_I32 8 + +/* NV50_MOD_I32 is used to indicate integer mode for neg/abs */ /* STACK: Conditionals and loops have to use the (per warp) stack. * Stack entries consist of an entry type (divergent path, join at), @@ -134,6 +138,7 @@ struct nv50_pc { uint8_t addr_alloc; /* set bit indicates used for TGSI_FILE_ADDRESS */ struct nv50_reg *temp_temp[16]; + struct nv50_program_exec *temp_temp_exec[16]; unsigned temp_temp_nr; /* broadcast and destination replacement regs */ @@ -241,7 +246,8 @@ alloc_reg(struct nv50_pc *pc, struct nv50_reg *reg) } } - assert(0); + NOUVEAU_ERR("out of registers\n"); + abort(); } static INLINE struct nv50_reg * @@ -281,7 +287,8 @@ alloc_temp(struct nv50_pc *pc, struct nv50_reg *dst) } } - assert(0); + NOUVEAU_ERR("out of registers\n"); + abort(); return NULL; } @@ -343,23 +350,29 @@ free_temp4(struct nv50_pc *pc, struct nv50_reg *reg[4]) } static struct nv50_reg * -temp_temp(struct nv50_pc *pc) +temp_temp(struct nv50_pc *pc, struct nv50_program_exec *e) { if (pc->temp_temp_nr >= 16) assert(0); pc->temp_temp[pc->temp_temp_nr] = alloc_temp(pc, NULL); + pc->temp_temp_exec[pc->temp_temp_nr] = e; return pc->temp_temp[pc->temp_temp_nr++]; } +/* This *must* be called for all nv50_program_exec that have been + * given as argument to temp_temp, or the temps will be leaked ! + */ static void -kill_temp_temp(struct nv50_pc *pc) +kill_temp_temp(struct nv50_pc *pc, struct nv50_program_exec *e) { int i; for (i = 0; i < pc->temp_temp_nr; i++) - free_temp(pc, pc->temp_temp[i]); - pc->temp_temp_nr = 0; + if (pc->temp_temp_exec[i] == e) + free_temp(pc, pc->temp_temp[i]); + if (!e) + pc->temp_temp_nr = 0; } static int @@ -421,6 +434,8 @@ emit(struct nv50_pc *pc, struct nv50_program_exec *e) p->exec_head = e; p->exec_tail = e; p->exec_size += (e->inst[0] & 1) ? 2 : 1; + + kill_temp_temp(pc, e); } static INLINE void set_long(struct nv50_pc *, struct nv50_program_exec *); @@ -776,7 +791,7 @@ set_src_0_restricted(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_reg *temp; if (src->type != P_TEMP) { - temp = temp_temp(pc); + temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; } @@ -795,7 +810,7 @@ set_src_0(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) e->inst[1] |= 0x00200000; } else if (src->type == P_CONST || src->type == P_IMMD) { - struct nv50_reg *temp = temp_temp(pc); + struct nv50_reg *temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; @@ -811,7 +826,7 @@ static void set_src_1(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) { if (src->type == P_ATTR) { - struct nv50_reg *temp = temp_temp(pc); + struct nv50_reg *temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; @@ -819,7 +834,7 @@ set_src_1(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) if (src->type == P_CONST || src->type == P_IMMD) { assert(!(e->inst[0] & 0x00800000)); if (e->inst[0] & 0x01000000) { - struct nv50_reg *temp = temp_temp(pc); + struct nv50_reg *temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; @@ -841,7 +856,7 @@ set_src_2(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) set_long(pc, e); if (src->type == P_ATTR) { - struct nv50_reg *temp = temp_temp(pc); + struct nv50_reg *temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; @@ -849,7 +864,7 @@ set_src_2(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) if (src->type == P_CONST || src->type == P_IMMD) { assert(!(e->inst[0] & 0x01000000)); if (e->inst[0] & 0x00800000) { - struct nv50_reg *temp = temp_temp(pc); + struct nv50_reg *temp = temp_temp(pc, e); emit_mov(pc, temp, src); src = temp; @@ -864,6 +879,26 @@ set_src_2(struct nv50_pc *pc, struct nv50_reg *src, struct nv50_program_exec *e) } static void +set_half_src(struct nv50_pc *pc, struct nv50_reg *src, int lh, + struct nv50_program_exec *e, int pos) +{ + struct nv50_reg *r = src; + + alloc_reg(pc, r); + if (r->type != P_TEMP) { + r = temp_temp(pc, e); + emit_mov(pc, r, src); + } + + if (r->hw > (NV50_SU_MAX_TEMP / 2)) { + NOUVEAU_ERR("out of low GPRs\n"); + abort(); + } + + e->inst[pos / 32] |= ((src->hw * 2) + lh) << (pos % 32); +} + +static void emit_mov_from_pred(struct nv50_pc *pc, struct nv50_reg *dst, int pred) { struct nv50_program_exec *e = exec(pc); @@ -967,6 +1002,13 @@ emit_arl(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src, emit(pc, e); } +#define NV50_MAX_F32 0x880 +#define NV50_MAX_S32 0x08c +#define NV50_MAX_U32 0x084 +#define NV50_MIN_F32 0x8a0 +#define NV50_MIN_S32 0x0ac +#define NV50_MIN_U32 0x0a4 + static void emit_minmax(struct nv50_pc *pc, unsigned sub, struct nv50_reg *dst, struct nv50_reg *src0, struct nv50_reg *src1) @@ -974,8 +1016,8 @@ emit_minmax(struct nv50_pc *pc, unsigned sub, struct nv50_reg *dst, struct nv50_program_exec *e = exec(pc); set_long(pc, e); - e->inst[0] |= 0xb0000000; - e->inst[1] |= (sub << 29); + e->inst[0] |= 0x30000000 | ((sub & 0x800) << 20); + e->inst[1] |= (sub << 24); check_swap_src_0_1(pc, &src0, &src1); set_dst(pc, dst, e); @@ -1039,6 +1081,69 @@ emit_bitop2(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src0, } static void +emit_not(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0xd0000000; + e->inst[1] = 0x0402c000; + set_long(pc, e); + set_dst(pc, dst, e); + set_src_1(pc, src, e); + + emit(pc, e); +} + +static void +emit_shift(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src0, struct nv50_reg *src1, unsigned dir) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0x30000000; + e->inst[1] = 0xc4000000; + + set_long(pc, e); + set_dst(pc, dst, e); + set_src_0(pc, src0, e); + + if (src1->type == P_IMMD) { + e->inst[1] |= (1 << 20); + e->inst[0] |= (pc->immd_buf[src1->hw] & 0x7f) << 16; + } else + set_src_1(pc, src1, e); + + if (dir != TGSI_OPCODE_SHL) + e->inst[1] |= (1 << 29); + + if (dir == TGSI_OPCODE_ISHR) + e->inst[1] |= (1 << 27); + + emit(pc, e); +} + +static void +emit_shl_imm(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src, int s) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0x30000000; + e->inst[1] = 0xc4100000; + if (s < 0) { + e->inst[1] |= 1 << 29; + s = -s; + } + e->inst[1] |= ((s & 0x7f) << 16); + + set_long(pc, e); + set_dst(pc, dst, e); + set_src_0(pc, src, e); + + emit(pc, e); +} + +static void emit_mad(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src0, struct nv50_reg *src1, struct nv50_reg *src2) { @@ -1142,36 +1247,41 @@ emit_precossin(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) emit(pc, e); } -#define CVTOP_RN 0x01 -#define CVTOP_FLOOR 0x03 -#define CVTOP_CEIL 0x05 -#define CVTOP_TRUNC 0x07 -#define CVTOP_SAT 0x08 -#define CVTOP_ABS 0x10 +#define CVT_RN (0x00 << 16) +#define CVT_FLOOR (0x02 << 16) +#define CVT_CEIL (0x04 << 16) +#define CVT_TRUNC (0x06 << 16) +#define CVT_SAT (0x08 << 16) +#define CVT_ABS (0x10 << 16) -/* 0x04 == 32 bit dst */ -/* 0x40 == dst is float */ -/* 0x80 == src is float */ -#define CVT_F32_F32 0xc4 -#define CVT_F32_S32 0x44 -#define CVT_S32_F32 0x8c -#define CVT_S32_S32 0x0c -#define CVT_NEG 0x20 -#define CVT_RI 0x08 +#define CVT_X32_X32 0x04004000 +#define CVT_X32_S32 0x04014000 +#define CVT_F32_F32 ((0xc0 << 24) | CVT_X32_X32) +#define CVT_S32_F32 ((0x88 << 24) | CVT_X32_X32) +#define CVT_U32_F32 ((0x80 << 24) | CVT_X32_X32) +#define CVT_F32_S32 ((0x40 << 24) | CVT_X32_S32) +#define CVT_F32_U32 ((0x40 << 24) | CVT_X32_X32) +#define CVT_S32_S32 ((0x08 << 24) | CVT_X32_S32) +#define CVT_S32_U32 ((0x08 << 24) | CVT_X32_X32) +#define CVT_U32_S32 ((0x00 << 24) | CVT_X32_S32) + +#define CVT_NEG 0x20000000 +#define CVT_RI 0x08000000 static void emit_cvt(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src, - int wp, unsigned cvn, unsigned fmt) + int wp, uint32_t cvn) { struct nv50_program_exec *e; e = exec(pc); - set_long(pc, e); - e->inst[0] |= 0xa0000000; - e->inst[1] |= 0x00004000; /* 32 bit src */ - e->inst[1] |= (cvn << 16); - e->inst[1] |= (fmt << 24); + if (src->mod & NV50_MOD_NEG) cvn |= CVT_NEG; + if (src->mod & NV50_MOD_ABS) cvn |= CVT_ABS; + + e->inst[0] = 0xa0000000; + e->inst[1] = cvn; + set_long(pc, e); set_src_0(pc, src, e); if (wp >= 0) @@ -1196,10 +1306,12 @@ emit_cvt(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src, * 0x6 = GE * 0x7 = set condition code ? (used before bra.lt/le/gt/ge) * 0x8 = unordered bit (allows NaN) + * + * mode = 0x04 (u32), 0x0c (s32), 0x80 (f32) */ static void emit_set(struct nv50_pc *pc, unsigned ccode, struct nv50_reg *dst, int wp, - struct nv50_reg *src0, struct nv50_reg *src1) + struct nv50_reg *src0, struct nv50_reg *src1, uint8_t mode) { static const unsigned cc_swapped[8] = { 0, 4, 2, 6, 1, 5, 3, 7 }; @@ -1214,16 +1326,10 @@ emit_set(struct nv50_pc *pc, unsigned ccode, struct nv50_reg *dst, int wp, if (dst && dst->type != P_TEMP) dst = alloc_temp(pc, NULL); - /* set.u32 */ set_long(pc, e); - e->inst[0] |= 0xb0000000; + e->inst[0] |= 0x30000000 | (mode << 24); e->inst[1] |= 0x60000000 | (ccode << 14); - /* XXX: decuda will disasm as .u16 and use .lo/.hi regs, but - * that doesn't seem to match what the hw actually does - e->inst[1] |= 0x04000000; << breaks things, u32 by default ? - */ - if (wp >= 0) set_pred_wr(pc, 1, wp, e); if (dst) @@ -1238,33 +1344,146 @@ emit_set(struct nv50_pc *pc, unsigned ccode, struct nv50_reg *dst, int wp, emit(pc, e); - /* cvt.f32.u32/s32 (?) if we didn't only write the predicate */ - if (rdst) - emit_cvt(pc, rdst, dst, -1, CVTOP_ABS | CVTOP_RN, CVT_F32_S32); + if (rdst && mode == 0x80) /* convert to float ? */ + emit_cvt(pc, rdst, dst, -1, CVT_ABS | CVT_F32_S32); if (rdst && rdst != dst) free_temp(pc, dst); } -static INLINE unsigned -map_tgsi_setop_cc(unsigned op) +static INLINE void +map_tgsi_setop_hw(unsigned op, uint8_t *cc, uint8_t *ty) { switch (op) { - case TGSI_OPCODE_SLT: return 0x1; - case TGSI_OPCODE_SGE: return 0x6; - case TGSI_OPCODE_SEQ: return 0x2; - case TGSI_OPCODE_SGT: return 0x4; - case TGSI_OPCODE_SLE: return 0x3; - case TGSI_OPCODE_SNE: return 0xd; + case TGSI_OPCODE_SLT: *cc = 0x1; *ty = 0x80; break; + case TGSI_OPCODE_SGE: *cc = 0x6; *ty = 0x80; break; + case TGSI_OPCODE_SEQ: *cc = 0x2; *ty = 0x80; break; + case TGSI_OPCODE_SGT: *cc = 0x4; *ty = 0x80; break; + case TGSI_OPCODE_SLE: *cc = 0x3; *ty = 0x80; break; + case TGSI_OPCODE_SNE: *cc = 0xd; *ty = 0x80; break; + + case TGSI_OPCODE_ISLT: *cc = 0x1; *ty = 0x0c; break; + case TGSI_OPCODE_ISGE: *cc = 0x6; *ty = 0x0c; break; + case TGSI_OPCODE_USEQ: *cc = 0x2; *ty = 0x04; break; + case TGSI_OPCODE_USGE: *cc = 0x6; *ty = 0x04; break; + case TGSI_OPCODE_USLT: *cc = 0x1; *ty = 0x04; break; + case TGSI_OPCODE_USNE: *cc = 0x5; *ty = 0x04; break; default: assert(0); - return 0; + return; + } +} + +static void +emit_add_b32(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src0, struct nv50_reg *rsrc1) +{ + struct nv50_program_exec *e = exec(pc); + struct nv50_reg *src1; + + e->inst[0] = 0x20000000; + + alloc_reg(pc, rsrc1); + check_swap_src_0_1(pc, &src0, &rsrc1); + + src1 = rsrc1; + if (src0->mod & rsrc1->mod & NV50_MOD_NEG) { + src1 = temp_temp(pc, e); + emit_cvt(pc, src1, rsrc1, -1, CVT_S32_S32); + } + + if (!pc->allow32 || src1->hw > 63 || + (src1->type != P_TEMP && src1->type != P_IMMD)) + set_long(pc, e); + + set_dst(pc, dst, e); + set_src_0(pc, src0, e); + + if (is_long(e)) { + e->inst[1] |= 1 << 26; + set_src_2(pc, src1, e); + } else { + e->inst[0] |= 0x8000; + if (src1->type == P_IMMD) + set_immd(pc, src1, e); + else + set_src_1(pc, src1, e); } + + if (src0->mod & NV50_MOD_NEG) + e->inst[0] |= 1 << 28; + else + if (src1->mod & NV50_MOD_NEG) + e->inst[0] |= 1 << 22; + + emit(pc, e); +} + +static void +emit_mad_u16(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src0, int lh_0, struct nv50_reg *src1, int lh_1, + struct nv50_reg *src2) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0x60000000; + if (!pc->allow32) + set_long(pc, e); + set_dst(pc, dst, e); + + set_half_src(pc, src0, lh_0, e, 9); + set_half_src(pc, src1, lh_1, e, 16); + alloc_reg(pc, src2); + if (is_long(e) || (src2->type != P_TEMP) || (src2->hw != dst->hw)) + set_src_2(pc, src2, e); + + emit(pc, e); +} + +static void +emit_mul_u16(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src0, int lh_0, struct nv50_reg *src1, int lh_1) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0x40000000; + set_long(pc, e); + set_dst(pc, dst, e); + + set_half_src(pc, src0, lh_0, e, 9); + set_half_src(pc, src1, lh_1, e, 16); + + emit(pc, e); +} + +static void +emit_sad(struct nv50_pc *pc, struct nv50_reg *dst, + struct nv50_reg *src0, struct nv50_reg *src1, struct nv50_reg *src2) +{ + struct nv50_program_exec *e = exec(pc); + + e->inst[0] = 0x50000000; + if (!pc->allow32) + set_long(pc, e); + check_swap_src_0_1(pc, &src0, &src1); + set_dst(pc, dst, e); + set_src_0(pc, src0, e); + set_src_1(pc, src1, e); + alloc_reg(pc, src2); + if (is_long(e) || (src2->type != dst->type) || (src2->hw != dst->hw)) + set_src_2(pc, src2, e); + + if (is_long(e)) + e->inst[1] |= 0x0c << 24; + else + e->inst[0] |= 0x81 << 8; + + emit(pc, e); } static INLINE void emit_flr(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) { - emit_cvt(pc, dst, src, -1, CVTOP_FLOOR, CVT_F32_F32 | CVT_RI); + emit_cvt(pc, dst, src, -1, CVT_FLOOR | CVT_F32_F32 | CVT_RI); } static void @@ -1282,15 +1501,9 @@ emit_pow(struct nv50_pc *pc, struct nv50_reg *dst, } static INLINE void -emit_abs(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) -{ - emit_cvt(pc, dst, src, -1, CVTOP_ABS, CVT_F32_F32); -} - -static INLINE void emit_sat(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) { - emit_cvt(pc, dst, src, -1, CVTOP_SAT, CVT_F32_F32); + emit_cvt(pc, dst, src, -1, CVT_SAT | CVT_F32_F32); } static void @@ -1308,18 +1521,18 @@ emit_lit(struct nv50_pc *pc, struct nv50_reg **dst, unsigned mask, if (mask & (3 << 1)) { tmp[0] = alloc_temp(pc, NULL); - emit_minmax(pc, 4, tmp[0], src[0], zero); + emit_minmax(pc, NV50_MAX_F32, tmp[0], src[0], zero); } if (mask & (1 << 2)) { set_pred_wr(pc, 1, 0, pc->p->exec_tail); - tmp[1] = temp_temp(pc); - emit_minmax(pc, 4, tmp[1], src[1], zero); + tmp[1] = temp_temp(pc, NULL); + emit_minmax(pc, NV50_MAX_F32, tmp[1], src[1], zero); - tmp[3] = temp_temp(pc); - emit_minmax(pc, 4, tmp[3], src[3], neg128); - emit_minmax(pc, 5, tmp[3], tmp[3], pos128); + tmp[3] = temp_temp(pc, NULL); + emit_minmax(pc, NV50_MAX_F32, tmp[3], src[3], neg128); + emit_minmax(pc, NV50_MIN_F32, tmp[3], tmp[3], pos128); emit_pow(pc, dst[2], tmp[1], tmp[3]); emit_mov(pc, dst[2], zero); @@ -1347,12 +1560,6 @@ emit_lit(struct nv50_pc *pc, struct nv50_reg **dst, unsigned mask, FREE(one); } -static INLINE void -emit_neg(struct nv50_pc *pc, struct nv50_reg *dst, struct nv50_reg *src) -{ - emit_cvt(pc, dst, src, -1, CVTOP_RN, CVT_F32_F32 | CVT_NEG); -} - static void emit_kil(struct nv50_pc *pc, struct nv50_reg *src) { @@ -1364,14 +1571,9 @@ emit_kil(struct nv50_pc *pc, struct nv50_reg *src) set_long(pc, e); /* sets cond code to ALWAYS */ if (src) { - unsigned cvn = CVT_F32_F32; - set_pred(pc, 0x1 /* cc = LT */, r_pred, e); - - if (src->mod & NV50_MOD_NEG) - cvn |= CVT_NEG; - /* write predicate reg */ - emit_cvt(pc, NULL, src, r_pred, CVTOP_RN, cvn); + /* write to predicate reg */ + emit_cvt(pc, NULL, src, r_pred, CVT_F32_F32); } emit(pc, e); @@ -1474,8 +1676,8 @@ load_cube_tex_coords(struct nv50_pc *pc, struct nv50_reg *t[4], src[1]->mod |= NV50_MOD_ABS; src[2]->mod |= NV50_MOD_ABS; - emit_minmax(pc, 4, t[2], src[0], src[1]); - emit_minmax(pc, 4, t[2], src[2], t[2]); + emit_minmax(pc, NV50_MAX_F32, t[2], src[0], src[1]); + emit_minmax(pc, NV50_MAX_F32, t[2], src[2], t[2]); src[0]->mod = mod[0]; src[1]->mod = mod[1]; @@ -1778,6 +1980,21 @@ convert_to_long(struct nv50_pc *pc, struct nv50_program_exec *e) q = 0x0403c000; m = 0xffff7fff; break; + case 0x2: + case 0x3: + /* ADD, SUB, SUBR b32 */ + m = ~(0x8000 | (127 << 16)); + q = ((e->inst[0] & (~m)) >> 2) | (1 << 26); + break; + case 0x5: + /* SAD */ + m = ~(0x81 << 8); + q = (0x0c << 24) | ((e->inst[0] & (0x7f << 2)) << 12); + break; + case 0x6: + /* MAD u16 */ + q = (e->inst[0] & (0x7f << 2)) << 12; + break; case 0x8: /* INTERP (move centroid, perspective and flat bits) */ m = ~0x03000100; @@ -1814,8 +2031,8 @@ convert_to_long(struct nv50_pc *pc, struct nv50_program_exec *e) } /* Some operations support an optional negation flag. */ -static boolean -negate_supported(const struct tgsi_full_instruction *insn, int i) +static int +get_supported_mods(const struct tgsi_full_instruction *insn, int i) { switch (insn->Instruction.Opcode) { case TGSI_OPCODE_ADD: @@ -1835,9 +2052,36 @@ negate_supported(const struct tgsi_full_instruction *insn, int i) case TGSI_OPCODE_SCS: case TGSI_OPCODE_SIN: case TGSI_OPCODE_SUB: - return TRUE; + return NV50_MOD_NEG; + case TGSI_OPCODE_MAX: + case TGSI_OPCODE_MIN: + case TGSI_OPCODE_INEG: /* tgsi src sign toggle/set would be stupid */ + return NV50_MOD_ABS; + case TGSI_OPCODE_CEIL: + case TGSI_OPCODE_FLR: + case TGSI_OPCODE_TRUNC: + return NV50_MOD_NEG | NV50_MOD_ABS; + case TGSI_OPCODE_F2I: + case TGSI_OPCODE_F2U: + case TGSI_OPCODE_I2F: + case TGSI_OPCODE_U2F: + return NV50_MOD_NEG | NV50_MOD_ABS | NV50_MOD_I32; + case TGSI_OPCODE_UADD: + return NV50_MOD_NEG | NV50_MOD_I32; + case TGSI_OPCODE_SAD: + case TGSI_OPCODE_SHL: + case TGSI_OPCODE_IMAX: + case TGSI_OPCODE_IMIN: + case TGSI_OPCODE_ISHR: + case TGSI_OPCODE_NOT: + case TGSI_OPCODE_UMAD: + case TGSI_OPCODE_UMAX: + case TGSI_OPCODE_UMIN: + case TGSI_OPCODE_UMUL: + case TGSI_OPCODE_USHR: + return NV50_MOD_I32; default: - return FALSE; + return 0; } } @@ -1944,11 +2188,11 @@ tgsi_dst(struct nv50_pc *pc, int c, const struct tgsi_full_dst_register *dst) static struct nv50_reg * tgsi_src(struct nv50_pc *pc, int chan, const struct tgsi_full_src_register *src, - boolean neg) + int mod) { struct nv50_reg *r = NULL; - struct nv50_reg *temp; - unsigned sgn, c, swz; + struct nv50_reg *temp = NULL; + unsigned sgn, c, swz, cvn; if (src->Register.File != TGSI_FILE_CONSTANT) assert(!src->Register.Indirect); @@ -1988,7 +2232,7 @@ tgsi_src(struct nv50_pc *pc, int chan, const struct tgsi_full_src_register *src, r = &pc->immd[src->Register.Index * 4 + c]; break; case TGSI_FILE_SAMPLER: - break; + return NULL; case TGSI_FILE_ADDRESS: r = pc->addr[src->Register.Index * 4 + c]; assert(r); @@ -2003,35 +2247,34 @@ tgsi_src(struct nv50_pc *pc, int chan, const struct tgsi_full_src_register *src, break; } + cvn = (mod & NV50_MOD_I32) ? CVT_S32_S32 : CVT_F32_F32; + switch (sgn) { - case TGSI_UTIL_SIGN_KEEP: - break; case TGSI_UTIL_SIGN_CLEAR: - temp = temp_temp(pc); - emit_abs(pc, temp, r); - r = temp; - break; - case TGSI_UTIL_SIGN_TOGGLE: - if (neg) - r->mod = NV50_MOD_NEG; - else { - temp = temp_temp(pc); - emit_neg(pc, temp, r); - r = temp; - } + r->mod = NV50_MOD_ABS; break; case TGSI_UTIL_SIGN_SET: - temp = temp_temp(pc); - emit_cvt(pc, temp, r, -1, CVTOP_ABS, CVT_F32_F32 | CVT_NEG); - r = temp; + r->mod = NV50_MOD_NEG_ABS; + break; + case TGSI_UTIL_SIGN_TOGGLE: + r->mod = NV50_MOD_NEG; break; default: - assert(0); + assert(!r->mod && sgn == TGSI_UTIL_SIGN_KEEP); break; } - if (r && r->acc >= 0 && r != temp) - return reg_instance(pc, r); + if ((r->mod & mod) != r->mod) { + temp = temp_temp(pc, NULL); + emit_cvt(pc, temp, r, -1, cvn); + r->mod = 0; + r = temp; + } else + r->mod |= mod & NV50_MOD_I32; + + assert(r); + if (r->acc >= 0 && r != temp) + return reg_instance(pc, r); /* will clear r->mod */ return r; } @@ -2195,22 +2438,22 @@ nv50_program_tx_insn(struct nv50_pc *pc, for (i = 0; i < inst->Instruction.NumSrcRegs; i++) { const struct tgsi_full_src_register *fs = &inst->Src[i]; unsigned src_mask; - boolean neg_supp; + int mod_supp; src_mask = nv50_tgsi_src_mask(inst, i); - neg_supp = negate_supported(inst, i); + mod_supp = get_supported_mods(inst, i); if (fs->Register.File == TGSI_FILE_SAMPLER) unit = fs->Register.Index; for (c = 0; c < 4; c++) if (src_mask & (1 << c)) - src[i][c] = tgsi_src(pc, c, fs, neg_supp); + src[i][c] = tgsi_src(pc, c, fs, mod_supp); } brdc = temp = pc->r_brdc; if (brdc && brdc->type != P_TEMP) { - temp = temp_temp(pc); + temp = temp_temp(pc, NULL); if (sat) brdc = temp; } else @@ -2219,7 +2462,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (!(mask & (1 << c)) || dst[c]->type == P_TEMP) continue; /* rdst[c] = dst[c]; */ /* done above */ - dst[c] = temp_temp(pc); + dst[c] = temp_temp(pc, NULL); } } @@ -2230,7 +2473,8 @@ nv50_program_tx_insn(struct nv50_pc *pc, for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; - emit_abs(pc, dst[c], src[0][c]); + emit_cvt(pc, dst[c], src[0][c], -1, + CVT_ABS | CVT_F32_F32); } break; case TGSI_OPCODE_ADD: @@ -2252,8 +2496,8 @@ nv50_program_tx_insn(struct nv50_pc *pc, break; case TGSI_OPCODE_ARL: assert(src[0][0]); - temp = temp_temp(pc); - emit_cvt(pc, temp, src[0][0], -1, CVTOP_FLOOR, CVT_S32_F32); + temp = temp_temp(pc, NULL); + emit_cvt(pc, temp, src[0][0], -1, CVT_FLOOR | CVT_S32_F32); emit_arl(pc, dst[0], temp, 4); break; case TGSI_OPCODE_BGNLOOP: @@ -2282,7 +2526,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (!(mask & (1 << c))) continue; emit_cvt(pc, dst[c], src[0][c], -1, - CVTOP_CEIL, CVT_F32_F32 | CVT_RI); + CVT_CEIL | CVT_F32_F32 | CVT_RI); } break; case TGSI_OPCODE_CMP: @@ -2290,7 +2534,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; - emit_cvt(pc, NULL, src[0][c], 1, CVTOP_RN, CVT_F32_F32); + emit_cvt(pc, NULL, src[0][c], 1, CVT_F32_F32); emit_mov(pc, dst[c], src[1][c]); set_pred(pc, 0x1, 1, pc->p->exec_tail); /* @SF */ emit_mov(pc, dst[c], src[2][c]); @@ -2309,7 +2553,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (!(mask &= 7)) break; if (temp == dst[3]) - temp = brdc = temp_temp(pc); + temp = brdc = temp_temp(pc, NULL); } emit_precossin(pc, temp, src[0][0]); emit_flop(pc, NV50_FLOP_COS, brdc, temp); @@ -2397,8 +2641,8 @@ nv50_program_tx_insn(struct nv50_pc *pc, struct nv50_reg *t[2]; assert(!temp); - t[0] = temp_temp(pc); - t[1] = temp_temp(pc); + t[0] = temp_temp(pc, NULL); + t[1] = temp_temp(pc, NULL); if (mask & 0x6) emit_mov(pc, t[0], src[0][0]); @@ -2419,6 +2663,22 @@ nv50_program_tx_insn(struct nv50_pc *pc, emit_mov_immdval(pc, dst[3], 1.0f); } break; + case TGSI_OPCODE_F2I: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_cvt(pc, dst[c], src[0][c], -1, + CVT_TRUNC | CVT_S32_F32); + } + break; + case TGSI_OPCODE_F2U: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_cvt(pc, dst[c], src[0][c], -1, + CVT_TRUNC | CVT_U32_F32); + } + break; case TGSI_OPCODE_FLR: for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) @@ -2427,7 +2687,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, } break; case TGSI_OPCODE_FRC: - temp = temp_temp(pc); + temp = temp_temp(pc, NULL); for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; @@ -2435,14 +2695,42 @@ nv50_program_tx_insn(struct nv50_pc *pc, emit_sub(pc, dst[c], src[0][c], temp); } break; + case TGSI_OPCODE_I2F: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_cvt(pc, dst[c], src[0][c], -1, CVT_F32_S32); + } + break; case TGSI_OPCODE_IF: assert(pc->if_lvl < NV50_MAX_COND_NESTING); - emit_cvt(pc, NULL, src[0][0], 0, CVTOP_ABS | CVTOP_RN, - CVT_F32_F32); + emit_cvt(pc, NULL, src[0][0], 0, CVT_ABS | CVT_F32_F32); pc->if_join[pc->if_lvl] = emit_joinat(pc); pc->if_insn[pc->if_lvl++] = emit_branch(pc, 0, 2);; terminate_mbb(pc); break; + case TGSI_OPCODE_IMAX: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_minmax(pc, 0x08c, dst[c], src[0][c], src[1][c]); + } + break; + case TGSI_OPCODE_IMIN: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_minmax(pc, 0x0ac, dst[c], src[0][c], src[1][c]); + } + break; + case TGSI_OPCODE_INEG: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_cvt(pc, dst[c], src[0][c], -1, + CVT_S32_S32 | CVT_NEG); + } + break; case TGSI_OPCODE_KIL: assert(src[0][0] && src[0][1] && src[0][2] && src[0][3]); emit_kil(pc, src[0][0]); @@ -2463,13 +2751,13 @@ nv50_program_tx_insn(struct nv50_pc *pc, { struct nv50_reg *t[2]; - t[0] = temp_temp(pc); + t[0] = temp_temp(pc, NULL); if (mask & (1 << 1)) - t[1] = temp_temp(pc); + t[1] = temp_temp(pc, NULL); else t[1] = t[0]; - emit_abs(pc, t[0], src[0][0]); + emit_cvt(pc, t[0], src[0][0], -1, CVT_ABS | CVT_F32_F32); emit_flop(pc, NV50_FLOP_LG2, t[1], t[0]); if (mask & (1 << 2)) emit_mov(pc, dst[2], t[1]); @@ -2488,7 +2776,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, } break; case TGSI_OPCODE_LRP: - temp = temp_temp(pc); + temp = temp_temp(pc, NULL); for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; @@ -2507,14 +2795,14 @@ nv50_program_tx_insn(struct nv50_pc *pc, for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; - emit_minmax(pc, 4, dst[c], src[0][c], src[1][c]); + emit_minmax(pc, 0x880, dst[c], src[0][c], src[1][c]); } break; case TGSI_OPCODE_MIN: for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; - emit_minmax(pc, 5, dst[c], src[0][c], src[1][c]); + emit_minmax(pc, 0x8a0, dst[c], src[0][c], src[1][c]); } break; case TGSI_OPCODE_MOV: @@ -2531,10 +2819,19 @@ nv50_program_tx_insn(struct nv50_pc *pc, emit_mul(pc, dst[c], src[0][c], src[1][c]); } break; + case TGSI_OPCODE_NOT: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_not(pc, dst[c], src[0][c]); + } + break; case TGSI_OPCODE_POW: emit_pow(pc, brdc, src[0][0], src[1][0]); break; case TGSI_OPCODE_RCP: + if (!sat && popcnt4(mask) == 1) + brdc = dst[ffs(mask) - 1]; emit_flop(pc, NV50_FLOP_RCP, brdc, src[0][0]); break; case TGSI_OPCODE_RET: @@ -2543,11 +2840,20 @@ nv50_program_tx_insn(struct nv50_pc *pc, emit_ret(pc, -1, 0); break; case TGSI_OPCODE_RSQ: + if (!sat && popcnt4(mask) == 1) + brdc = dst[ffs(mask) - 1]; src[0][0]->mod |= NV50_MOD_ABS; emit_flop(pc, NV50_FLOP_RSQ, brdc, src[0][0]); break; + case TGSI_OPCODE_SAD: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_sad(pc, dst[c], src[0][c], src[1][c], src[2][c]); + } + break; case TGSI_OPCODE_SCS: - temp = temp_temp(pc); + temp = temp_temp(pc, NULL); if (mask & 3) emit_precossin(pc, temp, src[0][0]); if (mask & (1 << 0)) @@ -2559,6 +2865,16 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (mask & (1 << 3)) emit_mov_immdval(pc, dst[3], 1.0); break; + case TGSI_OPCODE_SHL: + case TGSI_OPCODE_ISHR: + case TGSI_OPCODE_USHR: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_shift(pc, dst[c], src[0][c], src[1][c], + inst->Instruction.Opcode); + } + break; case TGSI_OPCODE_SIN: if (mask & 8) { emit_precossin(pc, temp, src[0][3]); @@ -2566,7 +2882,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (!(mask &= 7)) break; if (temp == dst[3]) - temp = brdc = temp_temp(pc); + temp = brdc = temp_temp(pc, NULL); } emit_precossin(pc, temp, src[0][0]); emit_flop(pc, NV50_FLOP_SIN, brdc, temp); @@ -2577,12 +2893,23 @@ nv50_program_tx_insn(struct nv50_pc *pc, case TGSI_OPCODE_SGT: case TGSI_OPCODE_SLE: case TGSI_OPCODE_SNE: - i = map_tgsi_setop_cc(inst->Instruction.Opcode); + case TGSI_OPCODE_ISLT: + case TGSI_OPCODE_ISGE: + case TGSI_OPCODE_USEQ: + case TGSI_OPCODE_USGE: + case TGSI_OPCODE_USLT: + case TGSI_OPCODE_USNE: + { + uint8_t cc, ty; + + map_tgsi_setop_hw(inst->Instruction.Opcode, &cc, &ty); + for (c = 0; c < 4; c++) { if (!(mask & (1 << c))) continue; - emit_set(pc, i, dst[c], -1, src[0][c], src[1][c]); + emit_set(pc, cc, dst[c], -1, src[0][c], src[1][c], ty); } + } break; case TGSI_OPCODE_SUB: for (c = 0; c < 4; c++) { @@ -2612,11 +2939,72 @@ nv50_program_tx_insn(struct nv50_pc *pc, if (!(mask & (1 << c))) continue; emit_cvt(pc, dst[c], src[0][c], -1, - CVTOP_TRUNC, CVT_F32_F32 | CVT_RI); + CVT_TRUNC | CVT_F32_F32 | CVT_RI); } break; + case TGSI_OPCODE_U2F: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_cvt(pc, dst[c], src[0][c], -1, CVT_F32_U32); + } + break; + case TGSI_OPCODE_UADD: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_add_b32(pc, dst[c], src[0][c], src[1][c]); + } + break; + case TGSI_OPCODE_UMAX: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_minmax(pc, 0x084, dst[c], src[0][c], src[1][c]); + } + break; + case TGSI_OPCODE_UMIN: + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_minmax(pc, 0x0a4, dst[c], src[0][c], src[1][c]); + } + break; + case TGSI_OPCODE_UMAD: + { + assert(!temp); + temp = temp_temp(pc, NULL); + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_mul_u16(pc, temp, src[0][c], 0, src[1][c], 1); + emit_mad_u16(pc, temp, src[0][c], 1, src[1][c], 0, + temp); + emit_shl_imm(pc, temp, temp, 16); + emit_mad_u16(pc, temp, src[0][c], 0, src[1][c], 0, + temp); + emit_add_b32(pc, dst[c], temp, src[2][c]); + } + } + break; + case TGSI_OPCODE_UMUL: + { + assert(!temp); + temp = temp_temp(pc, NULL); + for (c = 0; c < 4; c++) { + if (!(mask & (1 << c))) + continue; + emit_mul_u16(pc, temp, src[0][c], 0, src[1][c], 1); + emit_mad_u16(pc, temp, src[0][c], 1, src[1][c], 0, + temp); + emit_shl_imm(pc, temp, temp, 16); + emit_mad_u16(pc, dst[c], src[0][c], 0, src[1][c], 0, + temp); + } + } + break; case TGSI_OPCODE_XPD: - temp = temp_temp(pc); + temp = temp_temp(pc, NULL); if (mask & (1 << 0)) { emit_mul(pc, temp, src[0][2], src[1][1]); emit_msb(pc, dst[0], src[0][1], src[1][2], temp); @@ -2670,7 +3058,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, } } - kill_temp_temp(pc); + kill_temp_temp(pc, NULL); pc->reg_instance_nr = 0; return TRUE; @@ -2679,7 +3067,7 @@ nv50_program_tx_insn(struct nv50_pc *pc, static void prep_inspect_insn(struct nv50_pc *pc, const struct tgsi_full_instruction *insn) { - struct nv50_reg *reg = NULL; + struct nv50_reg *r, *reg = NULL; const struct tgsi_full_src_register *src; const struct tgsi_dst_register *dst; unsigned i, c, k, mask; @@ -2725,7 +3113,15 @@ prep_inspect_insn(struct nv50_pc *pc, const struct tgsi_full_instruction *insn) continue; k = tgsi_util_get_full_src_register_swizzle(src, c); - reg[src->Register.Index * 4 + k].acc = pc->insn_nr; + r = ®[src->Register.Index * 4 + k]; + + /* If used before written, pre-allocate the reg, + * lest we overwrite results from a subroutine. + */ + if (!r->acc && r->type == P_TEMP) + alloc_reg(pc, r); + + r->acc = pc->insn_nr; } } } @@ -2814,7 +3210,7 @@ nv50_tgsi_scan_swizzle(const struct tgsi_full_instruction *insn, for (i = 0; i < insn->Instruction.NumSrcRegs; i++) { unsigned chn, mask = nv50_tgsi_src_mask(insn, i); - boolean neg_supp = negate_supported(insn, i); + int ms = get_supported_mods(insn, i); fs = &insn->Src[i]; if (fs->Register.File != fd->Register.File || @@ -2832,10 +3228,12 @@ nv50_tgsi_scan_swizzle(const struct tgsi_full_instruction *insn, if (!(fd->Register.WriteMask & (1 << c))) continue; - /* no danger if src is copied to TEMP first */ - if ((s != TGSI_UTIL_SIGN_KEEP) && - (s != TGSI_UTIL_SIGN_TOGGLE || !neg_supp)) - continue; + if (s == TGSI_UTIL_SIGN_TOGGLE && !(ms & NV50_MOD_NEG)) + continue; + if (s == TGSI_UTIL_SIGN_CLEAR && !(ms & NV50_MOD_ABS)) + continue; + if ((s == TGSI_UTIL_SIGN_SET) && ((ms & 3) != 3)) + continue; rdep[c] |= nv50_tgsi_dst_revdep( insn->Instruction.Opcode, i, chn); @@ -2859,7 +3257,7 @@ nv50_tgsi_insn(struct nv50_pc *pc, const union tgsi_full_token *tok) if (is_scalar_op(insn.Instruction.Opcode)) { pc->r_brdc = tgsi_broadcast_dst(pc, fd, deqs); if (!pc->r_brdc) - pc->r_brdc = temp_temp(pc); + pc->r_brdc = temp_temp(pc, NULL); return nv50_program_tx_insn(pc, &insn); } pc->r_brdc = NULL; @@ -3579,7 +3977,7 @@ nv50_vertprog_validate(struct nv50_context *nv50) nv50_program_validate_data(nv50, p); nv50_program_validate_code(nv50, p); - so = so_new(13, 2); + so = so_new(5, 8, 2); so_method(so, tesla, NV50TCL_VP_ADDRESS_HIGH, 2); so_reloc (so, p->bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_RD | NOUVEAU_BO_HIGH, 0, 0); @@ -3615,7 +4013,7 @@ nv50_fragprog_validate(struct nv50_context *nv50) nv50_program_validate_data(nv50, p); nv50_program_validate_code(nv50, p); - so = so_new(64, 2); + so = so_new(6, 7, 2); so_method(so, tesla, NV50TCL_FP_ADDRESS_HIGH, 2); so_reloc (so, p->bo, 0, NOUVEAU_BO_VRAM | NOUVEAU_BO_RD | NOUVEAU_BO_HIGH, 0, 0); @@ -3635,12 +4033,13 @@ nv50_fragprog_validate(struct nv50_context *nv50) so_ref(NULL, &so); } -static void +static uint32_t nv50_pntc_replace(struct nv50_context *nv50, uint32_t pntc[8], unsigned base) { struct nv50_program *fp = nv50->fragprog; struct nv50_program *vp = nv50->vertprog; unsigned i, c, m = base; + uint32_t origin = 0x00000010; /* XXX: this might not work correctly in all cases yet - we'll * just assume that an FP generic input that is not written in @@ -3674,7 +4073,9 @@ nv50_pntc_replace(struct nv50_context *nv50, uint32_t pntc[8], unsigned base) if (mode == PIPE_SPRITE_COORD_NONE) { m += n; continue; - } + } else + if (mode == PIPE_SPRITE_COORD_LOWER_LEFT) + origin = 0; } /* this is either PointCoord or replaced by sprite coords */ @@ -3685,6 +4086,7 @@ nv50_pntc_replace(struct nv50_context *nv50, uint32_t pntc[8], unsigned base) ++m; } } + return origin; } static int @@ -3783,7 +4185,7 @@ nv50_linkage_validate(struct nv50_context *nv50) } /* now fill the stateobj */ - so = so_new(64, 0); + so = so_new(7, 57, 0); n = (m + 3) / 4; so_method(so, tesla, NV50TCL_VP_RESULT_MAP_SIZE, 1); @@ -3801,7 +4203,9 @@ nv50_linkage_validate(struct nv50_context *nv50) so_datap (so, lin, 4); if (nv50->rasterizer->pipe.point_sprite) { - nv50_pntc_replace(nv50, pcrd, (reg[4] >> 8) & 0xff); + so_method(so, tesla, NV50TCL_POINT_SPRITE_CTRL, 1); + so_data (so, + nv50_pntc_replace(nv50, pcrd, (reg[4] >> 8) & 0xff)); so_method(so, tesla, NV50TCL_POINT_COORD_REPLACE_MAP(0), 8); so_datap (so, pcrd, 8); diff --git a/src/gallium/drivers/nv50/nv50_query.c b/src/gallium/drivers/nv50/nv50_query.c index 5d9e18218a..5a4ab3508b 100644 --- a/src/gallium/drivers/nv50/nv50_query.c +++ b/src/gallium/drivers/nv50/nv50_query.c @@ -111,7 +111,7 @@ nv50_query_result(struct pipe_context *pipe, struct pipe_query *pq, if (!q->ready) { ret = nouveau_bo_map(q->bo, NOUVEAU_BO_RD | - wait ? 0 : NOUVEAU_BO_NOWAIT); + (wait ? 0 : NOUVEAU_BO_NOWAIT)); if (ret) return false; q->result = ((uint32_t *)q->bo->map)[1]; diff --git a/src/gallium/drivers/nv50/nv50_screen.c b/src/gallium/drivers/nv50/nv50_screen.c index 7e039ea82e..28e2b35dea 100644 --- a/src/gallium/drivers/nv50/nv50_screen.c +++ b/src/gallium/drivers/nv50/nv50_screen.c @@ -189,6 +189,28 @@ nv50_screen_destroy(struct pipe_screen *pscreen) FREE(screen); } +static int +nv50_pre_pipebuffer_map(struct pipe_screen *pscreen, struct pipe_buffer *pb, + unsigned usage) +{ + struct nv50_screen *screen = nv50_screen(pscreen); + struct nv50_context *ctx = screen->cur_ctx; + + if (!(pb->usage & PIPE_BUFFER_USAGE_VERTEX)) + return 0; + + /* Our vtxbuf got mapped, it can no longer be considered part of current + * state, remove it to avoid emitting reloc markers. + */ + if (ctx && ctx->state.vtxbuf && so_bo_is_reloc(ctx->state.vtxbuf, + nouveau_bo(pb))) { + so_ref(NULL, &ctx->state.vtxbuf); + ctx->dirty |= NV50_NEW_ARRAYS; + } + + return 0; +} + struct pipe_screen * nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) { @@ -216,6 +238,7 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) pscreen->get_param = nv50_screen_get_param; pscreen->get_paramf = nv50_screen_get_paramf; pscreen->is_format_supported = nv50_screen_is_format_supported; + screen->base.pre_pipebuffer_map_callback = nv50_pre_pipebuffer_map; nv50_screen_init_miptree_functions(pscreen); nv50_transfer_init_screen_functions(pscreen); @@ -228,7 +251,6 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) nv50_screen_destroy(pscreen); return NULL; } - BIND_RING(chan, screen->m2mf, 1); /* 2D object */ ret = nouveau_grobj_alloc(chan, 0xbeef502d, NV50_2D, &screen->eng2d); @@ -237,7 +259,6 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) nv50_screen_destroy(pscreen); return NULL; } - BIND_RING(chan, screen->eng2d, 2); /* 3D object */ switch (chipset & 0xf0) { @@ -273,7 +294,6 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) nv50_screen_destroy(pscreen); return NULL; } - BIND_RING(chan, screen->tesla, 3); /* Sync notifier */ ret = nouveau_notifier_alloc(chan, 0xbeef0301, 1, &screen->sync); @@ -284,7 +304,7 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) } /* Static M2MF init */ - so = so_new(32, 0); + so = so_new(1, 3, 0); so_method(so, screen->m2mf, NV04_MEMORY_TO_MEMORY_FORMAT_DMA_NOTIFY, 3); so_data (so, screen->sync->handle); so_data (so, chan->vram->handle); @@ -293,7 +313,7 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) so_ref (NULL, &so); /* Static 2D init */ - so = so_new(64, 0); + so = so_new(4, 7, 0); so_method(so, screen->eng2d, NV50_2D_DMA_NOTIFY, 4); so_data (so, screen->sync->handle); so_data (so, chan->vram->handle); @@ -309,7 +329,7 @@ nv50_screen_create(struct pipe_winsys *ws, struct nouveau_device *dev) so_ref(NULL, &so); /* Static tesla init */ - so = so_new(256, 20); + so = so_new(40, 84, 20); so_method(so, screen->tesla, NV50TCL_COND_MODE, 1); so_data (so, NV50TCL_COND_MODE_ALWAYS); diff --git a/src/gallium/drivers/nv50/nv50_screen.h b/src/gallium/drivers/nv50/nv50_screen.h index 61e24a5b57..a038a4e3c2 100644 --- a/src/gallium/drivers/nv50/nv50_screen.h +++ b/src/gallium/drivers/nv50/nv50_screen.h @@ -2,6 +2,7 @@ #define __NV50_SCREEN_H__ #include "nouveau/nouveau_screen.h" +#include "nv50_context.h" struct nv50_screen { struct nouveau_screen base; @@ -9,6 +10,7 @@ struct nv50_screen { struct nouveau_winsys *nvws; unsigned cur_pctx; + struct nv50_context *cur_ctx; struct nouveau_grobj *tesla; struct nouveau_grobj *eng2d; diff --git a/src/gallium/drivers/nv50/nv50_state.c b/src/gallium/drivers/nv50/nv50_state.c index 30b2b0f91b..1f67df814b 100644 --- a/src/gallium/drivers/nv50/nv50_state.c +++ b/src/gallium/drivers/nv50/nv50_state.c @@ -35,7 +35,7 @@ static void * nv50_blend_state_create(struct pipe_context *pipe, const struct pipe_blend_state *cso) { - struct nouveau_stateobj *so = so_new(64, 0); + struct nouveau_stateobj *so = so_new(5, 24, 0); struct nouveau_grobj *tesla = nv50_context(pipe)->screen->tesla; struct nv50_blend_stateobj *bso = CALLOC_STRUCT(nv50_blend_stateobj); unsigned cmask = 0, i; @@ -146,7 +146,6 @@ nv50_sampler_state_create(struct pipe_context *pipe, (wrap_mode(cso->wrap_r) << 6)); switch (cso->mag_img_filter) { - case PIPE_TEX_FILTER_ANISO: case PIPE_TEX_FILTER_LINEAR: tsc[1] |= NV50TSC_1_1_MAGF_LINEAR; break; @@ -157,7 +156,6 @@ nv50_sampler_state_create(struct pipe_context *pipe, } switch (cso->min_img_filter) { - case PIPE_TEX_FILTER_ANISO: case PIPE_TEX_FILTER_LINEAR: tsc[1] |= NV50TSC_1_1_MINF_LINEAR; break; @@ -280,7 +278,7 @@ static void * nv50_rasterizer_state_create(struct pipe_context *pipe, const struct pipe_rasterizer_state *cso) { - struct nouveau_stateobj *so = so_new(64, 0); + struct nouveau_stateobj *so = so_new(15, 21, 0); struct nouveau_grobj *tesla = nv50_context(pipe)->screen->tesla; struct nv50_rasterizer_stateobj *rso = CALLOC_STRUCT(nv50_rasterizer_stateobj); @@ -425,7 +423,7 @@ nv50_depth_stencil_alpha_state_create(struct pipe_context *pipe, { struct nouveau_grobj *tesla = nv50_context(pipe)->screen->tesla; struct nv50_zsa_stateobj *zsa = CALLOC_STRUCT(nv50_zsa_stateobj); - struct nouveau_stateobj *so = so_new(64, 0); + struct nouveau_stateobj *so = so_new(8, 22, 0); so_method(so, tesla, NV50TCL_DEPTH_WRITE_ENABLE, 1); so_data (so, cso->depth.writemask ? 1 : 0); diff --git a/src/gallium/drivers/nv50/nv50_state_validate.c b/src/gallium/drivers/nv50/nv50_state_validate.c index c8bdf9dc27..f83232f43c 100644 --- a/src/gallium/drivers/nv50/nv50_state_validate.c +++ b/src/gallium/drivers/nv50/nv50_state_validate.c @@ -33,7 +33,7 @@ static void nv50_state_validate_fb(struct nv50_context *nv50) { struct nouveau_grobj *tesla = nv50->screen->tesla; - struct nouveau_stateobj *so = so_new(128, 18); + struct nouveau_stateobj *so = so_new(32, 79, 18); struct pipe_framebuffer_state *fb = &nv50->framebuffer; unsigned i, w, h, gw = 0; @@ -185,6 +185,9 @@ nv50_state_emit(struct nv50_context *nv50) struct nv50_screen *screen = nv50->screen; struct nouveau_channel *chan = screen->base.channel; + /* I don't want to copy headers from the winsys. */ + screen->cur_ctx = nv50; + if (nv50->pctx_id != screen->cur_pctx) { if (nv50->state.fb) nv50->state.dirty |= NV50_NEW_FRAMEBUFFER; @@ -296,7 +299,7 @@ nv50_state_validate(struct nv50_context *nv50) so_ref(nv50->rasterizer->so, &nv50->state.rast); if (nv50->dirty & NV50_NEW_BLEND_COLOUR) { - so = so_new(5, 0); + so = so_new(1, 4, 0); so_method(so, tesla, NV50TCL_BLEND_COLOR(0), 4); so_data (so, fui(nv50->blend_colour.color[0])); so_data (so, fui(nv50->blend_colour.color[1])); @@ -307,7 +310,7 @@ nv50_state_validate(struct nv50_context *nv50) } if (nv50->dirty & NV50_NEW_STIPPLE) { - so = so_new(33, 0); + so = so_new(1, 32, 0); so_method(so, tesla, NV50TCL_POLYGON_STIPPLE_PATTERN(0), 32); for (i = 0; i < 32; i++) so_data(so, util_bswap32(nv50->stipple.stipple[i])); @@ -324,7 +327,7 @@ nv50_state_validate(struct nv50_context *nv50) goto scissor_uptodate; nv50->state.scissor_enabled = rast->scissor; - so = so_new(3, 0); + so = so_new(1, 2, 0); so_method(so, tesla, NV50TCL_SCISSOR_HORIZ(0), 2); if (nv50->state.scissor_enabled) { so_data(so, (s->maxx << 16) | s->minx); @@ -353,7 +356,7 @@ scissor_uptodate: goto viewport_uptodate; nv50->state.viewport_bypass = bypass; - so = so_new(14, 0); + so = so_new(5, 9, 0); if (!bypass) { so_method(so, tesla, NV50TCL_VIEWPORT_TRANSLATE_X(0), 3); so_data (so, fui(nv50->viewport.translate[0])); @@ -397,7 +400,8 @@ viewport_uptodate: for (i = 0; i < PIPE_SHADER_TYPES; ++i) nr += nv50->sampler_nr[i]; - so = so_new(nr * 8 + 24 * PIPE_SHADER_TYPES + 2, 4); + so = so_new(1+ 5 * PIPE_SHADER_TYPES, 1+ 19 * PIPE_SHADER_TYPES + + nr * 8, PIPE_SHADER_TYPES * 2); nv50_validate_samplers(nv50, so, PIPE_SHADER_VERTEX); nv50_validate_samplers(nv50, so, PIPE_SHADER_FRAGMENT); diff --git a/src/gallium/drivers/nv50/nv50_tex.c b/src/gallium/drivers/nv50/nv50_tex.c index c4ca096d6a..bef548b728 100644 --- a/src/gallium/drivers/nv50/nv50_tex.c +++ b/src/gallium/drivers/nv50/nv50_tex.c @@ -199,16 +199,18 @@ nv50_tex_validate(struct nv50_context *nv50) { struct nouveau_stateobj *so; struct nouveau_grobj *tesla = nv50->screen->tesla; - unsigned p, push, nrlc; + unsigned p, start, push, nrlc; - for (nrlc = 0, push = 0, p = 0; p < PIPE_SHADER_TYPES; ++p) { + for (nrlc = 0, start = 0, push = 0, p = 0; p < PIPE_SHADER_TYPES; ++p) { + start += MAX2(nv50->miptree_nr[p], nv50->state.miptree_nr[p]); push += MAX2(nv50->miptree_nr[p], nv50->state.miptree_nr[p]); nrlc += nv50->miptree_nr[p]; } - push = push * 11 + 23 * PIPE_SHADER_TYPES + 4; + start = start * 2 + 4 * PIPE_SHADER_TYPES + 2; + push = push * 9 + 19 * PIPE_SHADER_TYPES + 2; nrlc = nrlc * 2 + 2 * PIPE_SHADER_TYPES; - so = so_new(push, nrlc); + so = so_new(start, push, nrlc); if (nv50_validate_textures(nv50, so, PIPE_SHADER_VERTEX) == FALSE || nv50_validate_textures(nv50, so, PIPE_SHADER_FRAGMENT) == FALSE) { diff --git a/src/gallium/drivers/nv50/nv50_vbo.c b/src/gallium/drivers/nv50/nv50_vbo.c index 602adfc50d..f2e510fba6 100644 --- a/src/gallium/drivers/nv50/nv50_vbo.c +++ b/src/gallium/drivers/nv50/nv50_vbo.c @@ -152,7 +152,7 @@ nv50_vbo_vtxelt_to_hw(struct pipe_vertex_element *ve) return (hw_type | hw_size); } -boolean +void nv50_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { @@ -182,7 +182,9 @@ nv50_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, BEGIN_RING(chan, tesla, NV50TCL_VERTEX_END, 1); OUT_RING (chan, 0); - return ret; + /* XXX: not sure what to do if ret != TRUE: flush and retry? + */ + assert(ret); } static INLINE boolean @@ -275,7 +277,7 @@ nv50_draw_elements_inline_u32(struct nv50_context *nv50, uint32_t *map, return TRUE; } -boolean +void nv50_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) @@ -317,8 +319,10 @@ nv50_draw_elements(struct pipe_context *pipe, OUT_RING (chan, 0); pipe_buffer_unmap(pscreen, indexBuffer); - - return ret; + + /* XXX: what to do if ret != TRUE? Flush and retry? + */ + assert(ret); } static INLINE boolean @@ -350,7 +354,7 @@ nv50_vbo_static_attrib(struct nv50_context *nv50, unsigned attrib, so = *pso; if (!so) - *pso = so = so_new(nv50->vtxelt_nr * 5, 0); + *pso = so = so_new(nv50->vtxelt_nr, nv50->vtxelt_nr * 4, 0); switch (ve->nr_components) { case 4: @@ -411,8 +415,8 @@ nv50_vbo_validate(struct nv50_context *nv50) n_ve = MAX2(nv50->vtxelt_nr, nv50->state.vtxelt_nr); vtxattr = NULL; - vtxbuf = so_new(n_ve * 7, nv50->vtxelt_nr * 4); - vtxfmt = so_new(n_ve + 1, 0); + vtxbuf = so_new(n_ve * 2, n_ve * 5, nv50->vtxelt_nr * 4); + vtxfmt = so_new(1, n_ve, 0); so_method(vtxfmt, tesla, NV50TCL_VERTEX_ARRAY_ATTRIB(0), n_ve); for (i = 0; i < nv50->vtxelt_nr; i++) { diff --git a/src/gallium/drivers/r300/r300_blit.c b/src/gallium/drivers/r300/r300_blit.c index ffe066d536..c14414fff6 100644 --- a/src/gallium/drivers/r300/r300_blit.c +++ b/src/gallium/drivers/r300/r300_blit.c @@ -27,9 +27,9 @@ static void r300_blitter_save_states(struct r300_context* r300) { - util_blitter_save_blend(r300->blitter, r300->blend_state); - util_blitter_save_depth_stencil_alpha(r300->blitter, r300->dsa_state); - util_blitter_save_rasterizer(r300->blitter, r300->rs_state); + util_blitter_save_blend(r300->blitter, r300->blend_state.state); + util_blitter_save_depth_stencil_alpha(r300->blitter, r300->dsa_state.state); + util_blitter_save_rasterizer(r300->blitter, r300->rs_state.state); util_blitter_save_fragment_shader(r300->blitter, r300->fs); util_blitter_save_vertex_shader(r300->blitter, r300->vs); } diff --git a/src/gallium/drivers/r300/r300_context.c b/src/gallium/drivers/r300/r300_context.c index d5c2d63d39..af95bbe789 100644 --- a/src/gallium/drivers/r300/r300_context.c +++ b/src/gallium/drivers/r300/r300_context.c @@ -30,6 +30,7 @@ #include "r300_blit.h" #include "r300_context.h" +#include "r300_emit.h" #include "r300_flush.h" #include "r300_query.h" #include "r300_render.h" @@ -69,11 +70,13 @@ static void r300_destroy_context(struct pipe_context* context) FREE(query); } - FREE(r300->blend_color_state); + FREE(r300->blend_color_state.state); + FREE(r300->clip_state.state); FREE(r300->rs_block); - FREE(r300->scissor_state); + FREE(r300->scissor_state.state); FREE(r300->vertex_info); - FREE(r300->viewport_state); + FREE(r300->viewport_state.state); + FREE(r300->ztop_state.state); FREE(r300); } @@ -107,6 +110,25 @@ static void r300_flush_cb(void *data) cs_context_copy->context.flush(&cs_context_copy->context, 0, NULL); } +#define R300_INIT_ATOM(name) \ + r300->name##_state.state = NULL; \ + r300->name##_state.emit = r300_emit_##name##_state; \ + r300->name##_state.dirty = FALSE; \ + insert_at_tail(&r300->atom_list, &r300->name##_state); + +static void r300_setup_atoms(struct r300_context* r300) +{ + make_empty_list(&r300->atom_list); + R300_INIT_ATOM(ztop); + R300_INIT_ATOM(blend); + R300_INIT_ATOM(blend_color); + R300_INIT_ATOM(clip); + R300_INIT_ATOM(dsa); + R300_INIT_ATOM(rs); + R300_INIT_ATOM(scissor); + R300_INIT_ATOM(viewport); +} + struct pipe_context* r300_create_context(struct pipe_screen* screen, struct radeon_winsys* radeon_winsys) { @@ -155,11 +177,15 @@ struct pipe_context* r300_create_context(struct pipe_screen* screen, r300->shader_hash_table = util_hash_table_create(r300_shader_key_hash, r300_shader_key_compare); - r300->blend_color_state = CALLOC_STRUCT(r300_blend_color_state); + r300_setup_atoms(r300); + + r300->blend_color_state.state = CALLOC_STRUCT(r300_blend_color_state); + r300->clip_state.state = CALLOC_STRUCT(pipe_clip_state); r300->rs_block = CALLOC_STRUCT(r300_rs_block); - r300->scissor_state = CALLOC_STRUCT(r300_scissor_state); + r300->scissor_state.state = CALLOC_STRUCT(r300_scissor_state); r300->vertex_info = CALLOC_STRUCT(r300_vertex_info); - r300->viewport_state = CALLOC_STRUCT(r300_viewport_state); + r300->viewport_state.state = CALLOC_STRUCT(r300_viewport_state); + r300->ztop_state.state = CALLOC_STRUCT(r300_ztop_state); /* Open up the OQ BO. */ r300->oqbo = screen->buffer_create(screen, 4096, diff --git a/src/gallium/drivers/r300/r300_context.h b/src/gallium/drivers/r300/r300_context.h index 232530b7dc..5937f0e2cc 100644 --- a/src/gallium/drivers/r300/r300_context.h +++ b/src/gallium/drivers/r300/r300_context.h @@ -30,9 +30,18 @@ #include "pipe/p_context.h" #include "pipe/p_inlines.h" +struct r300_context; + struct r300_fragment_shader; struct r300_vertex_shader; +struct r300_atom { + struct r300_atom *prev, *next; + void* state; + void (*emit)(struct r300_context*, void*); + boolean dirty; +}; + struct r300_blend_state { uint32_t blend_control; /* R300_RB3D_CBLEND: 0x4e04 */ uint32_t alpha_blend_control; /* R300_RB3D_ABLEND: 0x4e08 */ @@ -62,11 +71,6 @@ struct r300_rs_state { /* Draw-specific rasterizer state */ struct pipe_rasterizer_state rs; - /* Whether or not to enable the VTE. This is referenced at the very - * last moment during emission of VTE state, to decide whether or not - * the VTE should be used for transformation. */ - boolean enable_vte; - uint32_t vap_control_status; /* R300_VAP_CNTL_STATUS: 0x2140 */ uint32_t point_size; /* R300_GA_POINT_SIZE: 0x421c */ uint32_t point_minmax; /* R300_GA_POINT_MINMAX: 0x4230 */ @@ -105,9 +109,6 @@ struct r300_sampler_state { struct r300_scissor_regs { uint32_t top_left; /* R300_SC_SCISSORS_TL: 0x43e0 */ uint32_t bottom_right; /* R300_SC_SCISSORS_BR: 0x43e4 */ - - /* Whether everything is culled by scissoring. */ - boolean empty_area; }; struct r300_scissor_state { @@ -135,24 +136,17 @@ struct r300_ztop_state { uint32_t z_buffer_top; /* R300_ZB_ZTOP: 0x4f14 */ }; -#define R300_NEW_BLEND 0x00000001 -#define R300_NEW_BLEND_COLOR 0x00000002 -#define R300_NEW_CLIP 0x00000004 -#define R300_NEW_DSA 0x00000008 #define R300_NEW_FRAMEBUFFERS 0x00000010 #define R300_NEW_FRAGMENT_SHADER 0x00000020 #define R300_NEW_FRAGMENT_SHADER_CONSTANTS 0x00000040 -#define R300_NEW_RASTERIZER 0x00000080 #define R300_NEW_RS_BLOCK 0x00000100 #define R300_NEW_SAMPLER 0x00000200 #define R300_ANY_NEW_SAMPLERS 0x0001fe00 -#define R300_NEW_SCISSOR 0x00020000 #define R300_NEW_TEXTURE 0x00040000 #define R300_ANY_NEW_TEXTURES 0x03fc0000 #define R300_NEW_VERTEX_FORMAT 0x04000000 #define R300_NEW_VERTEX_SHADER 0x08000000 #define R300_NEW_VERTEX_SHADER_CONSTANTS 0x10000000 -#define R300_NEW_VIEWPORT 0x20000000 #define R300_NEW_QUERY 0x40000000 #define R300_NEW_KITCHEN_SINK 0x7fffffff @@ -273,38 +267,40 @@ struct r300_context { struct r300_vertex_info* vertex_info; /* Various CSO state objects. */ + /* Beginning of atom list. */ + struct r300_atom atom_list; /* Blend state. */ - struct r300_blend_state* blend_state; + struct r300_atom blend_state; /* Blend color state. */ - struct r300_blend_color_state* blend_color_state; + struct r300_atom blend_color_state; /* User clip planes. */ - struct pipe_clip_state clip_state; + struct r300_atom clip_state; /* Shader constants. */ struct r300_constant_buffer shader_constants[PIPE_SHADER_TYPES]; /* Depth, stencil, and alpha state. */ - struct r300_dsa_state* dsa_state; + struct r300_atom dsa_state; /* Fragment shader. */ struct r300_fragment_shader* fs; /* Framebuffer state. We currently don't need our own version of this. */ struct pipe_framebuffer_state framebuffer_state; /* Rasterizer state. */ - struct r300_rs_state* rs_state; + struct r300_atom rs_state; /* RS block state. */ struct r300_rs_block* rs_block; /* Sampler states. */ struct r300_sampler_state* sampler_states[8]; int sampler_count; /* Scissor state. */ - struct r300_scissor_state* scissor_state; + struct r300_atom scissor_state; /* Texture states. */ struct r300_texture* textures[8]; int texture_count; /* Vertex shader. */ struct r300_vertex_shader* vs; /* Viewport state. */ - struct r300_viewport_state* viewport_state; + struct r300_atom viewport_state; /* ZTOP state. */ - struct r300_ztop_state ztop_state; + struct r300_atom ztop_state; /* Vertex buffers for Gallium. */ struct pipe_vertex_buffer vertex_buffer[PIPE_MAX_ATTRIBS]; @@ -317,6 +313,8 @@ struct r300_context { uint32_t dirty_state; /* Flag indicating whether or not the HW is dirty. */ uint32_t dirty_hw; + /* Whether the TCL engine should be in bypass mode. */ + boolean tcl_bypass; /** Combination of DBG_xxx flags */ unsigned debug; diff --git a/src/gallium/drivers/r300/r300_emit.c b/src/gallium/drivers/r300/r300_emit.c index 199ce3a945..0e5533c790 100644 --- a/src/gallium/drivers/r300/r300_emit.c +++ b/src/gallium/drivers/r300/r300_emit.c @@ -25,6 +25,7 @@ #include "util/u_format.h" #include "util/u_math.h" +#include "util/u_simple_list.h" #include "r300_context.h" #include "r300_cs.h" @@ -36,11 +37,12 @@ #include "r300_texture.h" #include "r300_vs.h" -void r300_emit_blend_state(struct r300_context* r300, - struct r300_blend_state* blend) +void r300_emit_blend_state(struct r300_context* r300, void* state) { + struct r300_blend_state* blend = (struct r300_blend_state*)state; CS_LOCALS(r300); BEGIN_CS(8); + OUT_CS_REG(R300_RB3D_ROPCNTL, blend->rop); OUT_CS_REG_SEQ(R300_RB3D_CBLEND, 3); if (r300->framebuffer_state.nr_cbufs) { OUT_CS(blend->blend_control); @@ -52,14 +54,13 @@ void r300_emit_blend_state(struct r300_context* r300, OUT_CS(0); /* XXX also disable fastfill here once it's supported */ } - OUT_CS_REG(R300_RB3D_ROPCNTL, blend->rop); OUT_CS_REG(R300_RB3D_DITHER_CTL, blend->dither); END_CS; } -void r300_emit_blend_color_state(struct r300_context* r300, - struct r300_blend_color_state* bc) +void r300_emit_blend_color_state(struct r300_context* r300, void* state) { + struct r300_blend_color_state* bc = (struct r300_blend_color_state*)state; struct r300_screen* r300screen = r300_screen(r300->context.screen); CS_LOCALS(r300); @@ -76,9 +77,9 @@ void r300_emit_blend_color_state(struct r300_context* r300, } } -void r300_emit_clip_state(struct r300_context* r300, - struct pipe_clip_state* clip) +void r300_emit_clip_state(struct r300_context* r300, void* state) { + struct pipe_clip_state* clip = (struct pipe_clip_state*)state; int i; struct r300_screen* r300screen = r300_screen(r300->context.screen); CS_LOCALS(r300); @@ -106,13 +107,13 @@ void r300_emit_clip_state(struct r300_context* r300, } -void r300_emit_dsa_state(struct r300_context* r300, - struct r300_dsa_state* dsa) +void r300_emit_dsa_state(struct r300_context* r300, void* state) { + struct r300_dsa_state* dsa = (struct r300_dsa_state*)state; struct r300_screen* r300screen = r300_screen(r300->context.screen); CS_LOCALS(r300); - BEGIN_CS(r300screen->caps->is_r500 ? 10 : 8); + BEGIN_CS(r300screen->caps->is_r500 ? 8 : 6); OUT_CS_REG(R300_FG_ALPHA_FUNC, dsa->alpha_function); /* not needed since we use the 8bit alpha ref */ @@ -121,10 +122,16 @@ void r300_emit_dsa_state(struct r300_context* r300, }*/ OUT_CS_REG_SEQ(R300_ZB_CNTL, 3); - OUT_CS(dsa->z_buffer_control); - OUT_CS(dsa->z_stencil_control); + + if (r300->framebuffer_state.zsbuf) { + OUT_CS(dsa->z_buffer_control); + OUT_CS(dsa->z_stencil_control); + } else { + OUT_CS(0); + OUT_CS(0); + } + OUT_CS(dsa->stencil_ref_mask); - OUT_CS_REG(R300_ZB_ZTOP, r300->ztop_state.z_buffer_top); /* XXX it seems r3xx doesn't support STENCILREFMASK_BF */ if (r300screen->caps->is_r500) { @@ -138,6 +145,8 @@ static const float * get_shader_constant( struct rc_constant * constant, struct r300_constant_buffer * externals) { + struct r300_viewport_state* viewport = + (struct r300_viewport_state*)r300->viewport_state.state; static float vec[4] = { 0.0, 0.0, 0.0, 1.0 }; struct pipe_texture *tex; @@ -160,11 +169,31 @@ static const float * get_shader_constant( /* Texture compare-fail value. */ /* XXX Since Gallium doesn't support GL_ARB_shadow_ambient, - * this is always (0,0,0,0). */ + * this is always (0,0,0,0), right? */ case RC_STATE_SHADOW_AMBIENT: vec[3] = 0; break; + case RC_STATE_R300_VIEWPORT_SCALE: + if (r300->tcl_bypass) { + vec[0] = 1; + vec[1] = 1; + vec[2] = 1; + } else { + vec[0] = viewport->xscale; + vec[1] = viewport->yscale; + vec[2] = viewport->zscale; + } + break; + + case RC_STATE_R300_VIEWPORT_OFFSET: + if (!r300->tcl_bypass) { + vec[0] = viewport->xoffset; + vec[1] = viewport->yoffset; + vec[2] = viewport->zoffset; + } + break; + default: debug_printf("r300: Implementation error: " "Unknown RC_CONSTANT type %d\n", constant->u.State[0]); @@ -283,6 +312,22 @@ void r300_emit_fs_constant_buffer(struct r300_context* r300, END_CS; } +static void r300_emit_fragment_depth_config(struct r300_context* r300, + struct r300_fragment_shader* fs) +{ + CS_LOCALS(r300); + + BEGIN_CS(4); + if (r300_fragment_shader_writes_depth(fs)) { + OUT_CS_REG(R300_FG_DEPTH_SRC, R300_FG_DEPTH_SRC_SHADER); + OUT_CS_REG(R300_US_W_FMT, R300_W_FMT_W24 | R300_W_SRC_US); + } else { + OUT_CS_REG(R300_FG_DEPTH_SRC, R300_FG_DEPTH_SRC_SCAN); + OUT_CS_REG(R300_US_W_FMT, R300_W_FMT_W0 | R300_W_SRC_US); + } + END_CS; +} + void r500_emit_fragment_program_code(struct r300_context* r300, struct rX00_fragment_program_code* generic_code) { @@ -531,8 +576,9 @@ void r300_emit_query_end(struct r300_context* r300) r300_emit_query_finish(r300, query); } -void r300_emit_rs_state(struct r300_context* r300, struct r300_rs_state* rs) +void r300_emit_rs_state(struct r300_context* r300, void* state) { + struct r300_rs_state* rs = (struct r300_rs_state*)state; CS_LOCALS(r300); BEGIN_CS(22); @@ -607,10 +653,11 @@ static void r300_emit_scissor_regs(struct r300_context* r300, END_CS; } -void r300_emit_scissor_state(struct r300_context* r300, - struct r300_scissor_state* scissor) +void r300_emit_scissor_state(struct r300_context* r300, void* state) { - if (r300->rs_state->rs.scissor) { + struct r300_scissor_state* scissor = (struct r300_scissor_state*)state; + /* XXX argfl! */ + if (((struct r300_rs_state*)r300->rs_state.state)->rs.scissor) { r300_emit_scissor_regs(r300, &scissor->scissor); } else { r300_emit_scissor_regs(r300, &scissor->framebuffer); @@ -867,26 +914,27 @@ void r300_emit_vs_constant_buffer(struct r300_context* r300, END_CS; } -void r300_emit_viewport_state(struct r300_context* r300, - struct r300_viewport_state* viewport) +void r300_emit_viewport_state(struct r300_context* r300, void* state) { + struct r300_viewport_state* viewport = (struct r300_viewport_state*)state; CS_LOCALS(r300); - BEGIN_CS(9); - OUT_CS_REG_SEQ(R300_SE_VPORT_XSCALE, 6); - OUT_CS_32F(viewport->xscale); - OUT_CS_32F(viewport->xoffset); - OUT_CS_32F(viewport->yscale); - OUT_CS_32F(viewport->yoffset); - OUT_CS_32F(viewport->zscale); - OUT_CS_32F(viewport->zoffset); - - if (r300->rs_state->enable_vte) { - OUT_CS_REG(R300_VAP_VTE_CNTL, viewport->vte_control); - } else { + if (r300->tcl_bypass) { + BEGIN_CS(2); OUT_CS_REG(R300_VAP_VTE_CNTL, 0); + END_CS; + } else { + BEGIN_CS(9); + OUT_CS_REG_SEQ(R300_SE_VPORT_XSCALE, 6); + OUT_CS_32F(viewport->xscale); + OUT_CS_32F(viewport->xoffset); + OUT_CS_32F(viewport->yscale); + OUT_CS_32F(viewport->yoffset); + OUT_CS_32F(viewport->zscale); + OUT_CS_32F(viewport->zoffset); + OUT_CS_REG(R300_VAP_VTE_CNTL, viewport->vte_control); + END_CS; } - END_CS; } void r300_emit_texture_count(struct r300_context* r300) @@ -910,6 +958,16 @@ void r300_emit_texture_count(struct r300_context* r300) } +void r300_emit_ztop_state(struct r300_context* r300, void* state) +{ + struct r300_ztop_state* ztop = (struct r300_ztop_state*)state; + CS_LOCALS(r300); + + BEGIN_CS(2); + OUT_CS_REG(R300_ZB_ZTOP, ztop->z_buffer_top); + END_CS; +} + void r300_flush_textures(struct r300_context* r300) { CS_LOCALS(r300); @@ -933,13 +991,10 @@ void r300_emit_dirty_state(struct r300_context* r300) { struct r300_screen* r300screen = r300_screen(r300->context.screen); struct r300_texture* tex; + struct r300_atom* atom; int i, dirty_tex = 0; boolean invalid = FALSE; - if (!(r300->dirty_state)) { - return; - } - /* Check size of CS. */ /* Make sure we have at least 8*1024 spare dwords. */ /* XXX It would be nice to know the number of dwords we really need to @@ -997,7 +1052,7 @@ validate: goto validate; } } else { - // debug_printf("No VBO while emitting dirty state!\n"); + /* debug_printf("No VBO while emitting dirty state!\n"); */ } if (!r300->winsys->validate(r300->winsys)) { r300->context.flush(&r300->context, 0, NULL); @@ -1015,27 +1070,15 @@ validate: r300->dirty_state &= ~R300_NEW_QUERY; } - if (r300->dirty_state & R300_NEW_BLEND) { - r300_emit_blend_state(r300, r300->blend_state); - r300->dirty_state &= ~R300_NEW_BLEND; - } - - if (r300->dirty_state & R300_NEW_BLEND_COLOR) { - r300_emit_blend_color_state(r300, r300->blend_color_state); - r300->dirty_state &= ~R300_NEW_BLEND_COLOR; - } - - if (r300->dirty_state & R300_NEW_CLIP) { - r300_emit_clip_state(r300, &r300->clip_state); - r300->dirty_state &= ~R300_NEW_CLIP; - } - - if (r300->dirty_state & R300_NEW_DSA) { - r300_emit_dsa_state(r300, r300->dsa_state); - r300->dirty_state &= ~R300_NEW_DSA; + foreach(atom, &r300->atom_list) { + if (atom->dirty) { + atom->emit(r300, atom->state); + atom->dirty = FALSE; + } } if (r300->dirty_state & R300_NEW_FRAGMENT_SHADER) { + r300_emit_fragment_depth_config(r300, r300->fs); if (r300screen->caps->is_r500) { r500_emit_fragment_program_code(r300, &r300->fs->shader->code); } else { @@ -1060,21 +1103,11 @@ validate: r300->dirty_state &= ~R300_NEW_FRAMEBUFFERS; } - if (r300->dirty_state & R300_NEW_RASTERIZER) { - r300_emit_rs_state(r300, r300->rs_state); - r300->dirty_state &= ~R300_NEW_RASTERIZER; - } - if (r300->dirty_state & R300_NEW_RS_BLOCK) { r300_emit_rs_block_state(r300, r300->rs_block); r300->dirty_state &= ~R300_NEW_RS_BLOCK; } - if (r300->dirty_state & R300_NEW_SCISSOR) { - r300_emit_scissor_state(r300, r300->scissor_state); - r300->dirty_state &= ~R300_NEW_SCISSOR; - } - /* Samplers and textures are tracked separately but emitted together. */ if (r300->dirty_state & (R300_ANY_NEW_SAMPLERS | R300_ANY_NEW_TEXTURES)) { @@ -1096,11 +1129,6 @@ validate: r300->dirty_state &= ~(R300_ANY_NEW_SAMPLERS | R300_ANY_NEW_TEXTURES); } - if (r300->dirty_state & R300_NEW_VIEWPORT) { - r300_emit_viewport_state(r300, r300->viewport_state); - r300->dirty_state &= ~R300_NEW_VIEWPORT; - } - if (dirty_tex) { r300_flush_textures(r300); } @@ -1129,7 +1157,7 @@ validate: */ /* Finally, emit the VBO. */ - //r300_emit_vertex_buffer(r300); + /* r300_emit_vertex_buffer(r300); */ r300->dirty_hw++; } diff --git a/src/gallium/drivers/r300/r300_emit.h b/src/gallium/drivers/r300/r300_emit.h index 3797d3d332..05a6bfeae8 100644 --- a/src/gallium/drivers/r300/r300_emit.h +++ b/src/gallium/drivers/r300/r300_emit.h @@ -31,17 +31,13 @@ struct r300_vertex_program_code; void r300_emit_aos(struct r300_context* r300, unsigned offset); -void r300_emit_blend_state(struct r300_context* r300, - struct r300_blend_state* blend); +void r300_emit_blend_state(struct r300_context* r300, void* state); -void r300_emit_blend_color_state(struct r300_context* r300, - struct r300_blend_color_state* bc); +void r300_emit_blend_color_state(struct r300_context* r300, void* state); -void r300_emit_clip_state(struct r300_context* r300, - struct pipe_clip_state* clip); +void r300_emit_clip_state(struct r300_context* r300, void* state); -void r300_emit_dsa_state(struct r300_context* r300, - struct r300_dsa_state* dsa); +void r300_emit_dsa_state(struct r300_context* r300, void* state); void r300_emit_fragment_program_code(struct r300_context* r300, struct rX00_fragment_program_code* generic_code); @@ -63,13 +59,12 @@ void r300_emit_query_begin(struct r300_context* r300, void r300_emit_query_end(struct r300_context* r300); -void r300_emit_rs_state(struct r300_context* r300, struct r300_rs_state* rs); +void r300_emit_rs_state(struct r300_context* r300, void* state); void r300_emit_rs_block_state(struct r300_context* r300, struct r300_rs_block* rs); -void r300_emit_scissor_state(struct r300_context* r300, - struct r300_scissor_state* scissor); +void r300_emit_scissor_state(struct r300_context* r300, void* state); void r300_emit_texture(struct r300_context* r300, struct r300_sampler_state* sampler, @@ -89,11 +84,12 @@ void r300_emit_vs_constant_buffer(struct r300_context* r300, void r300_emit_vertex_shader(struct r300_context* r300, struct r300_vertex_shader* vs); -void r300_emit_viewport_state(struct r300_context* r300, - struct r300_viewport_state* viewport); +void r300_emit_viewport_state(struct r300_context* r300, void* state); void r300_emit_texture_count(struct r300_context* r300); +void r300_emit_ztop_state(struct r300_context* r300, void* state); + void r300_flush_textures(struct r300_context* r300); /* Emit all dirty state. */ diff --git a/src/gallium/drivers/r300/r300_fs.c b/src/gallium/drivers/r300/r300_fs.c index 4e1b61ca40..60ea9c171d 100644 --- a/src/gallium/drivers/r300/r300_fs.c +++ b/src/gallium/drivers/r300/r300_fs.c @@ -63,6 +63,11 @@ void r300_shader_read_fs_inputs(struct tgsi_shader_info* info, fs_inputs->fog = i; break; + case TGSI_SEMANTIC_POSITION: + assert(index == 0); + fs_inputs->wpos = i; + break; + default: assert(0); } @@ -114,6 +119,9 @@ static void allocate_hardware_inputs( if (inputs->fog != ATTR_UNUSED) { allocate(mydata, inputs->fog, reg++); } + if (inputs->wpos != ATTR_UNUSED) { + allocate(mydata, inputs->wpos, reg++); + } } static void get_compare_state( @@ -144,6 +152,7 @@ static void r300_translate_fragment_shader( struct r300_fragment_shader* fs = r300->fs; struct r300_fragment_program_compiler compiler; struct tgsi_to_rc ttr; + int wpos = fs->inputs.wpos; /* Setup the compiler. */ memset(&compiler, 0, sizeof(compiler)); @@ -171,6 +180,18 @@ static void r300_translate_fragment_shader( fs->shadow_samplers = compiler.Base.Program.ShadowSamplers; + /** + * Transform the program to support WPOS. + * + * Introduce a small fragment at the start of the program that will be + * the only code that directly reads the WPOS input. + * All other code pieces that reference that input will be rewritten + * to read from a newly allocated temporary. */ + if (wpos != ATTR_UNUSED) { + /* Moving the input to some other reg is not really necessary. */ + rc_transform_fragment_wpos(&compiler.Base, wpos, wpos, TRUE); + } + /* Invoke the compiler */ r3xx_compile_fragment_program(&compiler); if (compiler.Base.Error) { diff --git a/src/gallium/drivers/r300/r300_reg.h b/src/gallium/drivers/r300/r300_reg.h index d8d08fbe26..034bfc15cf 100644 --- a/src/gallium/drivers/r300/r300_reg.h +++ b/src/gallium/drivers/r300/r300_reg.h @@ -2186,6 +2186,8 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. # define R300_DISCARD_SRC_PIXELS_SRC_ALPHA_1 (4 << 3) # define R300_DISCARD_SRC_PIXELS_SRC_COLOR_1 (5 << 3) # define R300_DISCARD_SRC_PIXELS_SRC_ALPHA_COLOR_1 (6 << 3) +# define R500_SRC_ALPHA_0_NO_READ (1 << 30) +# define R500_SRC_ALPHA_1_NO_READ (1 << 31) /* the following are shared between CBLEND and ABLEND */ # define R300_FCN_MASK (3 << 12) @@ -2638,7 +2640,7 @@ enum { VE_COND_MUX_GTE = 25, VE_SET_GREATER_THAN = 26, VE_SET_EQUAL = 27, - VE_SET_NOT_EQUAL = 28, + VE_SET_NOT_EQUAL = 28 }; enum { @@ -2672,20 +2674,20 @@ enum { ME_PRED_SET_CLR = 25, ME_PRED_SET_INV = 26, ME_PRED_SET_POP = 27, - ME_PRED_SET_RESTORE = 28, + ME_PRED_SET_RESTORE = 28 }; enum { /* R3XX */ PVS_MACRO_OP_2CLK_MADD = 0, - PVS_MACRO_OP_2CLK_M2X_ADD = 1, + PVS_MACRO_OP_2CLK_M2X_ADD = 1 }; enum { PVS_SRC_REG_TEMPORARY = 0, /* Intermediate Storage */ PVS_SRC_REG_INPUT = 1, /* Input Vertex Storage */ PVS_SRC_REG_CONSTANT = 2, /* Constant State Storage */ - PVS_SRC_REG_ALT_TEMPORARY = 3, /* Alternate Intermediate Storage */ + PVS_SRC_REG_ALT_TEMPORARY = 3 /* Alternate Intermediate Storage */ }; enum { @@ -2694,7 +2696,7 @@ enum { PVS_DST_REG_OUT = 2, /* Output Memory. Used for all outputs */ PVS_DST_REG_OUT_REPL_X = 3, /* Output Memory & Replicate X to all channels */ PVS_DST_REG_ALT_TEMPORARY = 4, /* Alternate Intermediate Storage */ - PVS_DST_REG_INPUT = 5, /* Output Memory & Replicate X to all channels */ + PVS_DST_REG_INPUT = 5 /* Output Memory & Replicate X to all channels */ }; enum { @@ -2703,7 +2705,7 @@ enum { PVS_SRC_SELECT_Z = 2, /* Select Z Component */ PVS_SRC_SELECT_W = 3, /* Select W Component */ PVS_SRC_SELECT_FORCE_0 = 4, /* Force Component to 0.0 */ - PVS_SRC_SELECT_FORCE_1 = 5, /* Force Component to 1.0 */ + PVS_SRC_SELECT_FORCE_1 = 5 /* Force Component to 1.0 */ }; /* PVS Opcode & Destination Operand Description */ @@ -2742,7 +2744,7 @@ enum { PVS_DST_ADDR_SEL_MASK = 0x3, PVS_DST_ADDR_SEL_SHIFT = 29, PVS_DST_ADDR_MODE_0_MASK = 0x1, - PVS_DST_ADDR_MODE_0_SHIFT = 31, + PVS_DST_ADDR_MODE_0_SHIFT = 31 }; /* PVS Source Operand Description */ @@ -2777,7 +2779,7 @@ enum { PVS_SRC_ADDR_SEL_MASK = 0x3, PVS_SRC_ADDR_SEL_SHIFT = 29, PVS_SRC_ADDR_MODE_1_MASK = 0x0, - PVS_SRC_ADDR_MODE_1_SHIFT = 32, + PVS_SRC_ADDR_MODE_1_SHIFT = 32 }; /*\}*/ diff --git a/src/gallium/drivers/r300/r300_render.c b/src/gallium/drivers/r300/r300_render.c index a89cb633e0..ee43421cdb 100644 --- a/src/gallium/drivers/r300/r300_render.c +++ b/src/gallium/drivers/r300/r300_render.c @@ -69,16 +69,11 @@ uint32_t r300_translate_primitive(unsigned prim) } } -static boolean r300_nothing_to_draw(struct r300_context *r300) -{ - return r300->rs_state->rs.scissor && - r300->scissor_state->scissor.empty_area; -} - static uint32_t r300_provoking_vertex_fixes(struct r300_context *r300, unsigned mode) { - uint32_t color_control = r300->rs_state->color_control; + struct r300_rs_state* rs = (struct r300_rs_state*)r300->rs_state.state; + uint32_t color_control = rs->color_control; /* By default (see r300_state.c:r300_create_rs_state) color_control is * initialized to provoking the first vertex. @@ -98,7 +93,7 @@ static uint32_t r300_provoking_vertex_fixes(struct r300_context *r300, * ~ C. */ - if (r300->rs_state->rs.flatshade_first) { + if (rs->rs.flatshade_first) { switch (mode) { case PIPE_PRIM_TRIANGLE_FAN: color_control |= R300_GA_COLOR_CONTROL_PROVOKING_VERTEX_SECOND; @@ -213,7 +208,7 @@ validate: } /* This is the fast-path drawing & emission for HW TCL. */ -boolean r300_draw_range_elements(struct pipe_context* pipe, +void r300_draw_range_elements(struct pipe_context* pipe, struct pipe_buffer* indexBuffer, unsigned indexSize, unsigned minIndex, @@ -225,30 +220,29 @@ boolean r300_draw_range_elements(struct pipe_context* pipe, struct r300_context* r300 = r300_context(pipe); if (!u_trim_pipe_prim(mode, &count)) { - return FALSE; + return; } if (count > 65535) { - return FALSE; - } - - if (r300_nothing_to_draw(r300)) { - return TRUE; + /* XXX: use aux/indices functions to split this into smaller + * primitives. + */ + return; } r300_update_derived_state(r300); if (!r300_setup_vertex_buffers(r300)) { - return FALSE; + return; } if (!r300->winsys->add_buffer(r300->winsys, indexBuffer, RADEON_GEM_DOMAIN_GTT, 0)) { - return FALSE; + return; } if (!r300->winsys->validate(r300->winsys)) { - return FALSE; + return; } r300_emit_dirty_state(r300); @@ -257,41 +251,38 @@ boolean r300_draw_range_elements(struct pipe_context* pipe, r300_emit_draw_elements(r300, indexBuffer, indexSize, minIndex, maxIndex, mode, start, count); - - return TRUE; } /* Simple helpers for context setup. Should probably be moved to util. */ -boolean r300_draw_elements(struct pipe_context* pipe, - struct pipe_buffer* indexBuffer, - unsigned indexSize, unsigned mode, - unsigned start, unsigned count) +void r300_draw_elements(struct pipe_context* pipe, + struct pipe_buffer* indexBuffer, + unsigned indexSize, unsigned mode, + unsigned start, unsigned count) { - return pipe->draw_range_elements(pipe, indexBuffer, indexSize, 0, ~0, - mode, start, count); + pipe->draw_range_elements(pipe, indexBuffer, indexSize, 0, ~0, + mode, start, count); } -boolean r300_draw_arrays(struct pipe_context* pipe, unsigned mode, +void r300_draw_arrays(struct pipe_context* pipe, unsigned mode, unsigned start, unsigned count) { struct r300_context* r300 = r300_context(pipe); if (!u_trim_pipe_prim(mode, &count)) { - return FALSE; + return; } if (count > 65535) { - return FALSE; - } - - if (r300_nothing_to_draw(r300)) { - return TRUE; + /* XXX: driver needs to handle this -- use the functions in + * aux/indices to split this into several smaller primitives. + */ + return; } r300_update_derived_state(r300); if (!r300_setup_vertex_buffers(r300)) { - return FALSE; + return; } r300_emit_dirty_state(r300); @@ -299,8 +290,6 @@ boolean r300_draw_arrays(struct pipe_context* pipe, unsigned mode, r300_emit_aos(r300, start); r300_emit_draw_arrays(r300, mode, count); - - return TRUE; } /**************************************************************************** @@ -309,7 +298,7 @@ boolean r300_draw_arrays(struct pipe_context* pipe, unsigned mode, ***************************************************************************/ /* SW TCL arrays, using Draw. */ -boolean r300_swtcl_draw_arrays(struct pipe_context* pipe, +void r300_swtcl_draw_arrays(struct pipe_context* pipe, unsigned mode, unsigned start, unsigned count) @@ -318,11 +307,7 @@ boolean r300_swtcl_draw_arrays(struct pipe_context* pipe, int i; if (!u_trim_pipe_prim(mode, &count)) { - return FALSE; - } - - if (r300_nothing_to_draw(r300)) { - return TRUE; + return; } for (i = 0; i < r300->vertex_buffer_count; i++) { @@ -346,12 +331,10 @@ boolean r300_swtcl_draw_arrays(struct pipe_context* pipe, pipe_buffer_unmap(pipe->screen, r300->vertex_buffer[i].buffer); draw_set_mapped_vertex_buffer(r300->draw, i, NULL); } - - return TRUE; } /* SW TCL elements, using Draw. */ -boolean r300_swtcl_draw_range_elements(struct pipe_context* pipe, +void r300_swtcl_draw_range_elements(struct pipe_context* pipe, struct pipe_buffer* indexBuffer, unsigned indexSize, unsigned minIndex, @@ -365,11 +348,7 @@ boolean r300_swtcl_draw_range_elements(struct pipe_context* pipe, void* indices; if (!u_trim_pipe_prim(mode, &count)) { - return FALSE; - } - - if (r300_nothing_to_draw(r300)) { - return TRUE; + return; } for (i = 0; i < r300->vertex_buffer_count; i++) { @@ -400,8 +379,6 @@ boolean r300_swtcl_draw_range_elements(struct pipe_context* pipe, pipe_buffer_unmap(pipe->screen, indexBuffer); draw_set_mapped_element_buffer_range(r300->draw, 0, start, start + count - 1, NULL); - - return TRUE; } /* Object for rendering using Draw. */ diff --git a/src/gallium/drivers/r300/r300_render.h b/src/gallium/drivers/r300/r300_render.h index da83069083..27b5e6a963 100644 --- a/src/gallium/drivers/r300/r300_render.h +++ b/src/gallium/drivers/r300/r300_render.h @@ -25,35 +25,35 @@ uint32_t r300_translate_primitive(unsigned prim); -boolean r300_draw_range_elements(struct pipe_context* pipe, - struct pipe_buffer* indexBuffer, - unsigned indexSize, - unsigned minIndex, - unsigned maxIndex, - unsigned mode, - unsigned start, - unsigned count); +void r300_draw_range_elements(struct pipe_context* pipe, + struct pipe_buffer* indexBuffer, + unsigned indexSize, + unsigned minIndex, + unsigned maxIndex, + unsigned mode, + unsigned start, + unsigned count); -boolean r300_draw_elements(struct pipe_context* pipe, - struct pipe_buffer* indexBuffer, - unsigned indexSize, unsigned mode, - unsigned start, unsigned count); +void r300_draw_elements(struct pipe_context* pipe, + struct pipe_buffer* indexBuffer, + unsigned indexSize, unsigned mode, + unsigned start, unsigned count); -boolean r300_draw_arrays(struct pipe_context* pipe, unsigned mode, - unsigned start, unsigned count); +void r300_draw_arrays(struct pipe_context* pipe, unsigned mode, + unsigned start, unsigned count); -boolean r300_swtcl_draw_arrays(struct pipe_context* pipe, - unsigned mode, - unsigned start, - unsigned count); +void r300_swtcl_draw_arrays(struct pipe_context* pipe, + unsigned mode, + unsigned start, + unsigned count); -boolean r300_swtcl_draw_range_elements(struct pipe_context* pipe, - struct pipe_buffer* indexBuffer, - unsigned indexSize, - unsigned minIndex, - unsigned maxIndex, - unsigned mode, - unsigned start, - unsigned count); +void r300_swtcl_draw_range_elements(struct pipe_context* pipe, + struct pipe_buffer* indexBuffer, + unsigned indexSize, + unsigned minIndex, + unsigned maxIndex, + unsigned mode, + unsigned start, + unsigned count); #endif /* R300_RENDER_H */ diff --git a/src/gallium/drivers/r300/r300_screen.c b/src/gallium/drivers/r300/r300_screen.c index 2a8667d483..287664b1d2 100644 --- a/src/gallium/drivers/r300/r300_screen.c +++ b/src/gallium/drivers/r300/r300_screen.c @@ -83,6 +83,7 @@ static int r300_get_param(struct pipe_screen* pscreen, int param) switch (param) { case PIPE_CAP_MAX_TEXTURE_IMAGE_UNITS: + case PIPE_CAP_MAX_COMBINED_SAMPLERS: /* XXX I'm told this goes up to 16 */ return 8; case PIPE_CAP_NPOT_TEXTURES: @@ -143,9 +144,11 @@ static int r300_get_param(struct pipe_screen* pscreen, int param) case PIPE_CAP_BLEND_EQUATION_SEPARATE: return 1; case PIPE_CAP_SM3: - return 1; - case PIPE_CAP_MAX_COMBINED_SAMPLERS: - return 8; + if (r300screen->caps->is_r500) { + return 1; + } else { + return 0; + } default: debug_printf("r300: Implementation error: Bad param %d\n", param); diff --git a/src/gallium/drivers/r300/r300_shader_semantics.h b/src/gallium/drivers/r300/r300_shader_semantics.h index 85184e2cfd..6796841b29 100644 --- a/src/gallium/drivers/r300/r300_shader_semantics.h +++ b/src/gallium/drivers/r300/r300_shader_semantics.h @@ -40,6 +40,7 @@ struct r300_shader_semantics { int bcolor[ATTR_COLOR_COUNT]; int generic[ATTR_GENERIC_COUNT]; int fog; + int wpos; }; static INLINE void r300_shader_semantics_reset( @@ -50,6 +51,7 @@ static INLINE void r300_shader_semantics_reset( info->pos = ATTR_UNUSED; info->psize = ATTR_UNUSED; info->fog = ATTR_UNUSED; + info->wpos = ATTR_UNUSED; for (i = 0; i < ATTR_COLOR_COUNT; i++) { info->color[i] = ATTR_UNUSED; diff --git a/src/gallium/drivers/r300/r300_state.c b/src/gallium/drivers/r300/r300_state.c index 49072462ec..78764ddc98 100644 --- a/src/gallium/drivers/r300/r300_state.c +++ b/src/gallium/drivers/r300/r300_state.c @@ -1,5 +1,6 @@ /* * Copyright 2008 Corbin Simpson <MostAwesomeDude@gmail.com> + * Copyright 2009 Marek Olšák <maraeo@gmail.com> * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the "Software"), @@ -41,6 +42,120 @@ /* r300_state: Functions used to intialize state context by translating * Gallium state objects into semi-native r300 state objects. */ +static boolean blend_discard_if_src_alpha_0(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_ALPHA == 0, and the following state is set, the colorbuffer + * will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_SRC_ALPHA || + srcRGB == PIPE_BLENDFACTOR_SRC_ALPHA_SATURATE || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_SRC_COLOR || + srcA == PIPE_BLENDFACTOR_SRC_ALPHA || + srcA == PIPE_BLENDFACTOR_SRC_ALPHA_SATURATE || + srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_INV_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ONE); +} + +static boolean blend_discard_if_src_alpha_1(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_ALPHA == 1, and the following state is set, the colorbuffer + * will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_INV_SRC_COLOR || + srcA == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ONE); +} + +static boolean blend_discard_if_src_color_0(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_COLOR == (0,0,0), and the following state is set, the colorbuffer + * will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_SRC_COLOR || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_INV_SRC_COLOR || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_ONE); +} + +static boolean blend_discard_if_src_color_1(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_COLOR == (1,1,1), and the following state is set, the colorbuffer + * will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_INV_SRC_COLOR || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_SRC_COLOR || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_ONE); +} + +static boolean blend_discard_if_src_alpha_color_0(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_ALPHA_COLOR == (0,0,0,0), and the following state is set, + * the colorbuffer will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_SRC_COLOR || + srcRGB == PIPE_BLENDFACTOR_SRC_ALPHA || + srcRGB == PIPE_BLENDFACTOR_SRC_ALPHA_SATURATE || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_SRC_COLOR || + srcA == PIPE_BLENDFACTOR_SRC_ALPHA || + srcA == PIPE_BLENDFACTOR_SRC_ALPHA_SATURATE || + srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_INV_SRC_COLOR || + dstRGB == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_INV_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ONE); +} + +static boolean blend_discard_if_src_alpha_color_1(unsigned srcRGB, unsigned srcA, + unsigned dstRGB, unsigned dstA) +{ + /* If the blend equation is ADD or REVERSE_SUBTRACT, + * SRC_ALPHA_COLOR == (1,1,1,1), and the following state is set, + * the colorbuffer will not be changed. + * Notice that the dst factors are the src factors inverted. */ + return (srcRGB == PIPE_BLENDFACTOR_INV_SRC_COLOR || + srcRGB == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + srcRGB == PIPE_BLENDFACTOR_ZERO) && + (srcA == PIPE_BLENDFACTOR_INV_SRC_COLOR || + srcA == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + srcA == PIPE_BLENDFACTOR_ZERO) && + (dstRGB == PIPE_BLENDFACTOR_SRC_COLOR || + dstRGB == PIPE_BLENDFACTOR_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ONE) && + (dstA == PIPE_BLENDFACTOR_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ONE); +} + /* Create a new blend state based on the CSO blend state. * * This encompasses alpha blending, logic/raster ops, and blend dithering. */ @@ -66,7 +181,11 @@ static void* r300_create_blend_state(struct pipe_context* pipe, ( r300_translate_blend_factor(srcRGB) << R300_SRC_BLEND_SHIFT) | ( r300_translate_blend_factor(dstRGB) << R300_DST_BLEND_SHIFT); - /* optimization: some operations do not require the destination color */ + /* Optimization: some operations do not require the destination color. + * + * When SRC_ALPHA_SATURATE is used, colorbuffer reads must be enabled, + * otherwise blending gives incorrect results. It seems to be + * a hardware bug. */ if (eqRGB == PIPE_BLEND_MIN || eqA == PIPE_BLEND_MIN || eqRGB == PIPE_BLEND_MAX || eqA == PIPE_BLEND_MAX || dstRGB != PIPE_BLENDFACTOR_ZERO || @@ -78,11 +197,81 @@ static void* r300_create_blend_state(struct pipe_context* pipe, srcA == PIPE_BLENDFACTOR_DST_COLOR || srcA == PIPE_BLENDFACTOR_DST_ALPHA || srcA == PIPE_BLENDFACTOR_INV_DST_COLOR || - srcA == PIPE_BLENDFACTOR_INV_DST_ALPHA) + srcA == PIPE_BLENDFACTOR_INV_DST_ALPHA || + srcRGB == PIPE_BLENDFACTOR_SRC_ALPHA_SATURATE) { + /* Enable reading from the colorbuffer. */ blend->blend_control |= R300_READ_ENABLE; - /* XXX implement the optimization with DISCARD_SRC_PIXELS*/ - /* XXX implement the optimization with SRC_ALPHA_?_NO_READ */ + if (r300_screen(r300_context(pipe)->context.screen)->caps->is_r500) { + /* Optimization: Depending on incoming pixels, we can + * conditionally disable the reading in hardware... */ + if (eqRGB != PIPE_BLEND_MIN && eqA != PIPE_BLEND_MIN && + eqRGB != PIPE_BLEND_MAX && eqA != PIPE_BLEND_MAX) { + /* Disable reading if SRC_ALPHA == 0. */ + if ((dstRGB == PIPE_BLENDFACTOR_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ZERO) && + (dstA == PIPE_BLENDFACTOR_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ZERO)) { + blend->blend_control |= R500_SRC_ALPHA_0_NO_READ; + } + + /* Disable reading if SRC_ALPHA == 1. */ + if ((dstRGB == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstRGB == PIPE_BLENDFACTOR_ZERO) && + (dstA == PIPE_BLENDFACTOR_INV_SRC_COLOR || + dstA == PIPE_BLENDFACTOR_INV_SRC_ALPHA || + dstA == PIPE_BLENDFACTOR_ZERO)) { + blend->blend_control |= R500_SRC_ALPHA_1_NO_READ; + } + } + } + } + + /* Optimization: discard pixels which don't change the colorbuffer. + * + * The code below is non-trivial and some math is involved. + * + * Discarding pixels must be disabled when FP16 AA is enabled. + * This is a hardware bug. Also, this implementation wouldn't work + * with FP blending enabled and equation clamping disabled. + * + * Equations other than ADD are rarely used and therefore won't be + * optimized. */ + if ((eqRGB == PIPE_BLEND_ADD || eqRGB == PIPE_BLEND_REVERSE_SUBTRACT) && + (eqA == PIPE_BLEND_ADD || eqA == PIPE_BLEND_REVERSE_SUBTRACT)) { + /* ADD: X+Y + * REVERSE_SUBTRACT: Y-X + * + * The idea is: + * If X = src*srcFactor = 0 and Y = dst*dstFactor = 1, + * then CB will not be changed. + * + * Given the srcFactor and dstFactor variables, we can derive + * what src and dst should be equal to and discard appropriate + * pixels. + */ + if (blend_discard_if_src_alpha_0(srcRGB, srcA, dstRGB, dstA)) { + blend->blend_control |= R300_DISCARD_SRC_PIXELS_SRC_ALPHA_0; + } else if (blend_discard_if_src_alpha_1(srcRGB, srcA, + dstRGB, dstA)) { + blend->blend_control |= R300_DISCARD_SRC_PIXELS_SRC_ALPHA_1; + } else if (blend_discard_if_src_color_0(srcRGB, srcA, + dstRGB, dstA)) { + blend->blend_control |= R300_DISCARD_SRC_PIXELS_SRC_COLOR_0; + } else if (blend_discard_if_src_color_1(srcRGB, srcA, + dstRGB, dstA)) { + blend->blend_control |= R300_DISCARD_SRC_PIXELS_SRC_COLOR_1; + } else if (blend_discard_if_src_alpha_color_0(srcRGB, srcA, + dstRGB, dstA)) { + blend->blend_control |= + R300_DISCARD_SRC_PIXELS_SRC_ALPHA_COLOR_0; + } else if (blend_discard_if_src_alpha_color_1(srcRGB, srcA, + dstRGB, dstA)) { + blend->blend_control |= + R300_DISCARD_SRC_PIXELS_SRC_ALPHA_COLOR_1; + } + } /* separate alpha */ if (srcA != srcRGB || dstA != dstRGB || eqA != eqRGB) { @@ -128,8 +317,8 @@ static void r300_bind_blend_state(struct pipe_context* pipe, { struct r300_context* r300 = r300_context(pipe); - r300->blend_state = (struct r300_blend_state*)state; - r300->dirty_state |= R300_NEW_BLEND; + r300->blend_state.state = state; + r300->blend_state.dirty = TRUE; } /* Free blend state. */ @@ -151,20 +340,22 @@ static void r300_set_blend_color(struct pipe_context* pipe, const struct pipe_blend_color* color) { struct r300_context* r300 = r300_context(pipe); + struct r300_blend_color_state* state = + (struct r300_blend_color_state*)r300->blend_color_state.state; union util_color uc; util_pack_color(color->color, PIPE_FORMAT_A8R8G8B8_UNORM, &uc); - r300->blend_color_state->blend_color = uc.ui; + state->blend_color = uc.ui; /* XXX if FP16 blending is enabled, we should use the FP16 format */ - r300->blend_color_state->blend_color_red_alpha = + state->blend_color_red_alpha = float_to_fixed10(color->color[0]) | (float_to_fixed10(color->color[3]) << 16); - r300->blend_color_state->blend_color_green_blue = + state->blend_color_green_blue = float_to_fixed10(color->color[2]) | (float_to_fixed10(color->color[1]) << 16); - r300->dirty_state |= R300_NEW_BLEND_COLOR; + r300->blend_color_state.dirty = TRUE; } static void r300_set_clip_state(struct pipe_context* pipe, @@ -173,8 +364,8 @@ static void r300_set_clip_state(struct pipe_context* pipe, struct r300_context* r300 = r300_context(pipe); if (r300_screen(pipe->screen)->caps->has_tcl) { - r300->clip_state = *state; - r300->dirty_state |= R300_NEW_CLIP; + memcpy(r300->clip_state.state, state, sizeof(struct pipe_clip_state)); + r300->clip_state.dirty = TRUE; } else { draw_flush(r300->draw); draw_set_clip_state(r300->draw, state); @@ -272,8 +463,8 @@ static void r300_bind_dsa_state(struct pipe_context* pipe, { struct r300_context* r300 = r300_context(pipe); - r300->dsa_state = (struct r300_dsa_state*)state; - r300->dirty_state |= R300_NEW_DSA; + r300->dsa_state.state = state; + r300->dsa_state.dirty = TRUE; } /* Free DSA state. */ @@ -303,9 +494,6 @@ static void r300_set_scissor_regs(const struct pipe_scissor_state* state, (((state->maxx - 1) + 1440) << R300_SCISSORS_X_SHIFT) | (((state->maxy - 1) + 1440) << R300_SCISSORS_Y_SHIFT); } - - scissor->empty_area = state->minx >= state->maxx || - state->miny >= state->maxy; } static void @@ -313,7 +501,9 @@ static void const struct pipe_framebuffer_state* state) { struct r300_context* r300 = r300_context(pipe); - struct pipe_scissor_state scissor; + struct r300_scissor_state* scissor = + (struct r300_scissor_state*)r300->scissor_state.state; + struct pipe_scissor_state pscissor; if (r300->draw) { draw_flush(r300->draw); @@ -321,18 +511,19 @@ static void r300->framebuffer_state = *state; - scissor.minx = scissor.miny = 0; - scissor.maxx = state->width; - scissor.maxy = state->height; - r300_set_scissor_regs(&scissor, &r300->scissor_state->framebuffer, + /* XXX Arg. This is silly. */ + pscissor.minx = pscissor.miny = 0; + pscissor.maxx = state->width; + pscissor.maxy = state->height; + r300_set_scissor_regs(&pscissor, &scissor->framebuffer, r300_screen(r300->context.screen)->caps->is_r500); /* Don't rely on the order of states being set for the first time. */ - if (!r300->rs_state || !r300->rs_state->rs.scissor) { - r300->dirty_state |= R300_NEW_SCISSOR; - } r300->dirty_state |= R300_NEW_FRAMEBUFFERS; - r300->dirty_state |= R300_NEW_BLEND; + + r300->blend_state.dirty = TRUE; + r300->dsa_state.dirty = TRUE; + r300->scissor_state.dirty = TRUE; } /* Create fragment shader state. */ @@ -367,6 +558,10 @@ static void r300_bind_fs_state(struct pipe_context* pipe, void* shader) r300->fs = fs; r300_pick_fragment_shader(r300); + if (r300->vs && r300_vertex_shader_setup_wpos(r300)) { + r300->dirty_state |= R300_NEW_VERTEX_FORMAT; + } + r300->dirty_state |= R300_NEW_FRAGMENT_SHADER | R300_NEW_FRAGMENT_SHADER_CONSTANTS; } @@ -407,8 +602,6 @@ static void* r300_create_rs_state(struct pipe_context* pipe, /* Copy rasterizer state for Draw. */ rs->rs = *state; - rs->enable_vte = !state->bypass_vs_clip_and_viewport; - #ifdef PIPE_ARCH_LITTLE_ENDIAN rs->vap_control_status = R300_VC_NO_SWAP; #else @@ -524,12 +717,19 @@ static void r300_bind_rs_state(struct pipe_context* pipe, void* state) draw_set_rasterizer_state(r300->draw, &rs->rs); } - r300->rs_state = rs; + r300->tcl_bypass = rs->rs.bypass_vs_clip_and_viewport; + + r300->rs_state.state = rs; + r300->rs_state.dirty = TRUE; + /* XXX Why is this still needed, dammit!? */ + r300->scissor_state.dirty = TRUE; + r300->viewport_state.dirty = TRUE; + /* XXX Clean these up when we move to atom emits */ - r300->dirty_state |= R300_NEW_RASTERIZER; r300->dirty_state |= R300_NEW_RS_BLOCK; - r300->dirty_state |= R300_NEW_SCISSOR; - r300->dirty_state |= R300_NEW_VIEWPORT; + if (r300->fs && r300->fs->inputs.wpos != ATTR_UNUSED) { + r300->dirty_state |= R300_NEW_FRAGMENT_SHADER_CONSTANTS; + } } /* Free rasterizer state. */ @@ -556,7 +756,8 @@ static void* sampler->filter0 |= r300_translate_tex_filters(state->min_img_filter, state->mag_img_filter, - state->min_mip_filter); + state->min_mip_filter, + state->max_anisotropy > 1.0); /* Unfortunately, r300-r500 don't support floating-point mipmap lods. */ /* We must pass these to the emit function to clamp them properly. */ @@ -663,50 +864,54 @@ static void r300_set_scissor_state(struct pipe_context* pipe, const struct pipe_scissor_state* state) { struct r300_context* r300 = r300_context(pipe); + struct r300_scissor_state* scissor = + (struct r300_scissor_state*)r300->scissor_state.state; - r300_set_scissor_regs(state, &r300->scissor_state->scissor, + r300_set_scissor_regs(state, &scissor->scissor, r300_screen(r300->context.screen)->caps->is_r500); - /* Don't rely on the order of states being set for the first time. */ - if (!r300->rs_state || r300->rs_state->rs.scissor) { - r300->dirty_state |= R300_NEW_SCISSOR; - } + r300->scissor_state.dirty = TRUE; } static void r300_set_viewport_state(struct pipe_context* pipe, const struct pipe_viewport_state* state) { struct r300_context* r300 = r300_context(pipe); + struct r300_viewport_state* viewport = + (struct r300_viewport_state*)r300->viewport_state.state; /* Do the transform in HW. */ - r300->viewport_state->vte_control = R300_VTX_W0_FMT; + viewport->vte_control = R300_VTX_W0_FMT; if (state->scale[0] != 1.0f) { - r300->viewport_state->xscale = state->scale[0]; - r300->viewport_state->vte_control |= R300_VPORT_X_SCALE_ENA; + viewport->xscale = state->scale[0]; + viewport->vte_control |= R300_VPORT_X_SCALE_ENA; } if (state->scale[1] != 1.0f) { - r300->viewport_state->yscale = state->scale[1]; - r300->viewport_state->vte_control |= R300_VPORT_Y_SCALE_ENA; + viewport->yscale = state->scale[1]; + viewport->vte_control |= R300_VPORT_Y_SCALE_ENA; } if (state->scale[2] != 1.0f) { - r300->viewport_state->zscale = state->scale[2]; - r300->viewport_state->vte_control |= R300_VPORT_Z_SCALE_ENA; + viewport->zscale = state->scale[2]; + viewport->vte_control |= R300_VPORT_Z_SCALE_ENA; } if (state->translate[0] != 0.0f) { - r300->viewport_state->xoffset = state->translate[0]; - r300->viewport_state->vte_control |= R300_VPORT_X_OFFSET_ENA; + viewport->xoffset = state->translate[0]; + viewport->vte_control |= R300_VPORT_X_OFFSET_ENA; } if (state->translate[1] != 0.0f) { - r300->viewport_state->yoffset = state->translate[1]; - r300->viewport_state->vte_control |= R300_VPORT_Y_OFFSET_ENA; + viewport->yoffset = state->translate[1]; + viewport->vte_control |= R300_VPORT_Y_OFFSET_ENA; } if (state->translate[2] != 0.0f) { - r300->viewport_state->zoffset = state->translate[2]; - r300->viewport_state->vte_control |= R300_VPORT_Z_OFFSET_ENA; + viewport->zoffset = state->translate[2]; + viewport->vte_control |= R300_VPORT_Z_OFFSET_ENA; } - r300->dirty_state |= R300_NEW_VIEWPORT; + r300->viewport_state.dirty = TRUE; + if (r300->fs && r300->fs->inputs.wpos != ATTR_UNUSED) { + r300->dirty_state |= R300_NEW_FRAGMENT_SHADER_CONSTANTS; + } } static void r300_set_vertex_buffers(struct pipe_context* pipe, @@ -778,7 +983,13 @@ static void r300_bind_vs_state(struct pipe_context* pipe, void* shader) } r300->vs = vs; - r300->dirty_state |= R300_NEW_VERTEX_SHADER | R300_NEW_VERTEX_SHADER_CONSTANTS; + if (r300->fs) { + r300_vertex_shader_setup_wpos(r300); + } + + r300->dirty_state |= + R300_NEW_VERTEX_SHADER | R300_NEW_VERTEX_SHADER_CONSTANTS | + R300_NEW_VERTEX_FORMAT; } else { draw_flush(r300->draw); draw_bind_vertex_shader(r300->draw, diff --git a/src/gallium/drivers/r300/r300_state_derived.c b/src/gallium/drivers/r300/r300_state_derived.c index 727ae7ade6..192846411b 100644 --- a/src/gallium/drivers/r300/r300_state_derived.c +++ b/src/gallium/drivers/r300/r300_state_derived.c @@ -139,10 +139,10 @@ static void r300_vertex_psc(struct r300_context* r300) /* If TCL is bypassed, map vertex streams to equivalent VS output * locations. */ - if (r300->rs_state->enable_vte) { - stream_tab = identity; - } else { + if (r300->tcl_bypass) { stream_tab = r300->vs->stream_loc_notcl; + } else { + stream_tab = identity; } /* Vertex shaders have no semantics on their inputs, @@ -333,6 +333,8 @@ static void r300_update_rs_block(struct r300_context* r300, void (*rX00_rs_col_write)(struct r300_rs_block*, int, int); void (*rX00_rs_tex)(struct r300_rs_block*, int, int, boolean); void (*rX00_rs_tex_write)(struct r300_rs_block*, int, int); + boolean any_bcolor_used = vs_outputs->bcolor[0] != ATTR_UNUSED || + vs_outputs->bcolor[1] != ATTR_UNUSED; if (r300_screen(r300->context.screen)->caps->is_r500) { rX00_rs_col = r500_rs_col; @@ -348,7 +350,7 @@ static void r300_update_rs_block(struct r300_context* r300, /* Rasterize colors. */ for (i = 0; i < ATTR_COLOR_COUNT; i++) { - if (vs_outputs->color[i] != ATTR_UNUSED) { + if (vs_outputs->color[i] != ATTR_UNUSED || any_bcolor_used) { /* Always rasterize if it's written by the VS, * otherwise it locks up. */ rX00_rs_col(rs, col_count, i, FALSE); @@ -410,6 +412,16 @@ static void r300_update_rs_block(struct r300_context* r300, } } + /* Rasterize WPOS. */ + /* If the FS doesn't need it, it's not written by the VS. */ + if (fs_inputs->wpos != ATTR_UNUSED) { + rX00_rs_tex(rs, tex_count, tex_count, FALSE); + rX00_rs_tex_write(rs, tex_count, fp_offset); + + fp_offset++; + tex_count++; + } + /* Rasterize at least one color, or bad things happen. */ if (col_count == 0 && tex_count == 0) { rX00_rs_col(rs, 0, 0, TRUE); @@ -496,7 +508,8 @@ static boolean r300_dsa_alpha_test_enabled(struct r300_dsa_state* dsa) static void r300_update_ztop(struct r300_context* r300) { - r300->ztop_state.z_buffer_top = R300_ZTOP_ENABLE; + struct r300_ztop_state* ztop_state = + (struct r300_ztop_state*)r300->ztop_state.state; /* This is important enough that I felt it warranted a comment. * @@ -518,31 +531,37 @@ static void r300_update_ztop(struct r300_context* r300) * 5) Depth writes in fragment shader * 6) Outstanding occlusion queries * + * This register causes stalls all the way from SC to CB when changed, + * but it is buffered on-chip so it does not hurt to write it if it has + * not changed. + * * ~C. */ /* ZS writes */ - if (r300_dsa_writes_depth_stencil(r300->dsa_state) && - (r300_dsa_alpha_test_enabled(r300->dsa_state) || /* (1) */ - r300->fs->info.uses_kill)) { /* (2) */ - r300->ztop_state.z_buffer_top = R300_ZTOP_DISABLE; - } else if (r300_fragment_shader_writes_depth(r300->fs)) { /* (5) */ - r300->ztop_state.z_buffer_top = R300_ZTOP_DISABLE; - } else if (r300->query_current) { /* (6) */ - r300->ztop_state.z_buffer_top = R300_ZTOP_DISABLE; + if (r300_dsa_writes_depth_stencil(r300->dsa_state.state) && + (r300_dsa_alpha_test_enabled(r300->dsa_state.state) ||/* (1) */ + r300->fs->info.uses_kill)) { /* (2) */ + ztop_state->z_buffer_top = R300_ZTOP_DISABLE; + } else if (r300_fragment_shader_writes_depth(r300->fs)) { /* (5) */ + ztop_state->z_buffer_top = R300_ZTOP_DISABLE; + } else if (r300->query_current) { /* (6) */ + ztop_state->z_buffer_top = R300_ZTOP_DISABLE; + } else { + ztop_state->z_buffer_top = R300_ZTOP_ENABLE; } + + r300->ztop_state.dirty = TRUE; } void r300_update_derived_state(struct r300_context* r300) { + /* XXX */ if (r300->dirty_state & (R300_NEW_FRAGMENT_SHADER | R300_NEW_VERTEX_SHADER | - R300_NEW_VERTEX_FORMAT)) { + R300_NEW_VERTEX_FORMAT) || r300->rs_state.dirty) { r300_update_derived_shader_state(r300); } - if (r300->dirty_state & - (R300_NEW_DSA | R300_NEW_FRAGMENT_SHADER | R300_NEW_QUERY)) { - r300_update_ztop(r300); - } + r300_update_ztop(r300); } diff --git a/src/gallium/drivers/r300/r300_state_inlines.h b/src/gallium/drivers/r300/r300_state_inlines.h index dbe42edd91..35be00e1b0 100644 --- a/src/gallium/drivers/r300/r300_state_inlines.h +++ b/src/gallium/drivers/r300/r300_state_inlines.h @@ -257,38 +257,37 @@ static INLINE uint32_t r300_translate_wrap(int wrap) } } -static INLINE uint32_t r300_translate_tex_filters(int min, int mag, int mip) +static INLINE uint32_t r300_translate_tex_filters(int min, int mag, int mip, + int is_anisotropic) { uint32_t retval = 0; - switch (min) { + if (is_anisotropic) + retval |= R300_TX_MIN_FILTER_ANISO | R300_TX_MAG_FILTER_ANISO; + else { + switch (min) { case PIPE_TEX_FILTER_NEAREST: retval |= R300_TX_MIN_FILTER_NEAREST; break; case PIPE_TEX_FILTER_LINEAR: retval |= R300_TX_MIN_FILTER_LINEAR; break; - case PIPE_TEX_FILTER_ANISO: - retval |= R300_TX_MIN_FILTER_ANISO; - break; default: debug_printf("r300: Unknown texture filter %d\n", min); assert(0); break; - } - switch (mag) { + } + switch (mag) { case PIPE_TEX_FILTER_NEAREST: retval |= R300_TX_MAG_FILTER_NEAREST; break; case PIPE_TEX_FILTER_LINEAR: retval |= R300_TX_MAG_FILTER_LINEAR; break; - case PIPE_TEX_FILTER_ANISO: - retval |= R300_TX_MAG_FILTER_ANISO; - break; default: debug_printf("r300: Unknown texture filter %d\n", mag); assert(0); break; + } } switch (mip) { case PIPE_TEX_MIPFILTER_NONE: diff --git a/src/gallium/drivers/r300/r300_state_invariant.c b/src/gallium/drivers/r300/r300_state_invariant.c index bcd4c030f9..f25f3ca217 100644 --- a/src/gallium/drivers/r300/r300_state_invariant.c +++ b/src/gallium/drivers/r300/r300_state_invariant.c @@ -43,7 +43,7 @@ void r300_emit_invariant_state(struct r300_context* r300) struct r300_capabilities* caps = r300_screen(r300->context.screen)->caps; CS_LOCALS(r300); - BEGIN_CS(20 + (caps->has_tcl ? 2: 0)); + BEGIN_CS(16 + (caps->has_tcl ? 2: 0)); /*** Graphics Backend (GB) ***/ /* Various GB enables */ @@ -66,8 +66,6 @@ void r300_emit_invariant_state(struct r300_context* r300) OUT_CS_REG(R300_FG_FOG_COLOR_R, 0x0); OUT_CS_REG(R300_FG_FOG_COLOR_G, 0x0); OUT_CS_REG(R300_FG_FOG_COLOR_B, 0x0); - OUT_CS_REG(R300_FG_DEPTH_SRC, 0x0); - OUT_CS_REG(R300_US_W_FMT, 0x0); /*** VAP ***/ /* Sign/normalize control */ @@ -118,8 +116,8 @@ void r300_emit_invariant_state(struct r300_context* r300) OUT_CS_REG(R300_SC_EDGERULE, 0x2DA49525); OUT_CS_REG(R300_RB3D_AARESOLVE_CTL, 0x00000000); if (caps->is_r500) { - OUT_CS_REG(R500_RB3D_DISCARD_SRC_PIXEL_LTE_THRESHOLD, 0x00000000); - OUT_CS_REG(R500_RB3D_DISCARD_SRC_PIXEL_GTE_THRESHOLD, 0xFFFFFFFF); + OUT_CS_REG(R500_RB3D_DISCARD_SRC_PIXEL_LTE_THRESHOLD, 0x01010101); + OUT_CS_REG(R500_RB3D_DISCARD_SRC_PIXEL_GTE_THRESHOLD, 0xFEFEFEFE); } OUT_CS_REG(R300_ZB_BW_CNTL, 0x00000000); OUT_CS_REG(R300_ZB_DEPTHCLEARVALUE, 0x00000000); diff --git a/src/gallium/drivers/r300/r300_tgsi_to_rc.c b/src/gallium/drivers/r300/r300_tgsi_to_rc.c index 096cdb20bb..a792c2cf98 100644 --- a/src/gallium/drivers/r300/r300_tgsi_to_rc.c +++ b/src/gallium/drivers/r300/r300_tgsi_to_rc.c @@ -120,7 +120,7 @@ static unsigned translate_opcode(unsigned opcode) /* case TGSI_OPCODE_NOT: return RC_OPCODE_NOT; */ /* case TGSI_OPCODE_TRUNC: return RC_OPCODE_TRUNC; */ /* case TGSI_OPCODE_SHL: return RC_OPCODE_SHL; */ - /* case TGSI_OPCODE_SHR: return RC_OPCODE_SHR; */ + /* case TGSI_OPCODE_ISHR: return RC_OPCODE_SHR; */ /* case TGSI_OPCODE_AND: return RC_OPCODE_AND; */ /* case TGSI_OPCODE_OR: return RC_OPCODE_OR; */ /* case TGSI_OPCODE_MOD: return RC_OPCODE_MOD; */ diff --git a/src/gallium/drivers/r300/r300_vs.c b/src/gallium/drivers/r300/r300_vs.c index c4ed0d712f..68aef70872 100644 --- a/src/gallium/drivers/r300/r300_vs.c +++ b/src/gallium/drivers/r300/r300_vs.c @@ -22,6 +22,7 @@ * USE OR OTHER DEALINGS IN THE SOFTWARE. */ #include "r300_vs.h" +#include "r300_fs.h" #include "r300_context.h" #include "r300_screen.h" @@ -33,6 +34,8 @@ #include "radeon_compiler.h" +#include "util/u_math.h" + /* Convert info about VS output semantics into r300_shader_semantics. */ static void r300_shader_read_vs_outputs( struct tgsi_shader_info* info, @@ -88,11 +91,13 @@ static void r300_shader_read_vs_outputs( } } -static void r300_shader_vap_output_fmt( - struct r300_shader_semantics* vs_outputs, - uint* hwfmt) +static void r300_shader_vap_output_fmt(struct r300_vertex_shader* vs) { + struct r300_shader_semantics* vs_outputs = &vs->outputs; + uint32_t* hwfmt = vs->hwfmt; int i, gen_count; + boolean any_bcolor_used = vs_outputs->bcolor[0] != ATTR_UNUSED || + vs_outputs->bcolor[1] != ATTR_UNUSED; /* Do the actual vertex_info setup. * @@ -119,13 +124,19 @@ static void r300_shader_vap_output_fmt( /* Colors. */ for (i = 0; i < ATTR_COLOR_COUNT; i++) { - if (vs_outputs->color[i] != ATTR_UNUSED) { + if (vs_outputs->color[i] != ATTR_UNUSED || any_bcolor_used) { hwfmt[1] |= R300_INPUT_CNTL_COLOR; hwfmt[2] |= R300_VAP_OUTPUT_VTX_FMT_0__COLOR_0_PRESENT << i; } } - /* XXX Back-face colors. */ + /* Back-face colors. */ + if (any_bcolor_used) { + for (i = 0; i < ATTR_COLOR_COUNT; i++) { + hwfmt[1] |= R300_INPUT_CNTL_COLOR; + hwfmt[2] |= R300_VAP_OUTPUT_VTX_FMT_0__COLOR_0_PRESENT << (2+i); + } + } /* Texture coordinates. */ gen_count = 0; @@ -146,6 +157,9 @@ static void r300_shader_vap_output_fmt( /* XXX magic */ assert(gen_count <= 8); + + /* WPOS. */ + vs->wpos_tex_output = gen_count; } /* Sets up stream mapping to equivalent VS outputs if TCL is bypassed @@ -155,6 +169,8 @@ static void r300_stream_locations_notcl( int* stream_loc) { int i, tabi = 0, gen_count; + boolean any_bcolor_used = vs_outputs->bcolor[0] != ATTR_UNUSED || + vs_outputs->bcolor[1] != ATTR_UNUSED; /* Position. */ stream_loc[tabi++] = 0; @@ -166,14 +182,14 @@ static void r300_stream_locations_notcl( /* Colors. */ for (i = 0; i < ATTR_COLOR_COUNT; i++) { - if (vs_outputs->color[i] != ATTR_UNUSED) { + if (vs_outputs->color[i] != ATTR_UNUSED || any_bcolor_used) { stream_loc[tabi++] = 2 + i; } } /* Back-face colors. */ - for (i = 0; i < ATTR_COLOR_COUNT; i++) { - if (vs_outputs->bcolor[i] != ATTR_UNUSED) { + if (any_bcolor_used) { + for (i = 0; i < ATTR_COLOR_COUNT; i++) { stream_loc[tabi++] = 4 + i; } } @@ -181,7 +197,7 @@ static void r300_stream_locations_notcl( /* Texture coordinates. */ gen_count = 0; for (i = 0; i < ATTR_GENERIC_COUNT; i++) { - if (vs_outputs->bcolor[i] != ATTR_UNUSED) { + if (vs_outputs->generic[i] != ATTR_UNUSED) { assert(tabi < 16); stream_loc[tabi++] = 6 + gen_count; gen_count++; @@ -195,8 +211,12 @@ static void r300_stream_locations_notcl( gen_count++; } - /* XXX magic */ - assert(gen_count <= 8); + /* WPOS. */ + if (vs_outputs->wpos != ATTR_UNUSED) { + assert(tabi < 16); + stream_loc[tabi++] = 6 + gen_count; + gen_count++; + } for (; tabi < 16;) { stream_loc[tabi++] = -1; @@ -209,6 +229,8 @@ static void set_vertex_inputs_outputs(struct r300_vertex_program_compiler * c) struct r300_shader_semantics* outputs = &vs->outputs; struct tgsi_shader_info* info = &vs->info; int i, reg = 0; + boolean any_bcolor_used = outputs->bcolor[0] != ATTR_UNUSED || + outputs->bcolor[1] != ATTR_UNUSED; /* Fill in the input mapping */ for (i = 0; i < info->num_inputs; i++) @@ -226,14 +248,30 @@ static void set_vertex_inputs_outputs(struct r300_vertex_program_compiler * c) c->code->outputs[outputs->psize] = reg++; } + /* If we're writing back facing colors we need to send + * four colors to make front/back face colors selection work. + * If the vertex program doesn't write all 4 colors, lets + * pretend it does by skipping output index reg so the colors + * get written into appropriate output vectors. + */ + /* Colors. */ for (i = 0; i < ATTR_COLOR_COUNT; i++) { if (outputs->color[i] != ATTR_UNUSED) { c->code->outputs[outputs->color[i]] = reg++; + } else if (any_bcolor_used) { + reg++; } } - /* XXX Back-face colors. */ + /* Back-face colors. */ + for (i = 0; i < ATTR_COLOR_COUNT; i++) { + if (outputs->bcolor[i] != ATTR_UNUSED) { + c->code->outputs[outputs->bcolor[i]] = reg++; + } else if (any_bcolor_used) { + reg++; + } + } /* Texture coordinates. */ for (i = 0; i < ATTR_GENERIC_COUNT; i++) { @@ -246,6 +284,33 @@ static void set_vertex_inputs_outputs(struct r300_vertex_program_compiler * c) if (outputs->fog != ATTR_UNUSED) { c->code->outputs[outputs->fog] = reg++; } + + /* WPOS. */ + if (outputs->wpos != ATTR_UNUSED) { + c->code->outputs[outputs->wpos] = reg++; + } +} + +static void r300_insert_wpos(struct r300_vertex_program_compiler* c, + struct r300_shader_semantics* outputs) +{ + int i, lastOutput = 0; + + /* Find the max output index. */ + lastOutput = MAX2(lastOutput, outputs->psize); + for (i = 0; i < ATTR_COLOR_COUNT; i++) { + lastOutput = MAX2(lastOutput, outputs->color[i]); + lastOutput = MAX2(lastOutput, outputs->bcolor[i]); + } + for (i = 0; i < ATTR_GENERIC_COUNT; i++) { + lastOutput = MAX2(lastOutput, outputs->generic[i]); + } + lastOutput = MAX2(lastOutput, outputs->fog); + + /* Set WPOS after the last output. */ + lastOutput++; + rc_copy_output(&c->Base, 0, lastOutput); /* out[lastOutput] = out[0]; */ + outputs->wpos = lastOutput; } void r300_translate_vertex_shader(struct r300_context* r300, @@ -256,8 +321,6 @@ void r300_translate_vertex_shader(struct r300_context* r300, /* Initialize. */ r300_shader_read_vs_outputs(&vs->info, &vs->outputs); - r300_shader_vap_output_fmt(&vs->outputs, vs->hwfmt); - r300_stream_locations_notcl(&vs->outputs, vs->stream_loc_notcl); /* Setup the compiler */ rc_init(&compiler.Base); @@ -277,9 +340,15 @@ void r300_translate_vertex_shader(struct r300_context* r300, r300_tgsi_to_rc(&ttr, vs->state.tokens); - compiler.RequiredOutputs = ~(~0 << vs->info.num_outputs); + compiler.RequiredOutputs = ~(~0 << (vs->info.num_outputs+1)); compiler.SetHwInputOutput = &set_vertex_inputs_outputs; + /* Insert the WPOS output. */ + r300_insert_wpos(&compiler, &vs->outputs); + + r300_shader_vap_output_fmt(vs); + r300_stream_locations_notcl(&vs->outputs, vs->stream_loc_notcl); + /* Invoke the compiler */ r3xx_compile_vertex_program(&compiler); if (compiler.Base.Error) { @@ -292,3 +361,30 @@ void r300_translate_vertex_shader(struct r300_context* r300, rc_destroy(&compiler.Base); vs->translated = TRUE; } + +boolean r300_vertex_shader_setup_wpos(struct r300_context* r300) +{ + struct r300_vertex_shader* vs = r300->vs; + int tex_output = r300->vs->wpos_tex_output; + uint32_t tex_fmt = R300_INPUT_CNTL_TC0 << tex_output; + uint32_t* hwfmt = vs->hwfmt; + + if (r300->fs->inputs.wpos != ATTR_UNUSED) { + /* Enable WPOS in VAP. */ + if (!(hwfmt[1] & tex_fmt)) { + hwfmt[1] |= tex_fmt; + hwfmt[3] |= (4 << (3 * tex_output)); + + assert(tex_output < 8); + return TRUE; + } + } else { + /* Disable WPOS in VAP. */ + if (hwfmt[1] & tex_fmt) { + hwfmt[1] &= ~tex_fmt; + hwfmt[3] &= ~(4 << (3 * tex_output)); + return TRUE; + } + } + return FALSE; +} diff --git a/src/gallium/drivers/r300/r300_vs.h b/src/gallium/drivers/r300/r300_vs.h index 67e9db5366..18cfeee3cd 100644 --- a/src/gallium/drivers/r300/r300_vs.h +++ b/src/gallium/drivers/r300/r300_vs.h @@ -43,6 +43,9 @@ struct r300_vertex_shader { /* Stream locations for SWTCL or if TCL is bypassed. */ int stream_loc_notcl[16]; + /* Output stream location for WPOS. */ + int wpos_tex_output; + /* Has this shader been translated yet? */ boolean translated; @@ -53,4 +56,7 @@ struct r300_vertex_shader { void r300_translate_vertex_shader(struct r300_context* r300, struct r300_vertex_shader* vs); +/* Return TRUE if VAP (hwfmt) needs to be re-emitted. */ +boolean r300_vertex_shader_setup_wpos(struct r300_context* r300); + #endif /* R300_VS_H */ diff --git a/src/gallium/drivers/softpipe/sp_clear.c b/src/gallium/drivers/softpipe/sp_clear.c index f98087deb8..5f130453c3 100644 --- a/src/gallium/drivers/softpipe/sp_clear.c +++ b/src/gallium/drivers/softpipe/sp_clear.c @@ -36,6 +36,7 @@ #include "util/u_pack_color.h" #include "sp_clear.h" #include "sp_context.h" +#include "sp_query.h" #include "sp_tile_cache.h" @@ -55,6 +56,9 @@ softpipe_clear(struct pipe_context *pipe, unsigned buffers, const float *rgba, if (softpipe->no_rast) return; + if (!softpipe_check_render_cond(softpipe)) + return; + #if 0 softpipe_update_derived(softpipe); /* not needed?? */ #endif diff --git a/src/gallium/drivers/softpipe/sp_context.c b/src/gallium/drivers/softpipe/sp_context.c index 82173a3c2a..f3ac6760db 100644 --- a/src/gallium/drivers/softpipe/sp_context.c +++ b/src/gallium/drivers/softpipe/sp_context.c @@ -176,6 +176,19 @@ softpipe_is_buffer_referenced( struct pipe_context *pipe, } +static void +softpipe_render_condition( struct pipe_context *pipe, + struct pipe_query *query, + uint mode ) +{ + struct softpipe_context *softpipe = softpipe_context( pipe ); + + softpipe->render_cond_query = query; + softpipe->render_cond_mode = mode; +} + + + struct pipe_context * softpipe_create( struct pipe_screen *screen ) { @@ -252,6 +265,8 @@ softpipe_create( struct pipe_screen *screen ) softpipe_init_query_funcs( softpipe ); + softpipe->pipe.render_condition = softpipe_render_condition; + /* * Alloc caches for accessing drawing surfaces and textures. * Must be before quad stage setup! diff --git a/src/gallium/drivers/softpipe/sp_context.h b/src/gallium/drivers/softpipe/sp_context.h index 6a89bd4b06..73fa744f9d 100644 --- a/src/gallium/drivers/softpipe/sp_context.h +++ b/src/gallium/drivers/softpipe/sp_context.h @@ -116,6 +116,10 @@ struct softpipe_context { unsigned line_stipple_counter; + /** Conditional query object and mode */ + struct pipe_query *render_cond_query; + uint render_cond_mode; + /** Software quad rendering pipeline */ struct { struct quad_stage *shade; diff --git a/src/gallium/drivers/softpipe/sp_draw_arrays.c b/src/gallium/drivers/softpipe/sp_draw_arrays.c index 9ea5d6fb9f..03d35fb3cb 100644 --- a/src/gallium/drivers/softpipe/sp_draw_arrays.c +++ b/src/gallium/drivers/softpipe/sp_draw_arrays.c @@ -38,6 +38,7 @@ #include "util/u_prim.h" #include "sp_context.h" +#include "sp_query.h" #include "sp_state.h" #include "draw/draw_context.h" @@ -97,11 +98,11 @@ softpipe_unmap_constant_buffers(struct softpipe_context *sp) } -boolean +void softpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, unsigned start, unsigned count) { - return softpipe_draw_elements(pipe, NULL, 0, mode, start, count); + softpipe_draw_elements(pipe, NULL, 0, mode, start, count); } @@ -110,7 +111,7 @@ softpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, * Basically, map the vertex buffers (and drawing surfaces), then hand off * the drawing to the 'draw' module. */ -boolean +void softpipe_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, @@ -122,6 +123,9 @@ softpipe_draw_range_elements(struct pipe_context *pipe, struct draw_context *draw = sp->draw; unsigned i; + if (!softpipe_check_render_cond(sp)) + return; + sp->reduced_api_prim = u_reduced_prim(mode); if (sp->dirty) @@ -177,19 +181,17 @@ softpipe_draw_range_elements(struct pipe_context *pipe, softpipe_unmap_constant_buffers(sp); sp->dirty_render_cache = TRUE; - - return TRUE; } -boolean +void softpipe_draw_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, unsigned mode, unsigned start, unsigned count) { - return softpipe_draw_range_elements( pipe, indexBuffer, - indexSize, - 0, 0xffffffff, - mode, start, count ); + softpipe_draw_range_elements( pipe, indexBuffer, + indexSize, + 0, 0xffffffff, + mode, start, count ); } diff --git a/src/gallium/drivers/softpipe/sp_query.c b/src/gallium/drivers/softpipe/sp_query.c index 379cf4ad06..4ef5d9f7b1 100644 --- a/src/gallium/drivers/softpipe/sp_query.c +++ b/src/gallium/drivers/softpipe/sp_query.c @@ -99,6 +99,32 @@ softpipe_get_query_result(struct pipe_context *pipe, } +/** + * Called by rendering function to check rendering is conditional. + * \return TRUE if we should render, FALSE if we should skip rendering + */ +boolean +softpipe_check_render_cond(struct softpipe_context *sp) +{ + struct pipe_context *pipe = &sp->pipe; + boolean b, wait; + uint64_t result; + + if (!sp->render_cond_query) { + return TRUE; /* no query predicate, draw normally */ + } + + wait = (sp->render_cond_mode == PIPE_RENDER_COND_WAIT || + sp->render_cond_mode == PIPE_RENDER_COND_BY_REGION_WAIT); + + b = pipe->get_query_result(pipe, sp->render_cond_query, wait, &result); + if (b) + return result > 0; + else + return TRUE; +} + + void softpipe_init_query_funcs(struct softpipe_context *softpipe ) { softpipe->pipe.create_query = softpipe_create_query; diff --git a/src/gallium/drivers/softpipe/sp_query.h b/src/gallium/drivers/softpipe/sp_query.h index 05060a4575..736c033897 100644 --- a/src/gallium/drivers/softpipe/sp_query.h +++ b/src/gallium/drivers/softpipe/sp_query.h @@ -32,6 +32,10 @@ #ifndef SP_QUERY_H #define SP_QUERY_H +extern boolean +softpipe_check_render_cond(struct softpipe_context *sp); + + struct softpipe_context; extern void softpipe_init_query_funcs(struct softpipe_context * ); diff --git a/src/gallium/drivers/softpipe/sp_state.h b/src/gallium/drivers/softpipe/sp_state.h index 5a32d211d6..9b18dac67b 100644 --- a/src/gallium/drivers/softpipe/sp_state.h +++ b/src/gallium/drivers/softpipe/sp_state.h @@ -184,14 +184,14 @@ void softpipe_set_vertex_buffers(struct pipe_context *, void softpipe_update_derived( struct softpipe_context *softpipe ); -boolean softpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, - unsigned start, unsigned count); +void softpipe_draw_arrays(struct pipe_context *pipe, unsigned mode, + unsigned start, unsigned count); -boolean softpipe_draw_elements(struct pipe_context *pipe, - struct pipe_buffer *indexBuffer, - unsigned indexSize, - unsigned mode, unsigned start, unsigned count); -boolean +void softpipe_draw_elements(struct pipe_context *pipe, + struct pipe_buffer *indexBuffer, + unsigned indexSize, + unsigned mode, unsigned start, unsigned count); +void softpipe_draw_range_elements(struct pipe_context *pipe, struct pipe_buffer *indexBuffer, unsigned indexSize, diff --git a/src/gallium/drivers/softpipe/sp_tex_sample.c b/src/gallium/drivers/softpipe/sp_tex_sample.c index e26153b1d9..1ae8fecacf 100644 --- a/src/gallium/drivers/softpipe/sp_tex_sample.c +++ b/src/gallium/drivers/softpipe/sp_tex_sample.c @@ -2,7 +2,7 @@ * * Copyright 2007 Tungsten Graphics, Inc., Cedar Park, Texas. * All Rights Reserved. - * Copyright 2008 VMware, Inc. All rights reserved. + * Copyright 2008-2010 VMware, Inc. All rights reserved. * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the @@ -514,21 +514,15 @@ static float compute_lambda_1d(const struct sp_sampler_varient *samp, const float s[QUAD_SIZE], const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias) + const float p[QUAD_SIZE]) { const struct pipe_texture *texture = samp->texture; const struct pipe_sampler_state *sampler = samp->sampler; float dsdx = fabsf(s[QUAD_BOTTOM_RIGHT] - s[QUAD_BOTTOM_LEFT]); float dsdy = fabsf(s[QUAD_TOP_LEFT] - s[QUAD_BOTTOM_LEFT]); float rho = MAX2(dsdx, dsdy) * texture->width0; - float lambda; - - lambda = util_fast_log2(rho); - lambda += lodbias + sampler->lod_bias; - lambda = CLAMP(lambda, sampler->min_lod, sampler->max_lod); - return lambda; + return util_fast_log2(rho); } @@ -536,8 +530,7 @@ static float compute_lambda_2d(const struct sp_sampler_varient *samp, const float s[QUAD_SIZE], const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias) + const float p[QUAD_SIZE]) { const struct pipe_texture *texture = samp->texture; const struct pipe_sampler_state *sampler = samp->sampler; @@ -548,13 +541,8 @@ compute_lambda_2d(const struct sp_sampler_varient *samp, float maxx = MAX2(dsdx, dsdy) * texture->width0; float maxy = MAX2(dtdx, dtdy) * texture->height0; float rho = MAX2(maxx, maxy); - float lambda; - lambda = util_fast_log2(rho); - lambda += lodbias + sampler->lod_bias; - lambda = CLAMP(lambda, sampler->min_lod, sampler->max_lod); - - return lambda; + return util_fast_log2(rho); } @@ -562,8 +550,7 @@ static float compute_lambda_3d(const struct sp_sampler_varient *samp, const float s[QUAD_SIZE], const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias) + const float p[QUAD_SIZE]) { const struct pipe_texture *texture = samp->texture; const struct pipe_sampler_state *sampler = samp->sampler; @@ -576,31 +563,26 @@ compute_lambda_3d(const struct sp_sampler_varient *samp, float maxx = MAX2(dsdx, dsdy) * texture->width0; float maxy = MAX2(dtdx, dtdy) * texture->height0; float maxz = MAX2(dpdx, dpdy) * texture->depth0; - float rho, lambda; + float rho; rho = MAX2(maxx, maxy); rho = MAX2(rho, maxz); - lambda = util_fast_log2(rho); - lambda += lodbias + sampler->lod_bias; - lambda = CLAMP(lambda, sampler->min_lod, sampler->max_lod); - - return lambda; + return util_fast_log2(rho); } /** * Compute lambda for a vertex texture sampler. - * Since there aren't derivatives to use, just return the LOD bias. + * Since there aren't derivatives to use, just return 0. */ static float compute_lambda_vert(const struct sp_sampler_varient *samp, const float s[QUAD_SIZE], const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias) + const float p[QUAD_SIZE]) { - return lodbias; + return 0.0f; } @@ -769,7 +751,8 @@ img_filter_2d_linear_repeat_POT(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -827,7 +810,8 @@ img_filter_2d_nearest_repeat_POT(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -866,7 +850,8 @@ img_filter_2d_nearest_clamp_POT(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -914,7 +899,8 @@ img_filter_1d_nearest(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -949,7 +935,8 @@ img_filter_2d_nearest(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -996,7 +983,8 @@ img_filter_cube_nearest(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1035,7 +1023,8 @@ img_filter_3d_nearest(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1076,7 +1065,8 @@ img_filter_1d_linear(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1115,7 +1105,8 @@ img_filter_2d_linear(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1161,7 +1152,8 @@ img_filter_cube_linear(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1209,7 +1201,8 @@ img_filter_3d_linear(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { const struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1261,29 +1254,60 @@ img_filter_3d_linear(struct tgsi_sampler *tgsi_sampler, } +/* Calculate level of detail for every fragment. + * Note that lambda has already been biased by global LOD bias. + */ +static INLINE void +compute_lod(const struct pipe_sampler_state *sampler, + const float biased_lambda, + const float lodbias[QUAD_SIZE], + float lod[QUAD_SIZE]) +{ + uint i; + + for (i = 0; i < QUAD_SIZE; i++) { + lod[i] = biased_lambda + lodbias[i]; + lod[i] = CLAMP(lod[i], sampler->min_lod, sampler->max_lod); + } +} + + static void mip_filter_linear(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); const struct pipe_texture *texture = samp->texture; int level0; float lambda; + float lod[QUAD_SIZE]; + + if (control == tgsi_sampler_lod_bias) { + lambda = samp->compute_lambda(samp, s, t, p) + samp->sampler->lod_bias; + compute_lod(samp->sampler, lambda, c0, lod); + } else { + assert(control == tgsi_sampler_lod_explicit); - lambda = samp->compute_lambda(samp, s, t, p, lodbias); + memcpy(lod, c0, sizeof(lod)); + } + + /* XXX: Take into account all lod values. + */ + lambda = lod[0]; level0 = (int)lambda; if (lambda < 0.0) { samp->level = 0; - samp->mag_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->mag_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } else if (level0 >= texture->last_level) { samp->level = texture->last_level; - samp->min_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->min_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } else { float levelBlend = lambda - level0; @@ -1292,10 +1316,10 @@ mip_filter_linear(struct tgsi_sampler *tgsi_sampler, int c,j; samp->level = level0; - samp->min_img_filter( tgsi_sampler, s, t, p, 0, rgba0 ); + samp->min_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba0); samp->level = level0+1; - samp->min_img_filter( tgsi_sampler, s, t, p, 0, rgba1 ); + samp->min_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba1); for (j = 0; j < QUAD_SIZE; j++) { for (c = 0; c < 4; c++) { @@ -1311,23 +1335,36 @@ mip_filter_nearest(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); const struct pipe_texture *texture = samp->texture; float lambda; + float lod[QUAD_SIZE]; - lambda = samp->compute_lambda(samp, s, t, p, lodbias); + if (control == tgsi_sampler_lod_bias) { + lambda = samp->compute_lambda(samp, s, t, p) + samp->sampler->lod_bias; + compute_lod(samp->sampler, lambda, c0, lod); + } else { + assert(control == tgsi_sampler_lod_explicit); + + memcpy(lod, c0, sizeof(lod)); + } + + /* XXX: Take into account all lod values. + */ + lambda = lod[0]; if (lambda < 0.0) { samp->level = 0; - samp->mag_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->mag_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } else { samp->level = (int)(lambda + 0.5) ; samp->level = MIN2(samp->level, (int)texture->last_level); - samp->min_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->min_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } #if 0 @@ -1345,17 +1382,32 @@ mip_filter_none(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); - float lambda = samp->compute_lambda(samp, s, t, p, lodbias); + float lambda; + float lod[QUAD_SIZE]; + + if (control == tgsi_sampler_lod_bias) { + lambda = samp->compute_lambda(samp, s, t, p) + samp->sampler->lod_bias; + compute_lod(samp->sampler, lambda, c0, lod); + } else { + assert(control == tgsi_sampler_lod_explicit); + + memcpy(lod, c0, sizeof(lod)); + } + + /* XXX: Take into account all lod values. + */ + lambda = lod[0]; if (lambda < 0.0) { - samp->mag_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->mag_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } else { - samp->min_img_filter( tgsi_sampler, s, t, p, 0, rgba ); + samp->min_img_filter(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } } @@ -1371,15 +1423,28 @@ mip_filter_linear_2d_linear_repeat_POT( const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); const struct pipe_texture *texture = samp->texture; int level0; float lambda; + float lod[QUAD_SIZE]; - lambda = compute_lambda_2d(samp, s, t, p, lodbias); + if (control == tgsi_sampler_lod_bias) { + lambda = samp->compute_lambda(samp, s, t, p) + samp->sampler->lod_bias; + compute_lod(samp->sampler, lambda, c0, lod); + } else { + assert(control == tgsi_sampler_lod_explicit); + + memcpy(lod, c0, sizeof(lod)); + } + + /* XXX: Take into account all lod values. + */ + lambda = lod[0]; level0 = (int)lambda; /* Catches both negative and large values of level0: @@ -1390,7 +1455,7 @@ mip_filter_linear_2d_linear_repeat_POT( else samp->level = texture->last_level; - img_filter_2d_linear_repeat_POT( tgsi_sampler, s, t, p, 0, rgba ); + img_filter_2d_linear_repeat_POT(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba); } else { float levelBlend = lambda - level0; @@ -1399,10 +1464,10 @@ mip_filter_linear_2d_linear_repeat_POT( int c,j; samp->level = level0; - img_filter_2d_linear_repeat_POT( tgsi_sampler, s, t, p, 0, rgba0 ); + img_filter_2d_linear_repeat_POT(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba0); samp->level = level0+1; - img_filter_2d_linear_repeat_POT( tgsi_sampler, s, t, p, 0, rgba1 ); + img_filter_2d_linear_repeat_POT(tgsi_sampler, s, t, p, NULL, tgsi_sampler_lod_bias, rgba1); for (j = 0; j < QUAD_SIZE; j++) { for (c = 0; c < 4; c++) { @@ -1422,7 +1487,8 @@ sample_compare(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1430,7 +1496,7 @@ sample_compare(struct tgsi_sampler *tgsi_sampler, int j, k0, k1, k2, k3; float val; - samp->mip_filter( tgsi_sampler, s, t, p, lodbias, rgba ); + samp->mip_filter(tgsi_sampler, s, t, p, c0, control, rgba); /** * Compare texcoord 'p' (aka R) against texture value 'rgba[0]' @@ -1508,7 +1574,8 @@ sample_cube(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]) { struct sp_sampler_varient *samp = sp_sampler_varient(tgsi_sampler); @@ -1589,7 +1656,7 @@ sample_cube(struct tgsi_sampler *tgsi_sampler, * is not active, this will point somewhere deeper into the * pipeline, eg. to mip_filter or even img_filter. */ - samp->compare(tgsi_sampler, ssss, tttt, NULL, lodbias, rgba); + samp->compare(tgsi_sampler, ssss, tttt, NULL, c0, control, rgba); } @@ -1862,7 +1929,7 @@ sp_create_sampler_varient( const struct pipe_sampler_state *sampler, break; } - if (sampler->compare_mode != FALSE) { + if (sampler->compare_mode != PIPE_TEX_COMPARE_NONE) { samp->compare = sample_compare; } else { diff --git a/src/gallium/drivers/softpipe/sp_tex_sample.h b/src/gallium/drivers/softpipe/sp_tex_sample.h index b0797711d3..b6e66c998a 100644 --- a/src/gallium/drivers/softpipe/sp_tex_sample.h +++ b/src/gallium/drivers/softpipe/sp_tex_sample.h @@ -2,6 +2,7 @@ * * Copyright 2007 Tungsten Graphics, Inc., Cedar Park, Texas. * All Rights Reserved. + * Copyright 2010 VMware, Inc. All rights reserved. * * Permission is hereby granted, free of charge, to any person obtaining a * copy of this software and associated documentation files (the @@ -46,14 +47,14 @@ typedef void (*wrap_linear_func)(const float s[4], typedef float (*compute_lambda_func)(const struct sp_sampler_varient *sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], - const float p[QUAD_SIZE], - float lodbias); + const float p[QUAD_SIZE]); typedef void (*filter_func)(struct tgsi_sampler *tgsi_sampler, const float s[QUAD_SIZE], const float t[QUAD_SIZE], const float p[QUAD_SIZE], - float lodbias, + const float c0[QUAD_SIZE], + enum tgsi_sampler_control control, float rgba[NUM_CHANNELS][QUAD_SIZE]); diff --git a/src/gallium/drivers/svga/svga_context.c b/src/gallium/drivers/svga/svga_context.c index c3de12b4a3..af99c9de37 100644 --- a/src/gallium/drivers/svga/svga_context.c +++ b/src/gallium/drivers/svga/svga_context.c @@ -29,6 +29,7 @@ #include "pipe/p_inlines.h" #include "pipe/p_screen.h" #include "util/u_memory.h" +#include "util/u_bitmask.h" #include "util/u_upload_mgr.h" #include "svga_context.h" @@ -61,6 +62,9 @@ static void svga_destroy( struct pipe_context *pipe ) u_upload_destroy( svga->upload_vb ); u_upload_destroy( svga->upload_ib ); + util_bitmask_destroy( svga->vs_bm ); + util_bitmask_destroy( svga->fs_bm ); + for(shader = 0; shader < PIPE_SHADER_TYPES; ++shader) pipe_buffer_reference( &svga->curr.cb[shader], NULL ); @@ -130,7 +134,7 @@ struct pipe_context *svga_context_create( struct pipe_screen *screen ) svga = CALLOC_STRUCT(svga_context); if (svga == NULL) - goto error1; + goto no_svga; svga->pipe.winsys = screen->winsys; svga->pipe.screen = screen; @@ -142,7 +146,7 @@ struct pipe_context *svga_context_create( struct pipe_screen *screen ) svga->swc = svgascreen->sws->context_create(svgascreen->sws); if(!svga->swc) - goto error2; + goto no_swc; svga_init_blend_functions(svga); svga_init_blit_functions(svga); @@ -165,32 +169,40 @@ struct pipe_context *svga_context_create( struct pipe_screen *screen ) svga->debug.disable_shader = debug_get_num_option("SVGA_DISABLE_SHADER", ~0); if (!svga_init_swtnl(svga)) - goto error3; + goto no_swtnl; + + svga->fs_bm = util_bitmask_create(); + if (svga->fs_bm == NULL) + goto no_fs_bm; + + svga->vs_bm = util_bitmask_create(); + if (svga->vs_bm == NULL) + goto no_vs_bm; svga->upload_ib = u_upload_create( svga->pipe.screen, 32 * 1024, 16, PIPE_BUFFER_USAGE_INDEX ); if (svga->upload_ib == NULL) - goto error4; + goto no_upload_ib; svga->upload_vb = u_upload_create( svga->pipe.screen, 128 * 1024, 16, PIPE_BUFFER_USAGE_VERTEX ); if (svga->upload_vb == NULL) - goto error5; + goto no_upload_vb; svga->hwtnl = svga_hwtnl_create( svga, svga->upload_ib, svga->swc ); if (svga->hwtnl == NULL) - goto error6; + goto no_hwtnl; ret = svga_emit_initial_state( svga ); if (ret) - goto error7; + goto no_state; /* Avoid shortcircuiting state with initial value of zero. */ @@ -209,19 +221,23 @@ struct pipe_context *svga_context_create( struct pipe_screen *screen ) return &svga->pipe; -error7: +no_state: svga_hwtnl_destroy( svga->hwtnl ); -error6: +no_hwtnl: u_upload_destroy( svga->upload_vb ); -error5: +no_upload_vb: u_upload_destroy( svga->upload_ib ); -error4: +no_upload_ib: + util_bitmask_destroy( svga->vs_bm ); +no_vs_bm: + util_bitmask_destroy( svga->fs_bm ); +no_fs_bm: svga_destroy_swtnl(svga); -error3: +no_swtnl: svga->swc->destroy(svga->swc); -error2: +no_swc: FREE(svga); -error1: +no_svga: return NULL; } diff --git a/src/gallium/drivers/svga/svga_context.h b/src/gallium/drivers/svga/svga_context.h index 0885d9ca74..66259fd010 100644 --- a/src/gallium/drivers/svga/svga_context.h +++ b/src/gallium/drivers/svga/svga_context.h @@ -41,6 +41,7 @@ struct draw_vertex_shader; struct svga_shader_result; struct SVGACmdMemory; +struct util_bitmask; struct u_upload_mgr; @@ -265,8 +266,6 @@ struct svga_hw_draw_state unsigned ts[16][TS_MAX]; float cb[PIPE_SHADER_TYPES][CB_MAX][4]; - unsigned shader_id[PIPE_SHADER_TYPES]; - struct svga_shader_result *fs; struct svga_shader_result *vs; struct svga_hw_view_state views[PIPE_MAX_SAMPLERS]; @@ -319,12 +318,14 @@ struct svga_context boolean new_vdecl; } swtnl; + /* Bitmask of used shader IDs */ + struct util_bitmask *fs_bm; + struct util_bitmask *vs_bm; + struct { unsigned dirty[4]; unsigned texture_timestamp; - unsigned next_fs_id; - unsigned next_vs_id; /* Internally generated shaders: */ diff --git a/src/gallium/drivers/svga/svga_draw.c b/src/gallium/drivers/svga/svga_draw.c index 8db40d0fd5..ca73cf9d5a 100644 --- a/src/gallium/drivers/svga/svga_draw.c +++ b/src/gallium/drivers/svga/svga_draw.c @@ -164,7 +164,8 @@ svga_hwtnl_flush( struct svga_hwtnl *hwtnl ) } SVGA_DBG(DEBUG_DMA, "draw to sid %p, %d prims\n", - svga_surface(svga->curr.framebuffer.cbufs[0])->handle, + svga->curr.framebuffer.cbufs[0] ? + svga_surface(svga->curr.framebuffer.cbufs[0])->handle : NULL, hwtnl->cmd.prim_count); ret = SVGA3D_BeginDrawPrimitives(swc, diff --git a/src/gallium/drivers/svga/svga_pipe_draw.c b/src/gallium/drivers/svga/svga_pipe_draw.c index 71a552862e..0f24ef4ee8 100644 --- a/src/gallium/drivers/svga/svga_pipe_draw.c +++ b/src/gallium/drivers/svga/svga_pipe_draw.c @@ -149,7 +149,7 @@ retry: -static boolean +static void svga_draw_range_elements( struct pipe_context *pipe, struct pipe_buffer *index_buffer, unsigned index_size, @@ -162,7 +162,7 @@ svga_draw_range_elements( struct pipe_context *pipe, enum pipe_error ret = 0; if (!u_trim_pipe_prim( prim, &count )) - return TRUE; + return; /* * Mark currently bound target surfaces as dirty @@ -183,7 +183,7 @@ svga_draw_range_elements( struct pipe_context *pipe, #ifdef DEBUG if (svga->curr.vs->base.id == svga->debug.disable_shader || svga->curr.fs->base.id == svga->debug.disable_shader) - return 0; + return; #endif if (svga->state.sw.need_swtnl) @@ -225,31 +225,29 @@ svga_draw_range_elements( struct pipe_context *pipe, svga_hwtnl_flush_retry( svga ); svga_context_flush(svga, NULL); } - - return ret == PIPE_OK; } -static boolean +static void svga_draw_elements( struct pipe_context *pipe, struct pipe_buffer *index_buffer, unsigned index_size, unsigned prim, unsigned start, unsigned count) { - return svga_draw_range_elements( pipe, index_buffer, - index_size, - 0, 0xffffffff, - prim, start, count ); + svga_draw_range_elements( pipe, index_buffer, + index_size, + 0, 0xffffffff, + prim, start, count ); } -static boolean +static void svga_draw_arrays( struct pipe_context *pipe, unsigned prim, unsigned start, unsigned count) { - return svga_draw_range_elements(pipe, NULL, 0, - start, start + count - 1, - prim, - start, count); + svga_draw_range_elements(pipe, NULL, 0, + start, start + count - 1, + prim, + start, count); } diff --git a/src/gallium/drivers/svga/svga_pipe_fs.c b/src/gallium/drivers/svga/svga_pipe_fs.c index e3be840d92..5f1213e46a 100644 --- a/src/gallium/drivers/svga/svga_pipe_fs.c +++ b/src/gallium/drivers/svga/svga_pipe_fs.c @@ -26,6 +26,7 @@ #include "pipe/p_inlines.h" #include "util/u_math.h" #include "util/u_memory.h" +#include "util/u_bitmask.h" #include "tgsi/tgsi_parse.h" #include "tgsi/tgsi_text.h" @@ -107,7 +108,16 @@ void svga_delete_fs_state(struct pipe_context *pipe, void *shader) assert(ret == PIPE_OK); } + util_bitmask_clear( svga->fs_bm, result->id ); + svga_destroy_shader_result( result ); + + /* + * Remove stale references to this result to ensure a new result on the + * same address will be detected as a change. + */ + if(result == svga->state.hw_draw.fs) + svga->state.hw_draw.fs = NULL; } FREE((void *)fs->base.tokens); diff --git a/src/gallium/drivers/svga/svga_pipe_sampler.c b/src/gallium/drivers/svga/svga_pipe_sampler.c index 78053e755e..460a101f8c 100644 --- a/src/gallium/drivers/svga/svga_pipe_sampler.c +++ b/src/gallium/drivers/svga/svga_pipe_sampler.c @@ -76,7 +76,6 @@ static INLINE unsigned translate_img_filter( unsigned filter ) switch (filter) { case PIPE_TEX_FILTER_NEAREST: return SVGA3D_TEX_FILTER_NEAREST; case PIPE_TEX_FILTER_LINEAR: return SVGA3D_TEX_FILTER_LINEAR; - case PIPE_TEX_FILTER_ANISO: return SVGA3D_TEX_FILTER_ANISOTROPIC; default: assert(0); return SVGA3D_TEX_FILTER_NEAREST; @@ -107,6 +106,8 @@ svga_create_sampler_state(struct pipe_context *pipe, cso->magfilter = translate_img_filter( sampler->mag_img_filter ); cso->minfilter = translate_img_filter( sampler->min_img_filter ); cso->aniso_level = MAX2( (unsigned) sampler->max_anisotropy, 1 ); + if(cso->aniso_level != 1) + cso->magfilter = cso->minfilter = SVGA3D_TEX_FILTER_ANISOTROPIC; cso->lod_bias = sampler->lod_bias; cso->addressu = translate_wrap_mode(sampler->wrap_s); cso->addressv = translate_wrap_mode(sampler->wrap_t); diff --git a/src/gallium/drivers/svga/svga_pipe_vs.c b/src/gallium/drivers/svga/svga_pipe_vs.c index c104c41f5f..7e6ab576ad 100644 --- a/src/gallium/drivers/svga/svga_pipe_vs.c +++ b/src/gallium/drivers/svga/svga_pipe_vs.c @@ -27,6 +27,7 @@ #include "pipe/p_inlines.h" #include "util/u_math.h" #include "util/u_memory.h" +#include "util/u_bitmask.h" #include "tgsi/tgsi_parse.h" #include "tgsi/tgsi_text.h" @@ -172,7 +173,16 @@ static void svga_delete_vs_state(struct pipe_context *pipe, void *shader) assert(ret == PIPE_OK); } + util_bitmask_clear( svga->vs_bm, result->id ); + svga_destroy_shader_result( result ); + + /* + * Remove stale references to this result to ensure a new result on the + * same address will be detected as a change. + */ + if(result == svga->state.hw_draw.vs) + svga->state.hw_draw.vs = NULL; } FREE((void *)vs->base.tokens); diff --git a/src/gallium/drivers/svga/svga_state_fs.c b/src/gallium/drivers/svga/svga_state_fs.c index 6ec38ed3e4..d29f3762d2 100644 --- a/src/gallium/drivers/svga/svga_state_fs.c +++ b/src/gallium/drivers/svga/svga_state_fs.c @@ -26,6 +26,7 @@ #include "pipe/p_inlines.h" #include "pipe/p_defines.h" #include "util/u_math.h" +#include "util/u_bitmask.h" #include "svga_context.h" #include "svga_state.h" @@ -39,8 +40,13 @@ static INLINE int compare_fs_keys( const struct svga_fs_compile_key *a, const struct svga_fs_compile_key *b ) { - unsigned keysize = svga_fs_key_size( a ); - return memcmp( a, b, keysize ); + unsigned keysize_a = svga_fs_key_size( a ); + unsigned keysize_b = svga_fs_key_size( b ); + + if (keysize_a != keysize_b) { + return (int)(keysize_a - keysize_b); + } + return memcmp( a, b, keysize_a ); } @@ -66,7 +72,7 @@ static enum pipe_error compile_fs( struct svga_context *svga, struct svga_shader_result **out_result ) { struct svga_shader_result *result; - enum pipe_error ret; + enum pipe_error ret = PIPE_ERROR; result = svga_translate_fragment_program( fs, key ); if (result == NULL) { @@ -74,9 +80,12 @@ static enum pipe_error compile_fs( struct svga_context *svga, goto fail; } + result->id = util_bitmask_add(svga->fs_bm); + if(result->id == UTIL_BITMASK_INVALID_INDEX) + goto fail; ret = SVGA3D_DefineShader(svga->swc, - svga->state.next_fs_id, + result->id, SVGA3D_SHADERTYPE_PS, result->tokens, result->nr_tokens * sizeof result->tokens[0]); @@ -84,14 +93,16 @@ static enum pipe_error compile_fs( struct svga_context *svga, goto fail; *out_result = result; - result->id = svga->state.next_fs_id++; result->next = fs->base.results; fs->base.results = result; return PIPE_OK; fail: - if (result) + if (result) { + if (result->id != UTIL_BITMASK_INVALID_INDEX) + util_bitmask_clear( svga->fs_bm, result->id ); svga_destroy_shader_result( result ); + } return ret; } @@ -116,7 +127,7 @@ fail: */ static int emit_white_fs( struct svga_context *svga ) { - int ret; + int ret = PIPE_ERROR; /* ps_3_0 * def c0, 1.000000, 0.000000, 0.000000, 1.000000 @@ -137,16 +148,26 @@ static int emit_white_fs( struct svga_context *svga ) 0x0000ffff, }; + assert(SVGA3D_INVALID_ID == UTIL_BITMASK_INVALID_INDEX); + svga->state.white_fs_id = util_bitmask_add(svga->fs_bm); + if(svga->state.white_fs_id == SVGA3D_INVALID_ID) + goto no_fs_id; + ret = SVGA3D_DefineShader(svga->swc, - svga->state.next_fs_id, + svga->state.white_fs_id, SVGA3D_SHADERTYPE_PS, white_tokens, sizeof(white_tokens)); if (ret) - return ret; + goto no_definition; - svga->state.white_fs_id = svga->state.next_fs_id++; return 0; + +no_definition: + util_bitmask_clear(svga->fs_bm, svga->state.white_fs_id); + svga->state.white_fs_id = SVGA3D_INVALID_ID; +no_fs_id: + return ret; } @@ -251,15 +272,14 @@ static int emit_hw_fs( struct svga_context *svga, assert(id != SVGA3D_INVALID_ID); - if (id != svga->state.hw_draw.shader_id[PIPE_SHADER_FRAGMENT]) { - ret = SVGA3D_SetShader(svga->swc, - SVGA3D_SHADERTYPE_PS, + if (result != svga->state.hw_draw.fs) { + ret = SVGA3D_SetShader(svga->swc, + SVGA3D_SHADERTYPE_PS, id ); if (ret) return ret; svga->dirty |= SVGA_NEW_FS_RESULT; - svga->state.hw_draw.shader_id[PIPE_SHADER_FRAGMENT] = id; svga->state.hw_draw.fs = result; } diff --git a/src/gallium/drivers/svga/svga_state_vs.c b/src/gallium/drivers/svga/svga_state_vs.c index 44b7ceb4fa..ae1e77e7d4 100644 --- a/src/gallium/drivers/svga/svga_state_vs.c +++ b/src/gallium/drivers/svga/svga_state_vs.c @@ -27,6 +27,7 @@ #include "pipe/p_defines.h" #include "util/u_format.h" #include "util/u_math.h" +#include "util/u_bitmask.h" #include "translate/translate.h" #include "svga_context.h" @@ -78,8 +79,12 @@ static enum pipe_error compile_vs( struct svga_context *svga, goto fail; } + result->id = util_bitmask_add(svga->vs_bm); + if(result->id == UTIL_BITMASK_INVALID_INDEX) + goto fail; + ret = SVGA3D_DefineShader(svga->swc, - svga->state.next_vs_id, + result->id, SVGA3D_SHADERTYPE_VS, result->tokens, result->nr_tokens * sizeof result->tokens[0]); @@ -87,14 +92,16 @@ static enum pipe_error compile_vs( struct svga_context *svga, goto fail; *out_result = result; - result->id = svga->state.next_vs_id++; result->next = vs->base.results; vs->base.results = result; return PIPE_OK; fail: - if (result) + if (result) { + if (result->id != UTIL_BITMASK_INVALID_INDEX) + util_bitmask_clear( svga->vs_bm, result->id ); svga_destroy_shader_result( result ); + } return ret; } @@ -142,15 +149,14 @@ static int emit_hw_vs( struct svga_context *svga, id = result->id; } - if (id != svga->state.hw_draw.shader_id[PIPE_SHADER_VERTEX]) { - ret = SVGA3D_SetShader(svga->swc, - SVGA3D_SHADERTYPE_VS, + if (result != svga->state.hw_draw.vs) { + ret = SVGA3D_SetShader(svga->swc, + SVGA3D_SHADERTYPE_VS, id ); if (ret) return ret; svga->dirty |= SVGA_NEW_VS_RESULT; - svga->state.hw_draw.shader_id[PIPE_SHADER_VERTEX] = id; svga->state.hw_draw.vs = result; } diff --git a/src/gallium/drivers/svga/svga_tgsi.c b/src/gallium/drivers/svga/svga_tgsi.c index b8ef137c01..0cd620189b 100644 --- a/src/gallium/drivers/svga/svga_tgsi.c +++ b/src/gallium/drivers/svga/svga_tgsi.c @@ -31,6 +31,7 @@ #include "tgsi/tgsi_dump.h" #include "tgsi/tgsi_scan.h" #include "util/u_memory.h" +#include "util/u_bitmask.h" #include "svgadump/svga_shader_dump.h" @@ -221,6 +222,7 @@ svga_tgsi_translate( const struct svga_shader *shader, result->tokens = (const unsigned *)emit.buf; result->nr_tokens = (emit.ptr - emit.buf) / sizeof(unsigned); memcpy(&result->key, &key, sizeof key); + result->id = UTIL_BITMASK_INVALID_INDEX; if (SVGA_DEBUG & DEBUG_TGSI) { diff --git a/src/gallium/drivers/svga/svga_tgsi.h b/src/gallium/drivers/svga/svga_tgsi.h index 896c90a89a..737a2213af 100644 --- a/src/gallium/drivers/svga/svga_tgsi.h +++ b/src/gallium/drivers/svga/svga_tgsi.h @@ -39,26 +39,24 @@ struct tgsi_token; struct svga_vs_compile_key { - ubyte need_prescale:1; - ubyte allow_psiz:1; unsigned zero_stride_vertex_elements; - ubyte num_zero_stride_vertex_elements:6; + unsigned need_prescale:1; + unsigned allow_psiz:1; + unsigned num_zero_stride_vertex_elements:6; }; struct svga_fs_compile_key { - boolean light_twoside:1; - boolean front_cw:1; - ubyte num_textures; - ubyte num_unnormalized_coords; + unsigned light_twoside:1; + unsigned front_cw:1; + unsigned num_textures:8; + unsigned num_unnormalized_coords:8; struct { - ubyte compare_mode : 1; - ubyte compare_func : 3; - ubyte unnormalized : 1; - - ubyte width_height_idx : 7; - - ubyte texture_target; + unsigned compare_mode:1; + unsigned compare_func:3; + unsigned unnormalized:1; + unsigned width_height_idx:7; + unsigned texture_target:8; } tex[PIPE_MAX_SAMPLERS]; }; @@ -121,8 +119,7 @@ static INLINE unsigned svga_vs_key_size( const struct svga_vs_compile_key *key ) static INLINE unsigned svga_fs_key_size( const struct svga_fs_compile_key *key ) { - return (const char *)&key->tex[key->num_textures].texture_target - - (const char *)key; + return (const char *)&key->tex[key->num_textures] - (const char *)key; } struct svga_shader_result * diff --git a/src/gallium/drivers/svga/svga_tgsi_insn.c b/src/gallium/drivers/svga/svga_tgsi_insn.c index 1670da8bfa..dc5eb8fc60 100644 --- a/src/gallium/drivers/svga/svga_tgsi_insn.c +++ b/src/gallium/drivers/svga/svga_tgsi_insn.c @@ -2109,7 +2109,7 @@ static boolean svga_emit_instruction( struct svga_shader_emitter *emit, case TGSI_OPCODE_I2F: case TGSI_OPCODE_NOT: case TGSI_OPCODE_SHL: - case TGSI_OPCODE_SHR: + case TGSI_OPCODE_ISHR: case TGSI_OPCODE_XOR: return FALSE; diff --git a/src/gallium/drivers/trace/tr_context.c b/src/gallium/drivers/trace/tr_context.c index ad47a56fba..075e4f9a0b 100644 --- a/src/gallium/drivers/trace/tr_context.c +++ b/src/gallium/drivers/trace/tr_context.c @@ -161,16 +161,15 @@ trace_context_draw_block(struct trace_context *tr_ctx, int flag) pipe_mutex_unlock(tr_ctx->draw_mutex); } -static INLINE boolean +static INLINE void trace_context_draw_arrays(struct pipe_context *_pipe, unsigned mode, unsigned start, unsigned count) { struct trace_context *tr_ctx = trace_context(_pipe); struct pipe_context *pipe = tr_ctx->pipe; - boolean result; if (tr_ctx->curr.fs->disabled || tr_ctx->curr.vs->disabled) - return 0; + return; trace_context_draw_block(tr_ctx, 1); @@ -181,19 +180,15 @@ trace_context_draw_arrays(struct pipe_context *_pipe, trace_dump_arg(uint, start); trace_dump_arg(uint, count); - result = pipe->draw_arrays(pipe, mode, start, count); - - trace_dump_ret(bool, result); + pipe->draw_arrays(pipe, mode, start, count); trace_dump_call_end(); trace_context_draw_block(tr_ctx, 2); - - return result; } -static INLINE boolean +static INLINE void trace_context_draw_elements(struct pipe_context *_pipe, struct pipe_buffer *_indexBuffer, unsigned indexSize, @@ -203,10 +198,9 @@ trace_context_draw_elements(struct pipe_context *_pipe, struct trace_buffer *tr_buf = trace_buffer(_indexBuffer); struct pipe_context *pipe = tr_ctx->pipe; struct pipe_buffer *indexBuffer = tr_buf->buffer; - boolean result; if (tr_ctx->curr.fs->disabled || tr_ctx->curr.vs->disabled) - return 0; + return; trace_context_draw_block(tr_ctx, 1); @@ -221,19 +215,15 @@ trace_context_draw_elements(struct pipe_context *_pipe, trace_dump_arg(uint, start); trace_dump_arg(uint, count); - result = pipe->draw_elements(pipe, indexBuffer, indexSize, mode, start, count); - - trace_dump_ret(bool, result); + pipe->draw_elements(pipe, indexBuffer, indexSize, mode, start, count); trace_dump_call_end(); trace_context_draw_block(tr_ctx, 2); - - return result; } -static INLINE boolean +static INLINE void trace_context_draw_range_elements(struct pipe_context *_pipe, struct pipe_buffer *_indexBuffer, unsigned indexSize, @@ -247,10 +237,9 @@ trace_context_draw_range_elements(struct pipe_context *_pipe, struct trace_buffer *tr_buf = trace_buffer(_indexBuffer); struct pipe_context *pipe = tr_ctx->pipe; struct pipe_buffer *indexBuffer = tr_buf->buffer; - boolean result; if (tr_ctx->curr.fs->disabled || tr_ctx->curr.vs->disabled) - return 0; + return; trace_context_draw_block(tr_ctx, 1); @@ -267,18 +256,14 @@ trace_context_draw_range_elements(struct pipe_context *_pipe, trace_dump_arg(uint, start); trace_dump_arg(uint, count); - result = pipe->draw_range_elements(pipe, - indexBuffer, - indexSize, minIndex, maxIndex, - mode, start, count); - - trace_dump_ret(bool, result); + pipe->draw_range_elements(pipe, + indexBuffer, + indexSize, minIndex, maxIndex, + mode, start, count); trace_dump_call_end(); trace_context_draw_block(tr_ctx, 2); - - return result; } diff --git a/src/gallium/drivers/trace/tr_dump_state.c b/src/gallium/drivers/trace/tr_dump_state.c index 0102cc1876..86237e03bc 100644 --- a/src/gallium/drivers/trace/tr_dump_state.c +++ b/src/gallium/drivers/trace/tr_dump_state.c @@ -409,7 +409,7 @@ void trace_dump_sampler_state(const struct pipe_sampler_state *state) trace_dump_member(uint, state, min_img_filter); trace_dump_member(uint, state, min_mip_filter); trace_dump_member(uint, state, mag_img_filter); - trace_dump_member(bool, state, compare_mode); + trace_dump_member(uint, state, compare_mode); trace_dump_member(uint, state, compare_func); trace_dump_member(bool, state, normalized_coords); trace_dump_member(uint, state, prefilter); diff --git a/src/gallium/drivers/trace/tr_state.h b/src/gallium/drivers/trace/tr_state.h index 1c16042ee5..e2f981d051 100644 --- a/src/gallium/drivers/trace/tr_state.h +++ b/src/gallium/drivers/trace/tr_state.h @@ -32,7 +32,7 @@ struct tgsi_token; enum trace_shader_type { TRACE_SHADER_FRAGMENT = 0, TRACE_SHADER_VERTEX = 1, - TRACE_SHADER_GEOMETRY = 2, + TRACE_SHADER_GEOMETRY = 2 }; struct trace_shader diff --git a/src/gallium/include/pipe/p_compiler.h b/src/gallium/include/pipe/p_compiler.h index f7368bb95b..26a940593f 100644 --- a/src/gallium/include/pipe/p_compiler.h +++ b/src/gallium/include/pipe/p_compiler.h @@ -52,45 +52,15 @@ #endif /* _MSC_VER */ -#if defined(_MSC_VER) - -typedef __int8 int8_t; -typedef unsigned __int8 uint8_t; -typedef __int16 int16_t; -typedef unsigned __int16 uint16_t; -#ifndef __eglplatform_h_ -typedef __int32 int32_t; -#endif -typedef unsigned __int32 uint32_t; -typedef __int64 int64_t; -typedef unsigned __int64 uint64_t; - -#if defined(_WIN64) -typedef __int64 intptr_t; -typedef unsigned __int64 uintptr_t; -#else -typedef __int32 intptr_t; -typedef unsigned __int32 uintptr_t; -#endif - -#define INT64_C(__val) __val##i64 -#define UINT64_C(__val) __val##ui64 - -#ifndef __cplusplus -#define false 0 -#define true 1 -#define bool _Bool -typedef int _Bool; -#define __bool_true_false_are_defined 1 -#endif /* !__cplusplus */ - -#else +/* + * Alternative stdint.h and stdbool.h headers are supplied in include/c99 for + * systems that lack it. + */ #ifndef __STDC_LIMIT_MACROS #define __STDC_LIMIT_MACROS 1 #endif #include <stdint.h> #include <stdbool.h> -#endif #ifndef __HAIKU__ @@ -99,11 +69,7 @@ typedef unsigned short ushort; #endif typedef unsigned char ubyte; -#if 0 -#define boolean bool -#else typedef unsigned char boolean; -#endif #ifndef TRUE #define TRUE true #endif @@ -135,6 +101,17 @@ typedef unsigned char boolean; # endif #endif + +/* Function visibility */ +#ifndef PUBLIC +# if defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303 +# define PUBLIC __attribute__((visibility("default"))) +# else +# define PUBLIC +# endif +#endif + + /* The __FUNCTION__ gcc variable is generally only used for debugging. * If we're not using gcc, define __FUNCTION__ as a cpp symbol here. */ diff --git a/src/gallium/include/pipe/p_context.h b/src/gallium/include/pipe/p_context.h index 6c06fb9027..d2f8085b42 100644 --- a/src/gallium/include/pipe/p_context.h +++ b/src/gallium/include/pipe/p_context.h @@ -61,29 +61,37 @@ struct pipe_context { * VBO drawing (return false on fallbacks (temporary??)) */ /*@{*/ - boolean (*draw_arrays)( struct pipe_context *pipe, - unsigned mode, unsigned start, unsigned count); + void (*draw_arrays)( struct pipe_context *pipe, + unsigned mode, unsigned start, unsigned count); - boolean (*draw_elements)( struct pipe_context *pipe, - struct pipe_buffer *indexBuffer, - unsigned indexSize, - unsigned mode, unsigned start, unsigned count); + void (*draw_elements)( struct pipe_context *pipe, + struct pipe_buffer *indexBuffer, + unsigned indexSize, + unsigned mode, unsigned start, unsigned count); /* XXX: this is (probably) a temporary entrypoint, as the range * information should be available from the vertex_buffer state. * Using this to quickly evaluate a specialized path in the draw * module. */ - boolean (*draw_range_elements)( struct pipe_context *pipe, - struct pipe_buffer *indexBuffer, - unsigned indexSize, - unsigned minIndex, - unsigned maxIndex, - unsigned mode, - unsigned start, - unsigned count); + void (*draw_range_elements)( struct pipe_context *pipe, + struct pipe_buffer *indexBuffer, + unsigned indexSize, + unsigned minIndex, + unsigned maxIndex, + unsigned mode, + unsigned start, + unsigned count); /*@}*/ + /** + * Predicate subsequent rendering on occlusion query result + * \param query the query predicate, or NULL if no predicate + * \param mode one of PIPE_COND_RENDER_x + */ + void (*render_condition)( struct pipe_context *pipe, + struct pipe_query *query, + uint mode ); /** * Query objects diff --git a/src/gallium/include/pipe/p_defines.h b/src/gallium/include/pipe/p_defines.h index 2cda408fec..35f3830ebc 100644 --- a/src/gallium/include/pipe/p_defines.h +++ b/src/gallium/include/pipe/p_defines.h @@ -171,8 +171,6 @@ enum pipe_texture_target { */ #define PIPE_TEX_FILTER_NEAREST 0 #define PIPE_TEX_FILTER_LINEAR 1 -#define PIPE_TEX_FILTER_ANISO 2 - #define PIPE_TEX_COMPARE_NONE 0 #define PIPE_TEX_COMPARE_R_TO_TEXTURE 1 @@ -355,6 +353,15 @@ enum pipe_transfer_usage { /** + * Conditional rendering modes + */ +#define PIPE_RENDER_COND_WAIT 0 +#define PIPE_RENDER_COND_NO_WAIT 1 +#define PIPE_RENDER_COND_BY_REGION_WAIT 2 +#define PIPE_RENDER_COND_BY_REGION_NO_WAIT 3 + + +/** * Point sprite coord modes */ #define PIPE_SPRITE_COORD_NONE 0 diff --git a/src/gallium/include/pipe/p_screen.h b/src/gallium/include/pipe/p_screen.h index f0a4de5df3..b8e001a6b0 100644 --- a/src/gallium/include/pipe/p_screen.h +++ b/src/gallium/include/pipe/p_screen.h @@ -266,6 +266,11 @@ struct pipe_screen { void (*video_surface_destroy)( struct pipe_video_surface *vsfc ); + /** + * Do any special operations to ensure buffer size is correct + */ + void (*update_buffer)( struct pipe_screen *ws, + void *context_private ); /** * Do any special operations to ensure frontbuffer contents are diff --git a/src/gallium/include/pipe/p_shader_tokens.h b/src/gallium/include/pipe/p_shader_tokens.h index 7b19364b97..550e2abc32 100644 --- a/src/gallium/include/pipe/p_shader_tokens.h +++ b/src/gallium/include/pipe/p_shader_tokens.h @@ -141,6 +141,8 @@ struct tgsi_declaration_semantic }; #define TGSI_IMM_FLOAT32 0 +#define TGSI_IMM_UINT32 1 +#define TGSI_IMM_INT32 2 struct tgsi_immediate { @@ -153,6 +155,8 @@ struct tgsi_immediate union tgsi_immediate_data { float Float; + unsigned Uint; + int Int; }; #define TGSI_PROPERTY_GS_INPUT_PRIM 0 @@ -264,7 +268,7 @@ struct tgsi_property_data { #define TGSI_OPCODE_NOT 85 #define TGSI_OPCODE_TRUNC 86 #define TGSI_OPCODE_SHL 87 -#define TGSI_OPCODE_SHR 88 + /* gap */ #define TGSI_OPCODE_AND 89 #define TGSI_OPCODE_OR 90 #define TGSI_OPCODE_MOD 91 @@ -289,7 +293,33 @@ struct tgsi_property_data { #define TGSI_OPCODE_KIL 116 /* conditional kill */ #define TGSI_OPCODE_END 117 /* aka HALT */ /* gap */ -#define TGSI_OPCODE_LAST 119 +#define TGSI_OPCODE_F2I 119 +#define TGSI_OPCODE_IDIV 120 +#define TGSI_OPCODE_IMAX 121 +#define TGSI_OPCODE_IMIN 122 +#define TGSI_OPCODE_INEG 123 +#define TGSI_OPCODE_ISGE 124 +#define TGSI_OPCODE_ISHR 125 +#define TGSI_OPCODE_ISLT 126 +#define TGSI_OPCODE_F2U 127 +#define TGSI_OPCODE_U2F 128 +#define TGSI_OPCODE_UADD 129 +#define TGSI_OPCODE_UDIV 130 +#define TGSI_OPCODE_UMAD 131 +#define TGSI_OPCODE_UMAX 132 +#define TGSI_OPCODE_UMIN 133 +#define TGSI_OPCODE_UMOD 134 +#define TGSI_OPCODE_UMUL 135 +#define TGSI_OPCODE_USEQ 136 +#define TGSI_OPCODE_USGE 137 +#define TGSI_OPCODE_USHR 138 +#define TGSI_OPCODE_USLT 139 +#define TGSI_OPCODE_USNE 140 +#define TGSI_OPCODE_SWITCH 141 +#define TGSI_OPCODE_CASE 142 +#define TGSI_OPCODE_DEFAULT 143 +#define TGSI_OPCODE_ENDSWITCH 144 +#define TGSI_OPCODE_LAST 145 #define TGSI_SAT_NONE 0 /* do not saturate */ #define TGSI_SAT_ZERO_ONE 1 /* clamp to [0,1] */ diff --git a/src/gallium/state_trackers/dri/dri_context.c b/src/gallium/state_trackers/dri/dri_context.c index 8819936fca..f2e5f3fb23 100644 --- a/src/gallium/state_trackers/dri/dri_context.c +++ b/src/gallium/state_trackers/dri/dri_context.c @@ -44,9 +44,9 @@ GLboolean dri_create_context(const __GLcontextModes * visual, - __DRIcontextPrivate * cPriv, void *sharedContextPrivate) + __DRIcontext * cPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = cPriv->driScreenPriv; + __DRIscreen *sPriv = cPriv->driScreenPriv; struct dri_screen *screen = dri_screen(sPriv); struct dri_context *ctx = NULL; struct st_context *st_share = NULL; @@ -97,7 +97,7 @@ dri_create_context(const __GLcontextModes * visual, } void -dri_destroy_context(__DRIcontextPrivate * cPriv) +dri_destroy_context(__DRIcontext * cPriv) { struct dri_context *ctx = dri_context(cPriv); @@ -116,7 +116,7 @@ dri_destroy_context(__DRIcontextPrivate * cPriv) } GLboolean -dri_unbind_context(__DRIcontextPrivate * cPriv) +dri_unbind_context(__DRIcontext * cPriv) { if (cPriv) { struct dri_context *ctx = dri_context(cPriv); @@ -133,9 +133,9 @@ dri_unbind_context(__DRIcontextPrivate * cPriv) } GLboolean -dri_make_current(__DRIcontextPrivate * cPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv) +dri_make_current(__DRIcontext * cPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv) { if (cPriv) { struct dri_context *ctx = dri_context(cPriv); diff --git a/src/gallium/state_trackers/dri/dri_context.h b/src/gallium/state_trackers/dri/dri_context.h index 4650178734..13f497462f 100644 --- a/src/gallium/state_trackers/dri/dri_context.h +++ b/src/gallium/state_trackers/dri/dri_context.h @@ -44,10 +44,10 @@ struct dri_drawable; struct dri_context { /* dri */ - __DRIscreenPrivate *sPriv; - __DRIcontextPrivate *cPriv; - __DRIdrawablePrivate *dPriv; - __DRIdrawablePrivate *rPriv; + __DRIscreen *sPriv; + __DRIcontext *cPriv; + __DRIdrawable *dPriv; + __DRIdrawable *rPriv; driOptionCache optionCache; @@ -67,7 +67,7 @@ struct dri_context }; static INLINE struct dri_context * -dri_context(__DRIcontextPrivate * driContextPriv) +dri_context(__DRIcontext * driContextPriv) { return (struct dri_context *)driContextPriv->driverPrivate; } @@ -99,18 +99,18 @@ dri_unlock(struct dri_context *ctx) */ extern struct dri1_api_lock_funcs dri1_lf; -void dri_destroy_context(__DRIcontextPrivate * driContextPriv); +void dri_destroy_context(__DRIcontext * driContextPriv); -boolean dri_unbind_context(__DRIcontextPrivate * driContextPriv); +boolean dri_unbind_context(__DRIcontext * driContextPriv); boolean -dri_make_current(__DRIcontextPrivate * driContextPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv); +dri_make_current(__DRIcontext * driContextPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv); boolean dri_create_context(const __GLcontextModes * visual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); /*********************************************************************** diff --git a/src/gallium/state_trackers/dri/dri_drawable.c b/src/gallium/state_trackers/dri/dri_drawable.c index 4b12243ddf..f131e77ac5 100644 --- a/src/gallium/state_trackers/dri/dri_drawable.c +++ b/src/gallium/state_trackers/dri/dri_drawable.c @@ -118,7 +118,7 @@ dri2_check_if_pixmap(__DRIbuffer *buffers, int count) * This will be called a drawable is known to have been resized. */ void -dri_get_buffers(__DRIdrawablePrivate * dPriv) +dri_get_buffers(__DRIdrawable * dPriv) { struct dri_drawable *drawable = dri_drawable(dPriv); @@ -268,6 +268,14 @@ void dri2_set_tex_buffer(__DRIcontext *pDRICtx, GLint target, } void +dri_update_buffer(struct pipe_screen *screen, void *context_private) +{ + struct dri_context *ctx = (struct dri_context *)context_private; + + dri_get_buffers(ctx->dPriv); +} + +void dri_flush_frontbuffer(struct pipe_screen *screen, struct pipe_surface *surf, void *context_private) { @@ -299,8 +307,8 @@ dri_flush_frontbuffer(struct pipe_screen *screen, * This is called when we need to set up GL rendering to a new X window. */ boolean -dri_create_buffer(__DRIscreenPrivate * sPriv, - __DRIdrawablePrivate * dPriv, +dri_create_buffer(__DRIscreen * sPriv, + __DRIdrawable * dPriv, const __GLcontextModes * visual, boolean isPixmap) { struct dri_screen *screen = sPriv->private; @@ -416,7 +424,7 @@ dri_swap_fences_push_back(struct dri_drawable *draw, } void -dri_destroy_buffer(__DRIdrawablePrivate * dPriv) +dri_destroy_buffer(__DRIdrawable * dPriv) { struct dri_drawable *drawable = dri_drawable(dPriv); struct pipe_fence_handle *fence; @@ -434,8 +442,8 @@ dri_destroy_buffer(__DRIdrawablePrivate * dPriv) static void dri1_update_drawables_locked(struct dri_context *ctx, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv) + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv) { if (ctx->stLostLock) { ctx->stLostLock = FALSE; @@ -458,8 +466,8 @@ dri1_update_drawables_locked(struct dri_context *ctx, static void dri1_propagate_drawable_change(struct dri_context *ctx) { - __DRIdrawablePrivate *dPriv = ctx->dPriv; - __DRIdrawablePrivate *rPriv = ctx->rPriv; + __DRIdrawable *dPriv = ctx->dPriv; + __DRIdrawable *rPriv = ctx->rPriv; boolean flushed = FALSE; if (dPriv && ctx->d_stamp != dPriv->lastStamp) { @@ -532,7 +540,7 @@ static void dri1_swap_copy(struct dri_context *ctx, struct pipe_surface *dst, struct pipe_surface *src, - __DRIdrawablePrivate * dPriv, const struct drm_clip_rect *bbox) + __DRIdrawable * dPriv, const struct drm_clip_rect *bbox) { struct pipe_context *pipe = ctx->pipe; struct drm_clip_rect clip; @@ -563,7 +571,7 @@ dri1_swap_copy(struct dri_context *ctx, static void dri1_copy_to_front(struct dri_context *ctx, struct pipe_surface *surf, - __DRIdrawablePrivate * dPriv, + __DRIdrawable * dPriv, const struct drm_clip_rect *sub_box, struct pipe_fence_handle **fence) { @@ -636,7 +644,7 @@ dri1_flush_frontbuffer(struct pipe_screen *screen, } void -dri_swap_buffers(__DRIdrawablePrivate * dPriv) +dri_swap_buffers(__DRIdrawable * dPriv) { struct dri_context *ctx; struct pipe_surface *back_surf; @@ -668,7 +676,7 @@ dri_swap_buffers(__DRIdrawablePrivate * dPriv) } void -dri_copy_sub_buffer(__DRIdrawablePrivate * dPriv, int x, int y, int w, int h) +dri_copy_sub_buffer(__DRIdrawable * dPriv, int x, int y, int w, int h) { struct pipe_screen *screen = dri_screen(dPriv->driScreenPriv)->pipe_screen; struct drm_clip_rect sub_bbox; diff --git a/src/gallium/state_trackers/dri/dri_drawable.h b/src/gallium/state_trackers/dri/dri_drawable.h index b910930db4..8bc59cb4c3 100644 --- a/src/gallium/state_trackers/dri/dri_drawable.h +++ b/src/gallium/state_trackers/dri/dri_drawable.h @@ -41,8 +41,8 @@ struct dri_context; struct dri_drawable { /* dri */ - __DRIdrawablePrivate *dPriv; - __DRIscreenPrivate *sPriv; + __DRIdrawable *dPriv; + __DRIscreen *sPriv; unsigned attachments[8]; unsigned num_attachments; @@ -67,7 +67,7 @@ struct dri_drawable }; static INLINE struct dri_drawable * -dri_drawable(__DRIdrawablePrivate * driDrawPriv) +dri_drawable(__DRIdrawable * driDrawPriv) { return (struct dri_drawable *)driDrawPriv->driverPrivate; } @@ -76,22 +76,25 @@ dri_drawable(__DRIdrawablePrivate * driDrawPriv) * dri_drawable.c */ boolean -dri_create_buffer(__DRIscreenPrivate * sPriv, - __DRIdrawablePrivate * dPriv, +dri_create_buffer(__DRIscreen * sPriv, + __DRIdrawable * dPriv, const __GLcontextModes * visual, boolean isPixmap); void +dri_update_buffer(struct pipe_screen *screen, void *context_private); + +void dri_flush_frontbuffer(struct pipe_screen *screen, struct pipe_surface *surf, void *context_private); -void dri_swap_buffers(__DRIdrawablePrivate * dPriv); +void dri_swap_buffers(__DRIdrawable * dPriv); void -dri_copy_sub_buffer(__DRIdrawablePrivate * dPriv, int x, int y, int w, int h); +dri_copy_sub_buffer(__DRIdrawable * dPriv, int x, int y, int w, int h); -void dri_get_buffers(__DRIdrawablePrivate * dPriv); +void dri_get_buffers(__DRIdrawable * dPriv); -void dri_destroy_buffer(__DRIdrawablePrivate * dPriv); +void dri_destroy_buffer(__DRIdrawable * dPriv); void dri2_set_tex_buffer2(__DRIcontext *pDRICtx, GLint target, GLint glx_texture_format, __DRIdrawable *dPriv); diff --git a/src/gallium/state_trackers/dri/dri_screen.c b/src/gallium/state_trackers/dri/dri_screen.c index cb864d45d5..793db087ee 100644 --- a/src/gallium/state_trackers/dri/dri_screen.c +++ b/src/gallium/state_trackers/dri/dri_screen.c @@ -202,7 +202,7 @@ dri_fill_in_modes(struct dri_screen *screen, * Get information about previous buffer swaps. */ static int -dri_get_swap_info(__DRIdrawablePrivate * dPriv, __DRIswapInfo * sInfo) +dri_get_swap_info(__DRIdrawable * dPriv, __DRIswapInfo * sInfo) { if (dPriv == NULL || dPriv->driverPrivate == NULL || sInfo == NULL) return -1; @@ -220,7 +220,7 @@ dri_copy_version(struct dri1_api_version *dst, } static const __DRIconfig ** -dri_init_screen(__DRIscreenPrivate * sPriv) +dri_init_screen(__DRIscreen * sPriv) { struct dri_screen *screen; const __DRIconfig **configs; @@ -285,7 +285,7 @@ dri_init_screen(__DRIscreenPrivate * sPriv) * Returns the __GLcontextModes supported by this driver. */ static const __DRIconfig ** -dri_init_screen2(__DRIscreenPrivate * sPriv) +dri_init_screen2(__DRIscreen * sPriv) { struct dri_screen *screen; struct drm_create_screen_arg arg; @@ -308,6 +308,7 @@ dri_init_screen2(__DRIscreenPrivate * sPriv) } /* We need to hook in here */ + screen->pipe_screen->update_buffer = dri_update_buffer; screen->pipe_screen->flush_frontbuffer = dri_flush_frontbuffer; driParseOptionInfo(&screen->optionCache, @@ -319,7 +320,7 @@ dri_init_screen2(__DRIscreenPrivate * sPriv) } static void -dri_destroy_screen(__DRIscreenPrivate * sPriv) +dri_destroy_screen(__DRIscreen * sPriv) { struct dri_screen *screen = dri_screen(sPriv); @@ -346,4 +347,12 @@ PUBLIC const struct __DriverAPIRec driDriverAPI = { .InitScreen2 = dri_init_screen2, }; +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + &driDRI2Extension.base, + NULL +}; + /* vim: set sw=3 ts=8 sts=3 expandtab: */ diff --git a/src/gallium/state_trackers/dri/dri_screen.h b/src/gallium/state_trackers/dri/dri_screen.h index f6c56d0f0c..03387a0e81 100644 --- a/src/gallium/state_trackers/dri/dri_screen.h +++ b/src/gallium/state_trackers/dri/dri_screen.h @@ -42,7 +42,7 @@ struct dri_screen { /* dri */ - __DRIscreenPrivate *sPriv; + __DRIscreen *sPriv; /** * Configuration cache with default values for all contexts @@ -63,7 +63,7 @@ struct dri_screen /** cast wrapper */ static INLINE struct dri_screen * -dri_screen(__DRIscreenPrivate * sPriv) +dri_screen(__DRIscreen * sPriv) { return (struct dri_screen *)sPriv->private; } diff --git a/src/gallium/state_trackers/glx/xlib/glx_api.c b/src/gallium/state_trackers/glx/xlib/glx_api.c index 228ac9a20e..3caf56e924 100644 --- a/src/gallium/state_trackers/glx/xlib/glx_api.c +++ b/src/gallium/state_trackers/glx/xlib/glx_api.c @@ -1007,7 +1007,7 @@ choose_visual( Display *dpy, int screen, const int *list, GLboolean fbConfig ) } -XVisualInfo * +PUBLIC XVisualInfo * glXChooseVisual( Display *dpy, int screen, int *list ) { XMesaVisual xmvis; @@ -1029,7 +1029,7 @@ glXChooseVisual( Display *dpy, int screen, int *list ) } -GLXContext +PUBLIC GLXContext glXCreateContext( Display *dpy, XVisualInfo *visinfo, GLXContext share_list, Bool direct ) { @@ -1084,7 +1084,7 @@ static XMesaBuffer MakeCurrent_PrevReadBuffer = 0; /* GLX 1.3 and later */ -Bool +PUBLIC Bool glXMakeContextCurrent( Display *dpy, GLXDrawable draw, GLXDrawable read, GLXContext ctx ) { @@ -1180,21 +1180,21 @@ glXMakeContextCurrent( Display *dpy, GLXDrawable draw, } -Bool +PUBLIC Bool glXMakeCurrent( Display *dpy, GLXDrawable drawable, GLXContext ctx ) { return glXMakeContextCurrent( dpy, drawable, drawable, ctx ); } -GLXContext +PUBLIC GLXContext glXGetCurrentContext(void) { return GetCurrentContext(); } -Display * +PUBLIC Display * glXGetCurrentDisplay(void) { GLXContext glxCtx = glXGetCurrentContext(); @@ -1203,14 +1203,14 @@ glXGetCurrentDisplay(void) } -Display * +PUBLIC Display * glXGetCurrentDisplayEXT(void) { return glXGetCurrentDisplay(); } -GLXDrawable +PUBLIC GLXDrawable glXGetCurrentDrawable(void) { GLXContext gc = glXGetCurrentContext(); @@ -1218,7 +1218,7 @@ glXGetCurrentDrawable(void) } -GLXDrawable +PUBLIC GLXDrawable glXGetCurrentReadDrawable(void) { GLXContext gc = glXGetCurrentContext(); @@ -1226,14 +1226,14 @@ glXGetCurrentReadDrawable(void) } -GLXDrawable +PUBLIC GLXDrawable glXGetCurrentReadDrawableSGI(void) { return glXGetCurrentReadDrawable(); } -GLXPixmap +PUBLIC GLXPixmap glXCreateGLXPixmap( Display *dpy, XVisualInfo *visinfo, Pixmap pixmap ) { XMesaVisual v; @@ -1258,7 +1258,7 @@ glXCreateGLXPixmap( Display *dpy, XVisualInfo *visinfo, Pixmap pixmap ) /*** GLX_MESA_pixmap_colormap ***/ -GLXPixmap +PUBLIC GLXPixmap glXCreateGLXPixmapMESA( Display *dpy, XVisualInfo *visinfo, Pixmap pixmap, Colormap cmap ) { @@ -1282,7 +1282,7 @@ glXCreateGLXPixmapMESA( Display *dpy, XVisualInfo *visinfo, } -void +PUBLIC void glXDestroyGLXPixmap( Display *dpy, GLXPixmap pixmap ) { XMesaBuffer b = XMesaFindBuffer(dpy, pixmap); @@ -1295,7 +1295,7 @@ glXDestroyGLXPixmap( Display *dpy, GLXPixmap pixmap ) } -void +PUBLIC void glXCopyContext( Display *dpy, GLXContext src, GLXContext dst, unsigned long mask ) { @@ -1309,7 +1309,7 @@ glXCopyContext( Display *dpy, GLXContext src, GLXContext dst, } -Bool +PUBLIC Bool glXQueryExtension( Display *dpy, int *errorBase, int *eventBase ) { int op, ev, err; @@ -1324,7 +1324,7 @@ glXQueryExtension( Display *dpy, int *errorBase, int *eventBase ) } -void +PUBLIC void glXDestroyContext( Display *dpy, GLXContext ctx ) { GLXContext glxCtx = ctx; @@ -1340,7 +1340,7 @@ glXDestroyContext( Display *dpy, GLXContext ctx ) } -Bool +PUBLIC Bool glXIsDirect( Display *dpy, GLXContext ctx ) { GLXContext glxCtx = ctx; @@ -1350,7 +1350,7 @@ glXIsDirect( Display *dpy, GLXContext ctx ) -void +PUBLIC void glXSwapBuffers( Display *dpy, GLXDrawable drawable ) { XMesaBuffer buffer = XMesaFindBuffer( dpy, drawable ); @@ -1377,7 +1377,7 @@ glXSwapBuffers( Display *dpy, GLXDrawable drawable ) /*** GLX_MESA_copy_sub_buffer ***/ -void +PUBLIC void glXCopySubBufferMESA( Display *dpy, GLXDrawable drawable, int x, int y, int width, int height ) { @@ -1391,7 +1391,7 @@ glXCopySubBufferMESA( Display *dpy, GLXDrawable drawable, } -Bool +PUBLIC Bool glXQueryVersion( Display *dpy, int *maj, int *min ) { (void) dpy; @@ -1608,7 +1608,7 @@ get_config( XMesaVisual xmvis, int attrib, int *value, GLboolean fbconfig ) } -int +PUBLIC int glXGetConfig( Display *dpy, XVisualInfo *visinfo, int attrib, int *value ) { @@ -1638,7 +1638,7 @@ glXGetConfig( Display *dpy, XVisualInfo *visinfo, } -void +PUBLIC void glXWaitGL( void ) { XMesaContext xmesa = XMesaGetCurrentContext(); @@ -1647,7 +1647,7 @@ glXWaitGL( void ) -void +PUBLIC void glXWaitX( void ) { XMesaContext xmesa = XMesaGetCurrentContext(); @@ -1664,7 +1664,7 @@ get_extensions( void ) /* GLX 1.1 and later */ -const char * +PUBLIC const char * glXQueryExtensionsString( Display *dpy, int screen ) { (void) dpy; @@ -1675,7 +1675,7 @@ glXQueryExtensionsString( Display *dpy, int screen ) /* GLX 1.1 and later */ -const char * +PUBLIC const char * glXQueryServerString( Display *dpy, int screen, int name ) { static char version[1000]; @@ -1700,7 +1700,7 @@ glXQueryServerString( Display *dpy, int screen, int name ) /* GLX 1.1 and later */ -const char * +PUBLIC const char * glXGetClientString( Display *dpy, int name ) { static char version[1000]; @@ -1728,7 +1728,7 @@ glXGetClientString( Display *dpy, int name ) */ -int +PUBLIC int glXGetFBConfigAttrib( Display *dpy, GLXFBConfig config, int attribute, int *value ) { @@ -1743,7 +1743,7 @@ glXGetFBConfigAttrib( Display *dpy, GLXFBConfig config, } -GLXFBConfig * +PUBLIC GLXFBConfig * glXGetFBConfigs( Display *dpy, int screen, int *nelements ) { XVisualInfo *visuals, visTemplate; @@ -1769,7 +1769,7 @@ glXGetFBConfigs( Display *dpy, int screen, int *nelements ) } -GLXFBConfig * +PUBLIC GLXFBConfig * glXChooseFBConfig( Display *dpy, int screen, const int *attribList, int *nitems ) { @@ -1798,7 +1798,7 @@ glXChooseFBConfig( Display *dpy, int screen, } -XVisualInfo * +PUBLIC XVisualInfo * glXGetVisualFromFBConfig( Display *dpy, GLXFBConfig config ) { if (dpy && config) { @@ -1820,7 +1820,7 @@ glXGetVisualFromFBConfig( Display *dpy, GLXFBConfig config ) } -GLXWindow +PUBLIC GLXWindow glXCreateWindow( Display *dpy, GLXFBConfig config, Window win, const int *attribList ) { @@ -1840,7 +1840,7 @@ glXCreateWindow( Display *dpy, GLXFBConfig config, Window win, } -void +PUBLIC void glXDestroyWindow( Display *dpy, GLXWindow window ) { XMesaBuffer b = XMesaFindBuffer(dpy, (Drawable) window); @@ -1851,7 +1851,7 @@ glXDestroyWindow( Display *dpy, GLXWindow window ) /* XXX untested */ -GLXPixmap +PUBLIC GLXPixmap glXCreatePixmap( Display *dpy, GLXFBConfig config, Pixmap pixmap, const int *attribList ) { @@ -1961,7 +1961,7 @@ glXCreatePixmap( Display *dpy, GLXFBConfig config, Pixmap pixmap, } -void +PUBLIC void glXDestroyPixmap( Display *dpy, GLXPixmap pixmap ) { XMesaBuffer b = XMesaFindBuffer(dpy, (Drawable)pixmap); @@ -1971,7 +1971,7 @@ glXDestroyPixmap( Display *dpy, GLXPixmap pixmap ) } -GLXPbuffer +PUBLIC GLXPbuffer glXCreatePbuffer( Display *dpy, GLXFBConfig config, const int *attribList ) { @@ -2034,7 +2034,7 @@ glXCreatePbuffer( Display *dpy, GLXFBConfig config, } -void +PUBLIC void glXDestroyPbuffer( Display *dpy, GLXPbuffer pbuf ) { XMesaBuffer b = XMesaFindBuffer(dpy, pbuf); @@ -2044,7 +2044,7 @@ glXDestroyPbuffer( Display *dpy, GLXPbuffer pbuf ) } -void +PUBLIC void glXQueryDrawable( Display *dpy, GLXDrawable draw, int attribute, unsigned int *value ) { @@ -2090,7 +2090,7 @@ glXQueryDrawable( Display *dpy, GLXDrawable draw, int attribute, } -GLXContext +PUBLIC GLXContext glXCreateNewContext( Display *dpy, GLXFBConfig config, int renderType, GLXContext shareList, Bool direct ) { @@ -2124,7 +2124,7 @@ glXCreateNewContext( Display *dpy, GLXFBConfig config, } -int +PUBLIC int glXQueryContext( Display *dpy, GLXContext ctx, int attribute, int *value ) { GLXContext glxCtx = ctx; @@ -2153,7 +2153,7 @@ glXQueryContext( Display *dpy, GLXContext ctx, int attribute, int *value ) } -void +PUBLIC void glXSelectEvent( Display *dpy, GLXDrawable drawable, unsigned long mask ) { XMesaBuffer xmbuf = XMesaFindBuffer(dpy, drawable); @@ -2162,7 +2162,7 @@ glXSelectEvent( Display *dpy, GLXDrawable drawable, unsigned long mask ) } -void +PUBLIC void glXGetSelectedEvent( Display *dpy, GLXDrawable drawable, unsigned long *mask ) { @@ -2177,7 +2177,7 @@ glXGetSelectedEvent( Display *dpy, GLXDrawable drawable, /*** GLX_SGI_swap_control ***/ -int +PUBLIC int glXSwapIntervalSGI(int interval) { (void) interval; @@ -2190,7 +2190,7 @@ glXSwapIntervalSGI(int interval) static unsigned int FrameCounter = 0; -int +PUBLIC int glXGetVideoSyncSGI(unsigned int *count) { /* this is a bogus implementation */ @@ -2198,7 +2198,7 @@ glXGetVideoSyncSGI(unsigned int *count) return 0; } -int +PUBLIC int glXWaitVideoSyncSGI(int divisor, int remainder, unsigned int *count) { if (divisor <= 0 || remainder < 0) @@ -2215,7 +2215,7 @@ glXWaitVideoSyncSGI(int divisor, int remainder, unsigned int *count) /*** GLX_SGI_make_current_read ***/ -Bool +PUBLIC Bool glXMakeCurrentReadSGI(Display *dpy, GLXDrawable draw, GLXDrawable read, GLXContext ctx) { return glXMakeContextCurrent( dpy, draw, read, ctx ); @@ -2233,7 +2233,7 @@ glXGetCurrentReadDrawableSGI(void) /*** GLX_SGIX_video_source ***/ #if defined(_VL_H) -GLXVideoSourceSGIX +PUBLIC GLXVideoSourceSGIX glXCreateGLXVideoSourceSGIX(Display *dpy, int screen, VLServer server, VLPath path, int nodeClass, VLNode drainNode) { (void) dpy; @@ -2245,7 +2245,7 @@ glXCreateGLXVideoSourceSGIX(Display *dpy, int screen, VLServer server, VLPath pa return 0; } -void +PUBLIC void glXDestroyGLXVideoSourceSGIX(Display *dpy, GLXVideoSourceSGIX src) { (void) dpy; @@ -2257,21 +2257,21 @@ glXDestroyGLXVideoSourceSGIX(Display *dpy, GLXVideoSourceSGIX src) /*** GLX_EXT_import_context ***/ -void +PUBLIC void glXFreeContextEXT(Display *dpy, GLXContext context) { (void) dpy; (void) context; } -GLXContextID +PUBLIC GLXContextID glXGetContextIDEXT(const GLXContext context) { (void) context; return 0; } -GLXContext +PUBLIC GLXContext glXImportContextEXT(Display *dpy, GLXContextID contextID) { (void) dpy; @@ -2279,7 +2279,7 @@ glXImportContextEXT(Display *dpy, GLXContextID contextID) return 0; } -int +PUBLIC int glXQueryContextInfoEXT(Display *dpy, GLXContext context, int attribute, int *value) { (void) dpy; @@ -2293,20 +2293,20 @@ glXQueryContextInfoEXT(Display *dpy, GLXContext context, int attribute, int *val /*** GLX_SGIX_fbconfig ***/ -int +PUBLIC int glXGetFBConfigAttribSGIX(Display *dpy, GLXFBConfigSGIX config, int attribute, int *value) { return glXGetFBConfigAttrib(dpy, config, attribute, value); } -GLXFBConfigSGIX * +PUBLIC GLXFBConfigSGIX * glXChooseFBConfigSGIX(Display *dpy, int screen, int *attrib_list, int *nelements) { return (GLXFBConfig *) glXChooseFBConfig(dpy, screen, attrib_list, nelements); } -GLXPixmap +PUBLIC GLXPixmap glXCreateGLXPixmapWithConfigSGIX(Display *dpy, GLXFBConfigSGIX config, Pixmap pixmap) { XMesaVisual xmvis = (XMesaVisual) config; @@ -2315,7 +2315,7 @@ glXCreateGLXPixmapWithConfigSGIX(Display *dpy, GLXFBConfigSGIX config, Pixmap pi } -GLXContext +PUBLIC GLXContext glXCreateContextWithConfigSGIX(Display *dpy, GLXFBConfigSGIX config, int render_type, GLXContext share_list, Bool direct) { XMesaVisual xmvis = (XMesaVisual) config; @@ -2344,14 +2344,14 @@ glXCreateContextWithConfigSGIX(Display *dpy, GLXFBConfigSGIX config, int render_ } -XVisualInfo * +PUBLIC XVisualInfo * glXGetVisualFromFBConfigSGIX(Display *dpy, GLXFBConfigSGIX config) { return glXGetVisualFromFBConfig(dpy, config); } -GLXFBConfigSGIX +PUBLIC GLXFBConfigSGIX glXGetFBConfigFromVisualSGIX(Display *dpy, XVisualInfo *vis) { XMesaVisual xmvis = find_glx_visual(dpy, vis); @@ -2367,7 +2367,7 @@ glXGetFBConfigFromVisualSGIX(Display *dpy, XVisualInfo *vis) /*** GLX_SGIX_pbuffer ***/ -GLXPbufferSGIX +PUBLIC GLXPbufferSGIX glXCreateGLXPbufferSGIX(Display *dpy, GLXFBConfigSGIX config, unsigned int width, unsigned int height, int *attribList) @@ -2406,7 +2406,7 @@ glXCreateGLXPbufferSGIX(Display *dpy, GLXFBConfigSGIX config, } -void +PUBLIC void glXDestroyGLXPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuf) { XMesaBuffer xmbuf = XMesaFindBuffer(dpy, pbuf); @@ -2416,7 +2416,7 @@ glXDestroyGLXPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuf) } -int +PUBLIC int glXQueryGLXPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuf, int attribute, unsigned int *value) { const XMesaBuffer xmbuf = XMesaFindBuffer(dpy, pbuf); @@ -2449,7 +2449,7 @@ glXQueryGLXPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuf, int attribute, unsigne } -void +PUBLIC void glXSelectEventSGIX(Display *dpy, GLXDrawable drawable, unsigned long mask) { XMesaBuffer xmbuf = XMesaFindBuffer(dpy, drawable); @@ -2460,7 +2460,7 @@ glXSelectEventSGIX(Display *dpy, GLXDrawable drawable, unsigned long mask) } -void +PUBLIC void glXGetSelectedEventSGIX(Display *dpy, GLXDrawable drawable, unsigned long *mask) { XMesaBuffer xmbuf = XMesaFindBuffer(dpy, drawable); @@ -2476,7 +2476,7 @@ glXGetSelectedEventSGIX(Display *dpy, GLXDrawable drawable, unsigned long *mask) /*** GLX_SGI_cushion ***/ -void +PUBLIC void glXCushionSGI(Display *dpy, Window win, float cushion) { (void) dpy; @@ -2488,7 +2488,7 @@ glXCushionSGI(Display *dpy, Window win, float cushion) /*** GLX_SGIX_video_resize ***/ -int +PUBLIC int glXBindChannelToWindowSGIX(Display *dpy, int screen, int channel , Window window) { (void) dpy; @@ -2498,7 +2498,7 @@ glXBindChannelToWindowSGIX(Display *dpy, int screen, int channel , Window window return 0; } -int +PUBLIC int glXChannelRectSGIX(Display *dpy, int screen, int channel, int x, int y, int w, int h) { (void) dpy; @@ -2511,7 +2511,7 @@ glXChannelRectSGIX(Display *dpy, int screen, int channel, int x, int y, int w, i return 0; } -int +PUBLIC int glXQueryChannelRectSGIX(Display *dpy, int screen, int channel, int *x, int *y, int *w, int *h) { (void) dpy; @@ -2524,7 +2524,7 @@ glXQueryChannelRectSGIX(Display *dpy, int screen, int channel, int *x, int *y, i return 0; } -int +PUBLIC int glXQueryChannelDeltasSGIX(Display *dpy, int screen, int channel, int *dx, int *dy, int *dw, int *dh) { (void) dpy; @@ -2537,7 +2537,7 @@ glXQueryChannelDeltasSGIX(Display *dpy, int screen, int channel, int *dx, int *d return 0; } -int +PUBLIC int glXChannelRectSyncSGIX(Display *dpy, int screen, int channel, GLenum synctype) { (void) dpy; @@ -2552,7 +2552,7 @@ glXChannelRectSyncSGIX(Display *dpy, int screen, int channel, GLenum synctype) /*** GLX_SGIX_dmbuffer **/ #if defined(_DM_BUFFER_H_) -Bool +PUBLIC Bool glXAssociateDMPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuffer, DMparams *params, DMbuffer dmbuffer) { (void) dpy; @@ -2566,7 +2566,7 @@ glXAssociateDMPbufferSGIX(Display *dpy, GLXPbufferSGIX pbuffer, DMparams *params /*** GLX_SGIX_swap_group ***/ -void +PUBLIC void glXJoinSwapGroupSGIX(Display *dpy, GLXDrawable drawable, GLXDrawable member) { (void) dpy; @@ -2578,7 +2578,7 @@ glXJoinSwapGroupSGIX(Display *dpy, GLXDrawable drawable, GLXDrawable member) /*** GLX_SGIX_swap_barrier ***/ -void +PUBLIC void glXBindSwapBarrierSGIX(Display *dpy, GLXDrawable drawable, int barrier) { (void) dpy; @@ -2586,7 +2586,7 @@ glXBindSwapBarrierSGIX(Display *dpy, GLXDrawable drawable, int barrier) (void) barrier; } -Bool +PUBLIC Bool glXQueryMaxSwapBarriersSGIX(Display *dpy, int screen, int *max) { (void) dpy; @@ -2599,7 +2599,7 @@ glXQueryMaxSwapBarriersSGIX(Display *dpy, int screen, int *max) /*** GLX_SUN_get_transparent_index ***/ -Status +PUBLIC Status glXGetTransparentIndexSUN(Display *dpy, Window overlay, Window underlay, long *pTransparent) { (void) dpy; @@ -2617,7 +2617,7 @@ glXGetTransparentIndexSUN(Display *dpy, Window overlay, Window underlay, long *p * Release the depth, stencil, accum buffers attached to a GLXDrawable * (a window or pixmap) prior to destroying the GLXDrawable. */ -Bool +PUBLIC Bool glXReleaseBuffersMESA( Display *dpy, GLXDrawable d ) { XMesaBuffer b = XMesaFindBuffer(dpy, d); @@ -2630,7 +2630,7 @@ glXReleaseBuffersMESA( Display *dpy, GLXDrawable d ) /*** GLX_EXT_texture_from_pixmap ***/ -void +PUBLIC void glXBindTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer, const int *attrib_list) { @@ -2639,7 +2639,7 @@ glXBindTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer, XMesaBindTexImage(dpy, b, buffer, attrib_list); } -void +PUBLIC void glXReleaseTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer) { XMesaBuffer b = XMesaFindBuffer(dpy, drawable); diff --git a/src/gallium/state_trackers/glx/xlib/glx_getproc.c b/src/gallium/state_trackers/glx/xlib/glx_getproc.c index ca7d88c922..84d47b12ed 100644 --- a/src/gallium/state_trackers/glx/xlib/glx_getproc.c +++ b/src/gallium/state_trackers/glx/xlib/glx_getproc.c @@ -34,6 +34,7 @@ #include <string.h> #include "GL/glx.h" #include "glapi/glapi.h" +#include "pipe/p_compiler.h" struct name_address_pair { @@ -208,6 +209,7 @@ glXGetProcAddressARB(const GLubyte *procName) /* GLX 1.4 */ +PUBLIC void (*glXGetProcAddress(const GLubyte *procName))() { return glXGetProcAddressARB(procName); diff --git a/src/gallium/state_trackers/glx/xlib/glx_usefont.c b/src/gallium/state_trackers/glx/xlib/glx_usefont.c index acc64df62b..16e5ce642f 100644 --- a/src/gallium/state_trackers/glx/xlib/glx_usefont.c +++ b/src/gallium/state_trackers/glx/xlib/glx_usefont.c @@ -33,6 +33,7 @@ #include "main/context.h" #include "main/imports.h" #include <GL/glx.h> +#include "pipe/p_compiler.h" /* Some debugging info. */ @@ -210,7 +211,7 @@ isvalid(XFontStruct * fs, unsigned int which) } -void +PUBLIC void glXUseXFont(Font font, int first, int count, int listbase) { Display *dpy; diff --git a/src/gallium/state_trackers/python/SConscript b/src/gallium/state_trackers/python/SConscript index d4fdd43688..8498a90812 100644 --- a/src/gallium/state_trackers/python/SConscript +++ b/src/gallium/state_trackers/python/SConscript @@ -28,14 +28,27 @@ if 'python' in env['statetrackers']: 'X11', ]) + sources = [ + 'gallium.i', + 'st_device.c', + 'st_sample.c', + ] + + drivers = [ + trace + ] + + if 'llvmpipe' in env['drivers']: + env.Tool('llvm') + sources += ['st_llvmpipe_winsys.c'] + drivers += [llvmpipe] + else: + sources += ['st_softpipe_winsys.c'] + drivers += [softpipe] + pyst = env.ConvenienceLibrary( target = 'pyst', - source = [ - 'gallium.i', - 'st_device.c', - 'st_sample.c', - 'st_softpipe_winsys.c', - ], + source = sources, ) env['no_import_lib'] = 1 @@ -45,5 +58,5 @@ if 'python' in env['statetrackers']: source = [ 'st_hardpipe_winsys.c', ], - LIBS = [pyst, softpipe, trace] + gallium + env['LIBS'], + LIBS = [pyst] + drivers + gallium + env['LIBS'], ) diff --git a/src/gallium/state_trackers/python/p_device.i b/src/gallium/state_trackers/python/p_device.i index 2dc995adb0..0eba488a07 100644 --- a/src/gallium/state_trackers/python/p_device.i +++ b/src/gallium/state_trackers/python/p_device.i @@ -87,6 +87,10 @@ struct st_device { enum pipe_texture_target target, unsigned tex_usage, unsigned geom_flags ) { + /* We can't really display surfaces with the python statetracker so mask + * out that usage */ + tex_usage &= ~PIPE_TEXTURE_USAGE_DISPLAY_TARGET; + return $self->screen->is_format_supported( $self->screen, format, target, @@ -110,6 +114,11 @@ struct st_device { unsigned tex_usage = 0 ) { struct pipe_texture templat; + + /* We can't really display surfaces with the python statetracker so mask + * out that usage */ + tex_usage &= ~PIPE_TEXTURE_USAGE_DISPLAY_TARGET; + memset(&templat, 0, sizeof(templat)); templat.format = format; templat.width0 = width; @@ -118,6 +127,7 @@ struct st_device { templat.last_level = last_level; templat.target = target; templat.tex_usage = tex_usage; + return $self->screen->texture_create($self->screen, &templat); } diff --git a/src/gallium/state_trackers/python/samples/gs.py b/src/gallium/state_trackers/python/samples/gs.py index 1ceead5f17..a07cf557f2 100644 --- a/src/gallium/state_trackers/python/samples/gs.py +++ b/src/gallium/state_trackers/python/samples/gs.py @@ -136,10 +136,10 @@ def test(dev): cbuf = dev.texture_create( PIPE_FORMAT_X8R8G8B8_UNORM, width, height, - tex_usage=PIPE_TEXTURE_USAGE_DISPLAY_TARGET, + tex_usage=PIPE_TEXTURE_USAGE_RENDER_TARGET, ).get_surface() zbuf = dev.texture_create( - PIPE_FORMAT_Z16_UNORM, + PIPE_FORMAT_Z32_UNORM, width, height, tex_usage=PIPE_TEXTURE_USAGE_DEPTH_STENCIL, ).get_surface() diff --git a/src/gallium/state_trackers/python/samples/tri.py b/src/gallium/state_trackers/python/samples/tri.py index af80426dc6..e5e168bdc8 100644 --- a/src/gallium/state_trackers/python/samples/tri.py +++ b/src/gallium/state_trackers/python/samples/tri.py @@ -136,10 +136,10 @@ def test(dev): cbuf = dev.texture_create( PIPE_FORMAT_X8R8G8B8_UNORM, width, height, - tex_usage=PIPE_TEXTURE_USAGE_DISPLAY_TARGET, + tex_usage=PIPE_TEXTURE_USAGE_RENDER_TARGET, ).get_surface() zbuf = dev.texture_create( - PIPE_FORMAT_Z16_UNORM, + PIPE_FORMAT_Z32_UNORM, width, height, tex_usage=PIPE_TEXTURE_USAGE_DEPTH_STENCIL, ).get_surface() diff --git a/src/gallium/state_trackers/python/st_llvmpipe_winsys.c b/src/gallium/state_trackers/python/st_llvmpipe_winsys.c new file mode 100644 index 0000000000..0096b18c99 --- /dev/null +++ b/src/gallium/state_trackers/python/st_llvmpipe_winsys.c @@ -0,0 +1,148 @@ +/************************************************************************** + * + * Copyright 2010 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR + * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. IN NO EVENT SHALL + * THE COPYRIGHT HOLDERS, AUTHORS AND/OR ITS SUPPLIERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE + * USE OR OTHER DEALINGS IN THE SOFTWARE. + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * + **************************************************************************/ + +/** + * @file + * Llvmpipe support. + * + * @author Jose Fonseca + */ + + +#include "pipe/p_format.h" +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "util/u_math.h" +#include "util/u_memory.h" +#include "llvmpipe/lp_winsys.h" +#include "st_winsys.h" + + +static boolean +llvmpipe_ws_is_displaytarget_format_supported( struct llvmpipe_winsys *ws, + enum pipe_format format ) +{ + return FALSE; +} + + +static void * +llvmpipe_ws_displaytarget_map(struct llvmpipe_winsys *ws, + struct llvmpipe_displaytarget *dt, + unsigned flags ) +{ + assert(0); + return NULL; +} + + +static void +llvmpipe_ws_displaytarget_unmap(struct llvmpipe_winsys *ws, + struct llvmpipe_displaytarget *dt ) +{ + assert(0); +} + + +static void +llvmpipe_ws_displaytarget_destroy(struct llvmpipe_winsys *winsys, + struct llvmpipe_displaytarget *dt) +{ + assert(0); +} + + +static struct llvmpipe_displaytarget * +llvmpipe_ws_displaytarget_create(struct llvmpipe_winsys *winsys, + enum pipe_format format, + unsigned width, unsigned height, + unsigned alignment, + unsigned *stride) +{ + return NULL; +} + + +static void +llvmpipe_ws_displaytarget_display(struct llvmpipe_winsys *winsys, + struct llvmpipe_displaytarget *dt, + void *context_private) +{ + assert(0); +} + + +static void +llvmpipe_ws_destroy(struct llvmpipe_winsys *winsys) +{ + FREE(winsys); +} + + +static struct pipe_screen * +st_llvmpipe_screen_create(void) +{ + static struct llvmpipe_winsys *winsys; + struct pipe_screen *screen; + + winsys = CALLOC_STRUCT(llvmpipe_winsys); + if (!winsys) + goto no_winsys; + + winsys->destroy = llvmpipe_ws_destroy; + winsys->is_displaytarget_format_supported = llvmpipe_ws_is_displaytarget_format_supported; + winsys->displaytarget_create = llvmpipe_ws_displaytarget_create; + winsys->displaytarget_map = llvmpipe_ws_displaytarget_map; + winsys->displaytarget_unmap = llvmpipe_ws_displaytarget_unmap; + winsys->displaytarget_display = llvmpipe_ws_displaytarget_display; + winsys->displaytarget_destroy = llvmpipe_ws_displaytarget_destroy; + + screen = llvmpipe_create_screen(winsys); + if (!screen) + goto no_screen; + + return screen; + +no_screen: + FREE(winsys); +no_winsys: + return NULL; +} + + +static struct pipe_context * +st_llvmpipe_context_create(struct pipe_screen *screen) +{ + return llvmpipe_create(screen); +} + + +const struct st_winsys st_softpipe_winsys = { + &st_llvmpipe_screen_create, + &st_llvmpipe_context_create, +}; diff --git a/src/gallium/state_trackers/python/tests/regress/fragment-shader/fragment-shader.py b/src/gallium/state_trackers/python/tests/regress/fragment-shader/fragment-shader.py index eed6cdd1e6..8d3bf9d4d7 100644 --- a/src/gallium/state_trackers/python/tests/regress/fragment-shader/fragment-shader.py +++ b/src/gallium/state_trackers/python/tests/regress/fragment-shader/fragment-shader.py @@ -114,7 +114,7 @@ def test(dev, name): cbuf = dev.texture_create( PIPE_FORMAT_X8R8G8B8_UNORM, width, height, - tex_usage=PIPE_TEXTURE_USAGE_DISPLAY_TARGET, + tex_usage=PIPE_TEXTURE_USAGE_RENDER_TARGET, ).get_surface() fb = Framebuffer() fb.width = width diff --git a/src/gallium/state_trackers/python/tests/regress/vertex-shader/vertex-shader.py b/src/gallium/state_trackers/python/tests/regress/vertex-shader/vertex-shader.py index 41bebd0604..01bf5a3210 100644 --- a/src/gallium/state_trackers/python/tests/regress/vertex-shader/vertex-shader.py +++ b/src/gallium/state_trackers/python/tests/regress/vertex-shader/vertex-shader.py @@ -114,7 +114,7 @@ def test(dev, name): cbuf = dev.texture_create( PIPE_FORMAT_X8R8G8B8_UNORM, width, height, - tex_usage=PIPE_TEXTURE_USAGE_DISPLAY_TARGET, + tex_usage=PIPE_TEXTURE_USAGE_RENDER_TARGET, ).get_surface() fb = Framebuffer() fb.width = width diff --git a/src/gallium/state_trackers/vega/image.c b/src/gallium/state_trackers/vega/image.c index 278ba6d46e..1112ad9839 100644 --- a/src/gallium/state_trackers/vega/image.c +++ b/src/gallium/state_trackers/vega/image.c @@ -644,7 +644,7 @@ VGint image_sampler_filter(struct vg_context *ctx) return PIPE_TEX_FILTER_NEAREST; break; case VG_IMAGE_QUALITY_BETTER: - /*return PIPE_TEX_FILTER_ANISO;*/ + /* possibly use anisotropic filtering */ return PIPE_TEX_FILTER_LINEAR; break; default: diff --git a/src/gallium/state_trackers/vega/vg_tracker.h b/src/gallium/state_trackers/vega/vg_tracker.h index 5457631106..0f0c27f455 100644 --- a/src/gallium/state_trackers/vega/vg_tracker.h +++ b/src/gallium/state_trackers/vega/vg_tracker.h @@ -45,15 +45,19 @@ struct pipe_fence_handle; struct pipe_surface; +PUBLIC struct vg_context *st_create_context(struct pipe_context *pipe, const void *visual, struct vg_context *share); +PUBLIC void st_destroy_context( struct vg_context *st ); +PUBLIC void st_copy_context_state(struct vg_context *dst, struct vg_context *src, uint mask); +PUBLIC struct st_framebuffer *st_create_framebuffer(const void *visual, enum pipe_format colorFormat, enum pipe_format depthFormat, @@ -61,47 +65,63 @@ struct st_framebuffer *st_create_framebuffer(const void *visual, uint width, uint height, void *privateData); +PUBLIC void st_resize_framebuffer(struct st_framebuffer *stfb, uint width, uint height); +PUBLIC void st_set_framebuffer_surface(struct st_framebuffer *stfb, uint surfIndex, struct pipe_surface *surf); +PUBLIC void st_get_framebuffer_dimensions( struct st_framebuffer *stfb, uint *width, uint *height); +PUBLIC int st_bind_texture_surface(struct pipe_surface *ps, int target, int level, enum pipe_format format); +PUBLIC int st_unbind_texture_surface(struct pipe_surface *ps, int target, int level); +PUBLIC int st_get_framebuffer_surface(struct st_framebuffer *stfb, uint surfIndex, struct pipe_surface **surf); +PUBLIC int st_get_framebuffer_texture(struct st_framebuffer *stfb, uint surfIndex, struct pipe_texture **tex); +PUBLIC void *st_framebuffer_private(struct st_framebuffer *stfb); +PUBLIC void st_unreference_framebuffer(struct st_framebuffer *stfb); +PUBLIC void st_make_current(struct vg_context *st, struct st_framebuffer *draw, struct st_framebuffer *read); +PUBLIC struct vg_context *st_get_current(void); +PUBLIC void st_flush(struct vg_context *st, uint pipeFlushFlags, struct pipe_fence_handle **fence); +PUBLIC void st_finish(struct vg_context *st); +PUBLIC void st_notify_swapbuffers(struct st_framebuffer *stfb); +PUBLIC void st_notify_swapbuffers_complete(struct st_framebuffer *stfb); /** Generic function type */ typedef void (*st_proc)(); +PUBLIC st_proc st_get_proc_address(const char *procname); #endif diff --git a/src/gallium/state_trackers/xorg/xorg_crtc.c b/src/gallium/state_trackers/xorg/xorg_crtc.c index e390ce29ae..650d2c0d1d 100644 --- a/src/gallium/state_trackers/xorg/xorg_crtc.c +++ b/src/gallium/state_trackers/xorg/xorg_crtc.c @@ -123,7 +123,8 @@ crtc_set_mode_major(xf86CrtcPtr crtc, DisplayModePtr mode, drm_mode.vrefresh = mode->VRefresh; if (!mode->name) xf86SetModeDefaultName(mode); - strncpy(drm_mode.name, mode->name, DRM_DISPLAY_MODE_LEN); + strncpy(drm_mode.name, mode->name, DRM_DISPLAY_MODE_LEN - 1); + drm_mode.name[DRM_DISPLAY_MODE_LEN - 1] = '\0'; ret = drmModeSetCrtc(ms->fd, drm_crtc->crtc_id, ms->fb_id, x, y, &drm_connector->connector_id, 1, &drm_mode); diff --git a/src/gallium/state_trackers/xorg/xorg_driver.c b/src/gallium/state_trackers/xorg/xorg_driver.c index 4d169a1d14..b02fe68f31 100644 --- a/src/gallium/state_trackers/xorg/xorg_driver.c +++ b/src/gallium/state_trackers/xorg/xorg_driver.c @@ -181,8 +181,7 @@ drv_crtc_resize(ScrnInfoPtr pScrn, int width, int height) if (!pScreen->ModifyPixmapHeader(rootPixmap, width, height, -1, -1, -1, NULL)) return FALSE; - /* HW dependent - FIXME */ - pScrn->displayWidth = pScrn->virtualX; + pScrn->displayWidth = rootPixmap->devKind / (rootPixmap->drawable.bitsPerPixel / 8); /* now create new frontbuffer */ return ms->create_front_buffer(pScrn) && ms->bind_front_buffer(pScrn); diff --git a/src/gallium/state_trackers/xorg/xorg_exa.c b/src/gallium/state_trackers/xorg/xorg_exa.c index aa68570b9c..d9432babf1 100644 --- a/src/gallium/state_trackers/xorg/xorg_exa.c +++ b/src/gallium/state_trackers/xorg/xorg_exa.c @@ -811,34 +811,7 @@ xorg_exa_set_shared_usage(PixmapPtr pPixmap) return 0; } -unsigned -xorg_exa_get_pixmap_handle(PixmapPtr pPixmap, unsigned *stride_out) -{ - ScreenPtr pScreen = pPixmap->drawable.pScreen; - ScrnInfoPtr pScrn = xf86Screens[pScreen->myNum]; - modesettingPtr ms = modesettingPTR(pScrn); - struct exa_pixmap_priv *priv; - unsigned handle; - unsigned stride; - if (!ms->exa) { - FatalError("NO MS->EXA\n"); - return 0; - } - - priv = exaGetPixmapDriverPrivate(pPixmap); - - if (!priv) { - FatalError("NO PIXMAP PRIVATE\n"); - return 0; - } - - ms->api->local_handle_from_texture(ms->api, ms->screen, priv->tex, &stride, &handle); - if (stride_out) - *stride_out = stride; - - return handle; -} static Bool size_match( int width, int tex_width ) diff --git a/src/gallium/state_trackers/xorg/xorg_tracker.h b/src/gallium/state_trackers/xorg/xorg_tracker.h index c0cfbe6061..4d5d4780dc 100644 --- a/src/gallium/state_trackers/xorg/xorg_tracker.h +++ b/src/gallium/state_trackers/xorg/xorg_tracker.h @@ -135,9 +135,6 @@ typedef struct _modesettingRec struct pipe_texture * xorg_exa_get_texture(PixmapPtr pPixmap); -unsigned -xorg_exa_get_pixmap_handle(PixmapPtr pPixmap, unsigned *stride); - int xorg_exa_set_displayed_usage(PixmapPtr pPixmap); diff --git a/src/gallium/winsys/drm/nouveau/drm/nouveau_drm_api.c b/src/gallium/winsys/drm/nouveau/drm/nouveau_drm_api.c index 7106a06492..e5912ef77f 100644 --- a/src/gallium/winsys/drm/nouveau/drm/nouveau_drm_api.c +++ b/src/gallium/winsys/drm/nouveau/drm/nouveau_drm_api.c @@ -87,6 +87,7 @@ nouveau_drm_create_screen(struct drm_api *api, int fd, case 0x60: init = nv40_screen_create; break; + case 0x50: case 0x80: case 0x90: case 0xa0: @@ -164,6 +165,7 @@ nouveau_drm_create_context(struct drm_api *api, struct pipe_screen *pscreen) case 0x60: init = nv40_create; break; + case 0x50: case 0x80: case 0x90: case 0xa0: diff --git a/src/gallium/winsys/drm/radeon/core/radeon_buffer.c b/src/gallium/winsys/drm/radeon/core/radeon_buffer.c index d2367b245a..385fa857b5 100644 --- a/src/gallium/winsys/drm/radeon/core/radeon_buffer.c +++ b/src/gallium/winsys/drm/radeon/core/radeon_buffer.c @@ -146,16 +146,17 @@ static void *radeon_buffer_map(struct pipe_winsys *ws, (struct radeon_pipe_buffer*)buffer; int write = 0; - if (radeon_bo_is_referenced_by_cs(radeon_buffer->bo, priv->cs)) { - priv->flush_cb(priv->flush_data); - } - if (flags & PIPE_BUFFER_USAGE_DONTBLOCK) { uint32_t domain; if (radeon_bo_is_busy(radeon_buffer->bo, &domain)) return NULL; } + + if (radeon_bo_is_referenced_by_cs(radeon_buffer->bo, priv->cs)) { + priv->flush_cb(priv->flush_data); + } + if (flags & PIPE_BUFFER_USAGE_CPU_WRITE) { write = 1; } @@ -280,58 +281,3 @@ struct radeon_winsys* radeon_pipe_winsys(int fd) return radeon_ws; } -#if 0 -static struct pipe_buffer *radeon_buffer_from_handle(struct radeon_screen *radeon_screen, - uint32_t handle) -{ - struct radeon_pipe_buffer *radeon_buffer; - struct radeon_bo *bo = NULL; - - bo = radeon_bo_open(radeon_screen->bom, handle, 0, 0, 0, 0); - if (bo == NULL) { - return NULL; - } - radeon_buffer = calloc(1, sizeof(struct radeon_pipe_buffer)); - if (radeon_buffer == NULL) { - radeon_bo_unref(bo); - return NULL; - } - pipe_reference_init(&radeon_buffer->base.reference, 1); - radeon_buffer->base.usage = PIPE_BUFFER_USAGE_PIXEL; - radeon_buffer->bo = bo; - return &radeon_buffer->base; -} - -struct pipe_surface *radeon_surface_from_handle(struct radeon_context *radeon_context, - uint32_t handle, - enum pipe_format format, - int w, int h, int pitch) -{ - struct pipe_screen *pipe_screen = radeon_context->pipe_screen; - struct pipe_winsys *pipe_winsys = radeon_context->pipe_winsys; - struct pipe_texture tmpl; - struct pipe_surface *ps; - struct pipe_texture *pt; - struct pipe_buffer *pb; - - pb = radeon_buffer_from_handle(radeon_context->radeon_screen, handle); - if (pb == NULL) { - return NULL; - } - memset(&tmpl, 0, sizeof(tmpl)); - tmpl.tex_usage = PIPE_TEXTURE_USAGE_DISPLAY_TARGET; - tmpl.target = PIPE_TEXTURE_2D; - tmpl.width0 = w; - tmpl.height0 = h; - tmpl.depth0 = 1; - tmpl.format = format; - - pt = pipe_screen->texture_blanket(pipe_screen, &tmpl, &pitch, pb); - if (pt == NULL) { - pipe_buffer_reference(&pb, NULL); - } - ps = pipe_screen->get_tex_surface(pipe_screen, pt, 0, 0, 0, - PIPE_BUFFER_USAGE_GPU_WRITE); - return ps; -} -#endif diff --git a/src/gallium/winsys/drm/vmware/xorg/SConscript b/src/gallium/winsys/drm/vmware/xorg/SConscript index f7ce400a7a..1e5d8ff7fe 100644 --- a/src/gallium/winsys/drm/vmware/xorg/SConscript +++ b/src/gallium/winsys/drm/vmware/xorg/SConscript @@ -44,6 +44,7 @@ if env['platform'] == 'linux': sources = [ 'vmw_ioctl.c', 'vmw_screen.c', + 'vmw_video.c', 'vmw_xorg.c', ] diff --git a/src/gallium/winsys/egl_xlib/egl_xlib.c b/src/gallium/winsys/egl_xlib/egl_xlib.c index 599973ce12..420dccc92c 100644 --- a/src/gallium/winsys/egl_xlib/egl_xlib.c +++ b/src/gallium/winsys/egl_xlib/egl_xlib.c @@ -751,24 +751,18 @@ xlib_eglReleaseTexImage(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *surface, static EGLBoolean xlib_eglSwapBuffers(_EGLDriver *drv, _EGLDisplay *dpy, _EGLSurface *draw) { - /* error checking step: */ - if (!_eglSwapBuffers(drv, dpy, draw)) - return EGL_FALSE; - - { - struct xlib_egl_surface *xsurf = lookup_surface(draw); - struct pipe_winsys *pws = xsurf->winsys; - struct pipe_surface *psurf; + struct xlib_egl_surface *xsurf = lookup_surface(draw); + struct pipe_winsys *pws = xsurf->winsys; + struct pipe_surface *psurf; - st_get_framebuffer_surface(xsurf->Framebuffer, ST_SURFACE_BACK_LEFT, - &psurf); + st_get_framebuffer_surface(xsurf->Framebuffer, ST_SURFACE_BACK_LEFT, + &psurf); - st_notify_swapbuffers(xsurf->Framebuffer); + st_notify_swapbuffers(xsurf->Framebuffer); - display_surface(pws, psurf, xsurf); + display_surface(pws, psurf, xsurf); - check_and_update_buffer_size(xsurf); - } + check_and_update_buffer_size(xsurf); return EGL_TRUE; } diff --git a/src/gallium/winsys/xlib/SConscript b/src/gallium/winsys/xlib/SConscript index 713841aeb1..a4dabb7804 100644 --- a/src/gallium/winsys/xlib/SConscript +++ b/src/gallium/winsys/xlib/SConscript @@ -3,50 +3,66 @@ Import('*') -if env['platform'] == 'linux' \ - and 'mesa' in env['statetrackers'] \ - and set(('softpipe', 'llvmpipe', 'i915', 'trace')).intersection(env['drivers']) \ - and not env['dri']: +if env['platform'] != 'linux': + Return() - env = env.Clone() +if 'mesa' not in env['statetrackers']: + print 'warning: Mesa state tracker disabled: skipping build of xlib libGL.so' + Return() - env.Append(CPPPATH = [ - '#/src/mesa', - '#/src/mesa/main', - '#src/gallium/state_trackers/glx/xlib', - ]) +if env['dri']: + print 'warning: DRI enabled: skipping build of xlib libGL.so' + Return() - env.Append(CPPDEFINES = ['USE_XSHM']) +if 'trace' not in env['drivers']: + print 'warning: trace pipe driver disabled: skipping build of xlib libGL.so' + Return() - sources = [ - 'xlib.c', - ] +if not set(('softpipe', 'llvmpipe', 'trace')).intersection(env['drivers']): + print 'warning: no supported pipe driver: skipping build of xlib libGL.so' + Return() - drivers = [trace] - - if 'softpipe' in env['drivers']: - env.Append(CPPDEFINES = 'GALLIUM_SOFTPIPE') - sources += ['xlib_softpipe.c'] - drivers += [softpipe] +env = env.Clone() - if 'llvmpipe' in env['drivers']: - env.Tool('llvm') - if 'LLVM_VERSION' in env: - env.Append(CPPDEFINES = 'GALLIUM_LLVMPIPE') - env.Tool('udis86') - sources += ['xlib_llvmpipe.c'] - drivers += [llvmpipe] - - if 'cell' in env['drivers']: - env.Append(CPPDEFINES = 'GALLIUM_CELL') - sources += ['xlib_cell.c'] - drivers += [cell] +env.Append(CPPPATH = [ + '#/src/mesa', + '#/src/mesa/main', + '#src/gallium/state_trackers/glx/xlib', +]) - # TODO: write a wrapper function http://www.scons.org/wiki/WrapperFunctions - libgl = env.SharedLibrary( - target ='GL', - source = sources, - LIBS = st_xlib + glapi + mesa + glsl + drivers + gallium + env['LIBS'], - ) +env.Append(CPPDEFINES = ['USE_XSHM']) +sources = [ + 'xlib.c', +] + +drivers = [trace] + +if 'softpipe' in env['drivers']: + env.Append(CPPDEFINES = 'GALLIUM_SOFTPIPE') + sources += ['xlib_softpipe.c'] + drivers += [softpipe] + +if 'llvmpipe' in env['drivers']: + env.Tool('llvm') + if 'LLVM_VERSION' in env: + env.Append(CPPDEFINES = 'GALLIUM_LLVMPIPE') + env.Tool('udis86') + sources += ['xlib_llvmpipe.c'] + drivers += [llvmpipe] + +if 'cell' in env['drivers']: + env.Append(CPPDEFINES = 'GALLIUM_CELL') + sources += ['xlib_cell.c'] + drivers += [cell] + +# TODO: write a wrapper function http://www.scons.org/wiki/WrapperFunctions +libgl = env.SharedLibrary( + target ='GL', + source = sources, + LIBS = st_xlib + glapi + mesa + glsl + drivers + gallium + env['LIBS'], +) + +if not env['dri']: + # Only install this libGL.so if DRI not enabled env.InstallSharedLibrary(libgl, version=(1, 5)) diff --git a/src/glew/SConscript b/src/glew/SConscript index 1d7dbb9b78..ce6e71e157 100644 --- a/src/glew/SConscript +++ b/src/glew/SConscript @@ -26,7 +26,6 @@ lib_env = env.Clone() lib_env.Append(CPPDEFINES = [ 'GLEW_BUILD', - #'GLEW_STATIC', #'GLEW_MX', # Multiple Rendering Contexts support ]) @@ -35,17 +34,18 @@ if lib_env['platform'] == 'windows': else: target = 'GLEW' -glew = lib_env.SharedLibrary( - target = target, - source = [ - 'glew.c', - ], -) - -env.InstallSharedLibrary(glew, version=(1, 5)) +source = [ + 'glew.c', +] if lib_env['platform'] == 'windows': + glew = lib_env.SharedLibrary(target = target, source = source) + env.InstallSharedLibrary(glew, version=(1, 5, 2)) glew = lib_env.FindIxes(glew, 'LIBPREFIX', 'LIBSUFFIX') +else: + # Use static library on Unices to avoid binary compatability issues + lib_env.Append(CPPDEFINES = ['GLEW_STATIC']) + glew = lib_env.StaticLibrary(target = target, source = source) # Program specific environment settings prog_env = env.Clone() diff --git a/src/glew/glew.c b/src/glew/glew.c index aa2278f6c0..624222f9fb 100644 --- a/src/glew/glew.c +++ b/src/glew/glew.c @@ -66,9 +66,26 @@ #endif /* GLEW_MX */ #if defined(__APPLE__) -#include <mach-o/dyld.h> #include <stdlib.h> #include <string.h> +#include <AvailabilityMacros.h> + +#ifdef MAC_OS_X_VERSION_10_3 + +#include <dlfcn.h> + +void* NSGLGetProcAddress (const GLubyte *name) +{ + static void* image = NULL; + if (NULL == image) + { + image = dlopen("/System/Library/Frameworks/OpenGL.framework/Versions/Current/OpenGL", RTLD_LAZY); + } + return image ? dlsym(image, (const char*)name) : NULL; +} +#else + +#include <mach-o/dyld.h> void* NSGLGetProcAddress (const GLubyte *name) { @@ -90,6 +107,7 @@ void* NSGLGetProcAddress (const GLubyte *name) free(symbolName); return symbol ? NSAddressOfSymbol(symbol) : NULL; } +#endif /* MAC_OS_X_VERSION_10_3 */ #endif /* __APPLE__ */ #if defined(__sgi) || defined (__sun) @@ -444,8 +462,6 @@ PFNGLUNIFORMMATRIX4X3FVPROC __glewUniformMatrix4x3fv = NULL; PFNGLBEGINCONDITIONALRENDERPROC __glewBeginConditionalRender = NULL; PFNGLBEGINTRANSFORMFEEDBACKPROC __glewBeginTransformFeedback = NULL; -PFNGLBINDBUFFERBASEPROC __glewBindBufferBase = NULL; -PFNGLBINDBUFFERRANGEPROC __glewBindBufferRange = NULL; PFNGLBINDFRAGDATALOCATIONPROC __glewBindFragDataLocation = NULL; PFNGLCLAMPCOLORPROC __glewClampColor = NULL; PFNGLCLEARBUFFERFIPROC __glewClearBufferfi = NULL; @@ -459,7 +475,6 @@ PFNGLENDCONDITIONALRENDERPROC __glewEndConditionalRender = NULL; PFNGLENDTRANSFORMFEEDBACKPROC __glewEndTransformFeedback = NULL; PFNGLGETBOOLEANI_VPROC __glewGetBooleani_v = NULL; PFNGLGETFRAGDATALOCATIONPROC __glewGetFragDataLocation = NULL; -PFNGLGETINTEGERI_VPROC __glewGetIntegeri_v = NULL; PFNGLGETSTRINGIPROC __glewGetStringi = NULL; PFNGLGETTEXPARAMETERIIVPROC __glewGetTexParameterIiv = NULL; PFNGLGETTEXPARAMETERIUIVPROC __glewGetTexParameterIuiv = NULL; @@ -501,8 +516,37 @@ PFNGLVERTEXATTRIBI4UIVPROC __glewVertexAttribI4uiv = NULL; PFNGLVERTEXATTRIBI4USVPROC __glewVertexAttribI4usv = NULL; PFNGLVERTEXATTRIBIPOINTERPROC __glewVertexAttribIPointer = NULL; +PFNGLDRAWARRAYSINSTANCEDPROC __glewDrawArraysInstanced = NULL; +PFNGLDRAWELEMENTSINSTANCEDPROC __glewDrawElementsInstanced = NULL; +PFNGLPRIMITIVERESTARTINDEXPROC __glewPrimitiveRestartIndex = NULL; +PFNGLTEXBUFFERPROC __glewTexBuffer = NULL; + +PFNGLFRAMEBUFFERTEXTUREPROC __glewFramebufferTexture = NULL; +PFNGLGETBUFFERPARAMETERI64VPROC __glewGetBufferParameteri64v = NULL; +PFNGLGETINTEGER64I_VPROC __glewGetInteger64i_v = NULL; + PFNGLTBUFFERMASK3DFXPROC __glewTbufferMask3DFX = NULL; +PFNGLBLENDEQUATIONINDEXEDAMDPROC __glewBlendEquationIndexedAMD = NULL; +PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC __glewBlendEquationSeparateIndexedAMD = NULL; +PFNGLBLENDFUNCINDEXEDAMDPROC __glewBlendFuncIndexedAMD = NULL; +PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC __glewBlendFuncSeparateIndexedAMD = NULL; + +PFNGLBEGINPERFMONITORAMDPROC __glewBeginPerfMonitorAMD = NULL; +PFNGLDELETEPERFMONITORSAMDPROC __glewDeletePerfMonitorsAMD = NULL; +PFNGLENDPERFMONITORAMDPROC __glewEndPerfMonitorAMD = NULL; +PFNGLGENPERFMONITORSAMDPROC __glewGenPerfMonitorsAMD = NULL; +PFNGLGETPERFMONITORCOUNTERDATAAMDPROC __glewGetPerfMonitorCounterDataAMD = NULL; +PFNGLGETPERFMONITORCOUNTERINFOAMDPROC __glewGetPerfMonitorCounterInfoAMD = NULL; +PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC __glewGetPerfMonitorCounterStringAMD = NULL; +PFNGLGETPERFMONITORCOUNTERSAMDPROC __glewGetPerfMonitorCountersAMD = NULL; +PFNGLGETPERFMONITORGROUPSTRINGAMDPROC __glewGetPerfMonitorGroupStringAMD = NULL; +PFNGLGETPERFMONITORGROUPSAMDPROC __glewGetPerfMonitorGroupsAMD = NULL; +PFNGLSELECTPERFMONITORCOUNTERSAMDPROC __glewSelectPerfMonitorCountersAMD = NULL; + +PFNGLTESSELLATIONFACTORAMDPROC __glewTessellationFactorAMD = NULL; +PFNGLTESSELLATIONMODEAMDPROC __glewTessellationModeAMD = NULL; + PFNGLDRAWELEMENTARRAYAPPLEPROC __glewDrawElementArrayAPPLE = NULL; PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC __glewDrawRangeElementArrayAPPLE = NULL; PFNGLELEMENTPOINTERAPPLEPROC __glewElementPointerAPPLE = NULL; @@ -521,6 +565,10 @@ PFNGLTESTOBJECTAPPLEPROC __glewTestObjectAPPLE = NULL; PFNGLBUFFERPARAMETERIAPPLEPROC __glewBufferParameteriAPPLE = NULL; PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC __glewFlushMappedBufferRangeAPPLE = NULL; +PFNGLGETOBJECTPARAMETERIVAPPLEPROC __glewGetObjectParameterivAPPLE = NULL; +PFNGLOBJECTPURGEABLEAPPLEPROC __glewObjectPurgeableAPPLE = NULL; +PFNGLOBJECTUNPURGEABLEAPPLEPROC __glewObjectUnpurgeableAPPLE = NULL; + PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC __glewGetTexParameterPointervAPPLE = NULL; PFNGLTEXTURERANGEAPPLEPROC __glewTextureRangeAPPLE = NULL; @@ -533,10 +581,30 @@ PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC __glewFlushVertexArrayRangeAPPLE = NULL; PFNGLVERTEXARRAYPARAMETERIAPPLEPROC __glewVertexArrayParameteriAPPLE = NULL; PFNGLVERTEXARRAYRANGEAPPLEPROC __glewVertexArrayRangeAPPLE = NULL; +PFNGLDISABLEVERTEXATTRIBAPPLEPROC __glewDisableVertexAttribAPPLE = NULL; +PFNGLENABLEVERTEXATTRIBAPPLEPROC __glewEnableVertexAttribAPPLE = NULL; +PFNGLISVERTEXATTRIBENABLEDAPPLEPROC __glewIsVertexAttribEnabledAPPLE = NULL; +PFNGLMAPVERTEXATTRIB1DAPPLEPROC __glewMapVertexAttrib1dAPPLE = NULL; +PFNGLMAPVERTEXATTRIB1FAPPLEPROC __glewMapVertexAttrib1fAPPLE = NULL; +PFNGLMAPVERTEXATTRIB2DAPPLEPROC __glewMapVertexAttrib2dAPPLE = NULL; +PFNGLMAPVERTEXATTRIB2FAPPLEPROC __glewMapVertexAttrib2fAPPLE = NULL; + PFNGLCLAMPCOLORARBPROC __glewClampColorARB = NULL; +PFNGLCOPYBUFFERSUBDATAPROC __glewCopyBufferSubData = NULL; + PFNGLDRAWBUFFERSARBPROC __glewDrawBuffersARB = NULL; +PFNGLBLENDEQUATIONSEPARATEIARBPROC __glewBlendEquationSeparateiARB = NULL; +PFNGLBLENDEQUATIONIARBPROC __glewBlendEquationiARB = NULL; +PFNGLBLENDFUNCSEPARATEIARBPROC __glewBlendFuncSeparateiARB = NULL; +PFNGLBLENDFUNCIARBPROC __glewBlendFunciARB = NULL; + +PFNGLDRAWELEMENTSBASEVERTEXPROC __glewDrawElementsBaseVertex = NULL; +PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC __glewDrawElementsInstancedBaseVertex = NULL; +PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC __glewDrawRangeElementsBaseVertex = NULL; +PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC __glewMultiDrawElementsBaseVertex = NULL; + PFNGLDRAWARRAYSINSTANCEDARBPROC __glewDrawArraysInstancedARB = NULL; PFNGLDRAWELEMENTSINSTANCEDARBPROC __glewDrawElementsInstancedARB = NULL; @@ -547,10 +615,10 @@ PFNGLCHECKFRAMEBUFFERSTATUSPROC __glewCheckFramebufferStatus = NULL; PFNGLDELETEFRAMEBUFFERSPROC __glewDeleteFramebuffers = NULL; PFNGLDELETERENDERBUFFERSPROC __glewDeleteRenderbuffers = NULL; PFNGLFRAMEBUFFERRENDERBUFFERPROC __glewFramebufferRenderbuffer = NULL; -PFNGLFRAMEBUFFERTEXTURELAYERPROC __glewFramebufferTextureLayer = NULL; PFNGLFRAMEBUFFERTEXTURE1DPROC __glewFramebufferTexture1D = NULL; PFNGLFRAMEBUFFERTEXTURE2DPROC __glewFramebufferTexture2D = NULL; PFNGLFRAMEBUFFERTEXTURE3DPROC __glewFramebufferTexture3D = NULL; +PFNGLFRAMEBUFFERTEXTURELAYERPROC __glewFramebufferTextureLayer = NULL; PFNGLGENFRAMEBUFFERSPROC __glewGenFramebuffers = NULL; PFNGLGENRENDERBUFFERSPROC __glewGenRenderbuffers = NULL; PFNGLGENERATEMIPMAPPROC __glewGenerateMipmap = NULL; @@ -659,6 +727,10 @@ PFNGLISQUERYARBPROC __glewIsQueryARB = NULL; PFNGLPOINTPARAMETERFARBPROC __glewPointParameterfARB = NULL; PFNGLPOINTPARAMETERFVARBPROC __glewPointParameterfvARB = NULL; +PFNGLPROVOKINGVERTEXPROC __glewProvokingVertex = NULL; + +PFNGLMINSAMPLESHADINGARBPROC __glewMinSampleShadingARB = NULL; + PFNGLATTACHOBJECTARBPROC __glewAttachObjectARB = NULL; PFNGLCOMPILESHADERARBPROC __glewCompileShaderARB = NULL; PFNGLCREATEPROGRAMOBJECTARBPROC __glewCreateProgramObjectARB = NULL; @@ -699,6 +771,14 @@ PFNGLUNIFORMMATRIX4FVARBPROC __glewUniformMatrix4fvARB = NULL; PFNGLUSEPROGRAMOBJECTARBPROC __glewUseProgramObjectARB = NULL; PFNGLVALIDATEPROGRAMARBPROC __glewValidateProgramARB = NULL; +PFNGLCLIENTWAITSYNCPROC __glewClientWaitSync = NULL; +PFNGLDELETESYNCPROC __glewDeleteSync = NULL; +PFNGLFENCESYNCPROC __glewFenceSync = NULL; +PFNGLGETINTEGER64VPROC __glewGetInteger64v = NULL; +PFNGLGETSYNCIVPROC __glewGetSynciv = NULL; +PFNGLISSYNCPROC __glewIsSync = NULL; +PFNGLWAITSYNCPROC __glewWaitSync = NULL; + PFNGLTEXBUFFERARBPROC __glewTexBufferARB = NULL; PFNGLCOMPRESSEDTEXIMAGE1DARBPROC __glewCompressedTexImage1DARB = NULL; @@ -709,11 +789,27 @@ PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC __glewCompressedTexSubImage2DARB = NULL; PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC __glewCompressedTexSubImage3DARB = NULL; PFNGLGETCOMPRESSEDTEXIMAGEARBPROC __glewGetCompressedTexImageARB = NULL; +PFNGLGETMULTISAMPLEFVPROC __glewGetMultisamplefv = NULL; +PFNGLSAMPLEMASKIPROC __glewSampleMaski = NULL; +PFNGLTEXIMAGE2DMULTISAMPLEPROC __glewTexImage2DMultisample = NULL; +PFNGLTEXIMAGE3DMULTISAMPLEPROC __glewTexImage3DMultisample = NULL; + PFNGLLOADTRANSPOSEMATRIXDARBPROC __glewLoadTransposeMatrixdARB = NULL; PFNGLLOADTRANSPOSEMATRIXFARBPROC __glewLoadTransposeMatrixfARB = NULL; PFNGLMULTTRANSPOSEMATRIXDARBPROC __glewMultTransposeMatrixdARB = NULL; PFNGLMULTTRANSPOSEMATRIXFARBPROC __glewMultTransposeMatrixfARB = NULL; +PFNGLBINDBUFFERBASEPROC __glewBindBufferBase = NULL; +PFNGLBINDBUFFERRANGEPROC __glewBindBufferRange = NULL; +PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC __glewGetActiveUniformBlockName = NULL; +PFNGLGETACTIVEUNIFORMBLOCKIVPROC __glewGetActiveUniformBlockiv = NULL; +PFNGLGETACTIVEUNIFORMNAMEPROC __glewGetActiveUniformName = NULL; +PFNGLGETACTIVEUNIFORMSIVPROC __glewGetActiveUniformsiv = NULL; +PFNGLGETINTEGERI_VPROC __glewGetIntegeri_v = NULL; +PFNGLGETUNIFORMBLOCKINDEXPROC __glewGetUniformBlockIndex = NULL; +PFNGLGETUNIFORMINDICESPROC __glewGetUniformIndices = NULL; +PFNGLUNIFORMBLOCKBINDINGPROC __glewUniformBlockBinding = NULL; + PFNGLBINDVERTEXARRAYPROC __glewBindVertexArray = NULL; PFNGLDELETEVERTEXARRAYSPROC __glewDeleteVertexArrays = NULL; PFNGLGENVERTEXARRAYSPROC __glewGenVertexArrays = NULL; @@ -988,7 +1084,14 @@ PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC __glewCopyTextureSubImage1DEXT = NULL; PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC __glewCopyTextureSubImage2DEXT = NULL; PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC __glewCopyTextureSubImage3DEXT = NULL; PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC __glewDisableClientStateIndexedEXT = NULL; +PFNGLDISABLECLIENTSTATEIEXTPROC __glewDisableClientStateiEXT = NULL; +PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC __glewDisableVertexArrayAttribEXT = NULL; +PFNGLDISABLEVERTEXARRAYEXTPROC __glewDisableVertexArrayEXT = NULL; PFNGLENABLECLIENTSTATEINDEXEDEXTPROC __glewEnableClientStateIndexedEXT = NULL; +PFNGLENABLECLIENTSTATEIEXTPROC __glewEnableClientStateiEXT = NULL; +PFNGLENABLEVERTEXARRAYATTRIBEXTPROC __glewEnableVertexArrayAttribEXT = NULL; +PFNGLENABLEVERTEXARRAYEXTPROC __glewEnableVertexArrayEXT = NULL; +PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC __glewFlushMappedNamedBufferRangeEXT = NULL; PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC __glewFramebufferDrawBufferEXT = NULL; PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC __glewFramebufferDrawBuffersEXT = NULL; PFNGLFRAMEBUFFERREADBUFFEREXTPROC __glewFramebufferReadBufferEXT = NULL; @@ -997,7 +1100,9 @@ PFNGLGENERATETEXTUREMIPMAPEXTPROC __glewGenerateTextureMipmapEXT = NULL; PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC __glewGetCompressedMultiTexImageEXT = NULL; PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC __glewGetCompressedTextureImageEXT = NULL; PFNGLGETDOUBLEINDEXEDVEXTPROC __glewGetDoubleIndexedvEXT = NULL; +PFNGLGETDOUBLEI_VEXTPROC __glewGetDoublei_vEXT = NULL; PFNGLGETFLOATINDEXEDVEXTPROC __glewGetFloatIndexedvEXT = NULL; +PFNGLGETFLOATI_VEXTPROC __glewGetFloati_vEXT = NULL; PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC __glewGetFramebufferParameterivEXT = NULL; PFNGLGETMULTITEXENVFVEXTPROC __glewGetMultiTexEnvfvEXT = NULL; PFNGLGETMULTITEXENVIVEXTPROC __glewGetMultiTexEnvivEXT = NULL; @@ -1023,6 +1128,7 @@ PFNGLGETNAMEDPROGRAMSTRINGEXTPROC __glewGetNamedProgramStringEXT = NULL; PFNGLGETNAMEDPROGRAMIVEXTPROC __glewGetNamedProgramivEXT = NULL; PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC __glewGetNamedRenderbufferParameterivEXT = NULL; PFNGLGETPOINTERINDEXEDVEXTPROC __glewGetPointerIndexedvEXT = NULL; +PFNGLGETPOINTERI_VEXTPROC __glewGetPointeri_vEXT = NULL; PFNGLGETTEXTUREIMAGEEXTPROC __glewGetTextureImageEXT = NULL; PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC __glewGetTextureLevelParameterfvEXT = NULL; PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC __glewGetTextureLevelParameterivEXT = NULL; @@ -1030,7 +1136,12 @@ PFNGLGETTEXTUREPARAMETERIIVEXTPROC __glewGetTextureParameterIivEXT = NULL; PFNGLGETTEXTUREPARAMETERIUIVEXTPROC __glewGetTextureParameterIuivEXT = NULL; PFNGLGETTEXTUREPARAMETERFVEXTPROC __glewGetTextureParameterfvEXT = NULL; PFNGLGETTEXTUREPARAMETERIVEXTPROC __glewGetTextureParameterivEXT = NULL; +PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC __glewGetVertexArrayIntegeri_vEXT = NULL; +PFNGLGETVERTEXARRAYINTEGERVEXTPROC __glewGetVertexArrayIntegervEXT = NULL; +PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC __glewGetVertexArrayPointeri_vEXT = NULL; +PFNGLGETVERTEXARRAYPOINTERVEXTPROC __glewGetVertexArrayPointervEXT = NULL; PFNGLMAPNAMEDBUFFEREXTPROC __glewMapNamedBufferEXT = NULL; +PFNGLMAPNAMEDBUFFERRANGEEXTPROC __glewMapNamedBufferRangeEXT = NULL; PFNGLMATRIXFRUSTUMEXTPROC __glewMatrixFrustumEXT = NULL; PFNGLMATRIXLOADIDENTITYEXTPROC __glewMatrixLoadIdentityEXT = NULL; PFNGLMATRIXLOADTRANSPOSEDEXTPROC __glewMatrixLoadTransposedEXT = NULL; @@ -1077,6 +1188,7 @@ PFNGLMULTITEXSUBIMAGE2DEXTPROC __glewMultiTexSubImage2DEXT = NULL; PFNGLMULTITEXSUBIMAGE3DEXTPROC __glewMultiTexSubImage3DEXT = NULL; PFNGLNAMEDBUFFERDATAEXTPROC __glewNamedBufferDataEXT = NULL; PFNGLNAMEDBUFFERSUBDATAEXTPROC __glewNamedBufferSubDataEXT = NULL; +PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC __glewNamedCopyBufferSubDataEXT = NULL; PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC __glewNamedFramebufferRenderbufferEXT = NULL; PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC __glewNamedFramebufferTexture1DEXT = NULL; PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC __glewNamedFramebufferTexture2DEXT = NULL; @@ -1148,6 +1260,17 @@ PFNGLTEXTURESUBIMAGE1DEXTPROC __glewTextureSubImage1DEXT = NULL; PFNGLTEXTURESUBIMAGE2DEXTPROC __glewTextureSubImage2DEXT = NULL; PFNGLTEXTURESUBIMAGE3DEXTPROC __glewTextureSubImage3DEXT = NULL; PFNGLUNMAPNAMEDBUFFEREXTPROC __glewUnmapNamedBufferEXT = NULL; +PFNGLVERTEXARRAYCOLOROFFSETEXTPROC __glewVertexArrayColorOffsetEXT = NULL; +PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC __glewVertexArrayEdgeFlagOffsetEXT = NULL; +PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC __glewVertexArrayFogCoordOffsetEXT = NULL; +PFNGLVERTEXARRAYINDEXOFFSETEXTPROC __glewVertexArrayIndexOffsetEXT = NULL; +PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC __glewVertexArrayMultiTexCoordOffsetEXT = NULL; +PFNGLVERTEXARRAYNORMALOFFSETEXTPROC __glewVertexArrayNormalOffsetEXT = NULL; +PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC __glewVertexArraySecondaryColorOffsetEXT = NULL; +PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC __glewVertexArrayTexCoordOffsetEXT = NULL; +PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC __glewVertexArrayVertexAttribIOffsetEXT = NULL; +PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC __glewVertexArrayVertexAttribOffsetEXT = NULL; +PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC __glewVertexArrayVertexOffsetEXT = NULL; PFNGLCOLORMASKINDEXEDEXTPROC __glewColorMaskIndexedEXT = NULL; PFNGLDISABLEINDEXEDEXTPROC __glewDisableIndexedEXT = NULL; @@ -1293,6 +1416,8 @@ PFNGLPOINTPARAMETERFVEXTPROC __glewPointParameterfvEXT = NULL; PFNGLPOLYGONOFFSETEXTPROC __glewPolygonOffsetEXT = NULL; +PFNGLPROVOKINGVERTEXEXTPROC __glewProvokingVertexEXT = NULL; + PFNGLBEGINSCENEEXTPROC __glewBeginSceneEXT = NULL; PFNGLENDSCENEEXTPROC __glewEndSceneEXT = NULL; @@ -1314,6 +1439,10 @@ PFNGLSECONDARYCOLOR3USEXTPROC __glewSecondaryColor3usEXT = NULL; PFNGLSECONDARYCOLOR3USVEXTPROC __glewSecondaryColor3usvEXT = NULL; PFNGLSECONDARYCOLORPOINTEREXTPROC __glewSecondaryColorPointerEXT = NULL; +PFNGLACTIVEPROGRAMEXTPROC __glewActiveProgramEXT = NULL; +PFNGLCREATESHADERPROGRAMEXTPROC __glewCreateShaderProgramEXT = NULL; +PFNGLUSESHADERPROGRAMEXTPROC __glewUseShaderProgramEXT = NULL; + PFNGLACTIVESTENCILFACEEXTPROC __glewActiveStencilFaceEXT = NULL; PFNGLTEXSUBIMAGE1DEXTPROC __glewTexSubImage1DEXT = NULL; @@ -1475,6 +1604,8 @@ PFNGLWINDOWPOS4SVMESAPROC __glewWindowPos4svMESA = NULL; PFNGLBEGINCONDITIONALRENDERNVPROC __glewBeginConditionalRenderNV = NULL; PFNGLENDCONDITIONALRENDERNVPROC __glewEndConditionalRenderNV = NULL; +PFNGLCOPYIMAGESUBDATANVPROC __glewCopyImageSubDataNV = NULL; + PFNGLCLEARDEPTHDNVPROC __glewClearDepthdNV = NULL; PFNGLDEPTHBOUNDSDNVPROC __glewDepthBoundsdNV = NULL; PFNGLDEPTHRANGEDNVPROC __glewDepthRangedNV = NULL; @@ -1596,7 +1727,6 @@ PFNGLGETVIDEOUI64VNVPROC __glewGetVideoui64vNV = NULL; PFNGLGETVIDEOUIVNVPROC __glewGetVideouivNV = NULL; PFNGLPRESENTFRAMEDUALFILLNVPROC __glewPresentFrameDualFillNV = NULL; PFNGLPRESENTFRAMEKEYEDNVPROC __glewPresentFrameKeyedNV = NULL; -PFNGLVIDEOPARAMETERIVNVPROC __glewVideoParameterivNV = NULL; PFNGLPRIMITIVERESTARTINDEXNVPROC __glewPrimitiveRestartIndexNV = NULL; PFNGLPRIMITIVERESTARTNVPROC __glewPrimitiveRestartNV = NULL; @@ -1618,6 +1748,23 @@ PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC __glewGetFinalCombinerInputParameter PFNGLCOMBINERSTAGEPARAMETERFVNVPROC __glewCombinerStageParameterfvNV = NULL; PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC __glewGetCombinerStageParameterfvNV = NULL; +PFNGLGETBUFFERPARAMETERUI64VNVPROC __glewGetBufferParameterui64vNV = NULL; +PFNGLGETINTEGERUI64VNVPROC __glewGetIntegerui64vNV = NULL; +PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC __glewGetNamedBufferParameterui64vNV = NULL; +PFNGLGETUNIFORMUI64VNVPROC __glewGetUniformui64vNV = NULL; +PFNGLISBUFFERRESIDENTNVPROC __glewIsBufferResidentNV = NULL; +PFNGLISNAMEDBUFFERRESIDENTNVPROC __glewIsNamedBufferResidentNV = NULL; +PFNGLMAKEBUFFERNONRESIDENTNVPROC __glewMakeBufferNonResidentNV = NULL; +PFNGLMAKEBUFFERRESIDENTNVPROC __glewMakeBufferResidentNV = NULL; +PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC __glewMakeNamedBufferNonResidentNV = NULL; +PFNGLMAKENAMEDBUFFERRESIDENTNVPROC __glewMakeNamedBufferResidentNV = NULL; +PFNGLPROGRAMUNIFORMUI64NVPROC __glewProgramUniformui64NV = NULL; +PFNGLPROGRAMUNIFORMUI64VNVPROC __glewProgramUniformui64vNV = NULL; +PFNGLUNIFORMUI64NVPROC __glewUniformui64NV = NULL; +PFNGLUNIFORMUI64VNVPROC __glewUniformui64vNV = NULL; + +PFNGLTEXTUREBARRIERNVPROC __glewTextureBarrierNV = NULL; + PFNGLACTIVEVARYINGNVPROC __glewActiveVaryingNV = NULL; PFNGLBEGINTRANSFORMFEEDBACKNVPROC __glewBeginTransformFeedbackNV = NULL; PFNGLBINDBUFFERBASENVPROC __glewBindBufferBaseNV = NULL; @@ -1630,9 +1777,30 @@ PFNGLGETVARYINGLOCATIONNVPROC __glewGetVaryingLocationNV = NULL; PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC __glewTransformFeedbackAttribsNV = NULL; PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC __glewTransformFeedbackVaryingsNV = NULL; +PFNGLBINDTRANSFORMFEEDBACKNVPROC __glewBindTransformFeedbackNV = NULL; +PFNGLDELETETRANSFORMFEEDBACKSNVPROC __glewDeleteTransformFeedbacksNV = NULL; +PFNGLDRAWTRANSFORMFEEDBACKNVPROC __glewDrawTransformFeedbackNV = NULL; +PFNGLGENTRANSFORMFEEDBACKSNVPROC __glewGenTransformFeedbacksNV = NULL; +PFNGLISTRANSFORMFEEDBACKNVPROC __glewIsTransformFeedbackNV = NULL; +PFNGLPAUSETRANSFORMFEEDBACKNVPROC __glewPauseTransformFeedbackNV = NULL; +PFNGLRESUMETRANSFORMFEEDBACKNVPROC __glewResumeTransformFeedbackNV = NULL; + PFNGLFLUSHVERTEXARRAYRANGENVPROC __glewFlushVertexArrayRangeNV = NULL; PFNGLVERTEXARRAYRANGENVPROC __glewVertexArrayRangeNV = NULL; +PFNGLBUFFERADDRESSRANGENVPROC __glewBufferAddressRangeNV = NULL; +PFNGLCOLORFORMATNVPROC __glewColorFormatNV = NULL; +PFNGLEDGEFLAGFORMATNVPROC __glewEdgeFlagFormatNV = NULL; +PFNGLFOGCOORDFORMATNVPROC __glewFogCoordFormatNV = NULL; +PFNGLGETINTEGERUI64I_VNVPROC __glewGetIntegerui64i_vNV = NULL; +PFNGLINDEXFORMATNVPROC __glewIndexFormatNV = NULL; +PFNGLNORMALFORMATNVPROC __glewNormalFormatNV = NULL; +PFNGLSECONDARYCOLORFORMATNVPROC __glewSecondaryColorFormatNV = NULL; +PFNGLTEXCOORDFORMATNVPROC __glewTexCoordFormatNV = NULL; +PFNGLVERTEXATTRIBFORMATNVPROC __glewVertexAttribFormatNV = NULL; +PFNGLVERTEXATTRIBIFORMATNVPROC __glewVertexAttribIFormatNV = NULL; +PFNGLVERTEXFORMATNVPROC __glewVertexFormatNV = NULL; + PFNGLAREPROGRAMSRESIDENTNVPROC __glewAreProgramsResidentNV = NULL; PFNGLBINDPROGRAMNVPROC __glewBindProgramNV = NULL; PFNGLDELETEPROGRAMSNVPROC __glewDeleteProgramsNV = NULL; @@ -1849,26 +2017,43 @@ GLboolean __GLEW_VERSION_1_5 = GL_FALSE; GLboolean __GLEW_VERSION_2_0 = GL_FALSE; GLboolean __GLEW_VERSION_2_1 = GL_FALSE; GLboolean __GLEW_VERSION_3_0 = GL_FALSE; +GLboolean __GLEW_VERSION_3_1 = GL_FALSE; +GLboolean __GLEW_VERSION_3_2 = GL_FALSE; GLboolean __GLEW_3DFX_multisample = GL_FALSE; GLboolean __GLEW_3DFX_tbuffer = GL_FALSE; GLboolean __GLEW_3DFX_texture_compression_FXT1 = GL_FALSE; +GLboolean __GLEW_AMD_draw_buffers_blend = GL_FALSE; +GLboolean __GLEW_AMD_performance_monitor = GL_FALSE; +GLboolean __GLEW_AMD_texture_texture4 = GL_FALSE; +GLboolean __GLEW_AMD_vertex_shader_tessellator = GL_FALSE; +GLboolean __GLEW_APPLE_aux_depth_stencil = GL_FALSE; GLboolean __GLEW_APPLE_client_storage = GL_FALSE; GLboolean __GLEW_APPLE_element_array = GL_FALSE; GLboolean __GLEW_APPLE_fence = GL_FALSE; GLboolean __GLEW_APPLE_float_pixels = GL_FALSE; GLboolean __GLEW_APPLE_flush_buffer_range = GL_FALSE; +GLboolean __GLEW_APPLE_object_purgeable = GL_FALSE; GLboolean __GLEW_APPLE_pixel_buffer = GL_FALSE; +GLboolean __GLEW_APPLE_rgb_422 = GL_FALSE; +GLboolean __GLEW_APPLE_row_bytes = GL_FALSE; GLboolean __GLEW_APPLE_specular_vector = GL_FALSE; GLboolean __GLEW_APPLE_texture_range = GL_FALSE; GLboolean __GLEW_APPLE_transform_hint = GL_FALSE; GLboolean __GLEW_APPLE_vertex_array_object = GL_FALSE; GLboolean __GLEW_APPLE_vertex_array_range = GL_FALSE; +GLboolean __GLEW_APPLE_vertex_program_evaluators = GL_FALSE; GLboolean __GLEW_APPLE_ycbcr_422 = GL_FALSE; GLboolean __GLEW_ARB_color_buffer_float = GL_FALSE; +GLboolean __GLEW_ARB_compatibility = GL_FALSE; +GLboolean __GLEW_ARB_copy_buffer = GL_FALSE; GLboolean __GLEW_ARB_depth_buffer_float = GL_FALSE; +GLboolean __GLEW_ARB_depth_clamp = GL_FALSE; GLboolean __GLEW_ARB_depth_texture = GL_FALSE; GLboolean __GLEW_ARB_draw_buffers = GL_FALSE; +GLboolean __GLEW_ARB_draw_buffers_blend = GL_FALSE; +GLboolean __GLEW_ARB_draw_elements_base_vertex = GL_FALSE; GLboolean __GLEW_ARB_draw_instanced = GL_FALSE; +GLboolean __GLEW_ARB_fragment_coord_conventions = GL_FALSE; GLboolean __GLEW_ARB_fragment_program = GL_FALSE; GLboolean __GLEW_ARB_fragment_program_shadow = GL_FALSE; GLboolean __GLEW_ARB_fragment_shader = GL_FALSE; @@ -1887,25 +2072,36 @@ GLboolean __GLEW_ARB_occlusion_query = GL_FALSE; GLboolean __GLEW_ARB_pixel_buffer_object = GL_FALSE; GLboolean __GLEW_ARB_point_parameters = GL_FALSE; GLboolean __GLEW_ARB_point_sprite = GL_FALSE; +GLboolean __GLEW_ARB_provoking_vertex = GL_FALSE; +GLboolean __GLEW_ARB_sample_shading = GL_FALSE; +GLboolean __GLEW_ARB_seamless_cube_map = GL_FALSE; GLboolean __GLEW_ARB_shader_objects = GL_FALSE; +GLboolean __GLEW_ARB_shader_texture_lod = GL_FALSE; GLboolean __GLEW_ARB_shading_language_100 = GL_FALSE; GLboolean __GLEW_ARB_shadow = GL_FALSE; GLboolean __GLEW_ARB_shadow_ambient = GL_FALSE; +GLboolean __GLEW_ARB_sync = GL_FALSE; GLboolean __GLEW_ARB_texture_border_clamp = GL_FALSE; GLboolean __GLEW_ARB_texture_buffer_object = GL_FALSE; GLboolean __GLEW_ARB_texture_compression = GL_FALSE; GLboolean __GLEW_ARB_texture_compression_rgtc = GL_FALSE; GLboolean __GLEW_ARB_texture_cube_map = GL_FALSE; +GLboolean __GLEW_ARB_texture_cube_map_array = GL_FALSE; GLboolean __GLEW_ARB_texture_env_add = GL_FALSE; GLboolean __GLEW_ARB_texture_env_combine = GL_FALSE; GLboolean __GLEW_ARB_texture_env_crossbar = GL_FALSE; GLboolean __GLEW_ARB_texture_env_dot3 = GL_FALSE; GLboolean __GLEW_ARB_texture_float = GL_FALSE; +GLboolean __GLEW_ARB_texture_gather = GL_FALSE; GLboolean __GLEW_ARB_texture_mirrored_repeat = GL_FALSE; +GLboolean __GLEW_ARB_texture_multisample = GL_FALSE; GLboolean __GLEW_ARB_texture_non_power_of_two = GL_FALSE; +GLboolean __GLEW_ARB_texture_query_lod = GL_FALSE; GLboolean __GLEW_ARB_texture_rectangle = GL_FALSE; GLboolean __GLEW_ARB_texture_rg = GL_FALSE; GLboolean __GLEW_ARB_transpose_matrix = GL_FALSE; +GLboolean __GLEW_ARB_uniform_buffer_object = GL_FALSE; +GLboolean __GLEW_ARB_vertex_array_bgra = GL_FALSE; GLboolean __GLEW_ARB_vertex_array_object = GL_FALSE; GLboolean __GLEW_ARB_vertex_blend = GL_FALSE; GLboolean __GLEW_ARB_vertex_buffer_object = GL_FALSE; @@ -1921,6 +2117,7 @@ GLboolean __GLEW_ATI_element_array = GL_FALSE; GLboolean __GLEW_ATI_envmap_bumpmap = GL_FALSE; GLboolean __GLEW_ATI_fragment_shader = GL_FALSE; GLboolean __GLEW_ATI_map_object_buffer = GL_FALSE; +GLboolean __GLEW_ATI_meminfo = GL_FALSE; GLboolean __GLEW_ATI_pn_triangles = GL_FALSE; GLboolean __GLEW_ATI_separate_stencil = GL_FALSE; GLboolean __GLEW_ATI_shader_texture_lod = GL_FALSE; @@ -1983,9 +2180,11 @@ GLboolean __GLEW_EXT_pixel_transform = GL_FALSE; GLboolean __GLEW_EXT_pixel_transform_color_table = GL_FALSE; GLboolean __GLEW_EXT_point_parameters = GL_FALSE; GLboolean __GLEW_EXT_polygon_offset = GL_FALSE; +GLboolean __GLEW_EXT_provoking_vertex = GL_FALSE; GLboolean __GLEW_EXT_rescale_normal = GL_FALSE; GLboolean __GLEW_EXT_scene_marker = GL_FALSE; GLboolean __GLEW_EXT_secondary_color = GL_FALSE; +GLboolean __GLEW_EXT_separate_shader_objects = GL_FALSE; GLboolean __GLEW_EXT_separate_specular_color = GL_FALSE; GLboolean __GLEW_EXT_shadow_funcs = GL_FALSE; GLboolean __GLEW_EXT_shared_texture_palette = GL_FALSE; @@ -2016,6 +2215,7 @@ GLboolean __GLEW_EXT_texture_perturb_normal = GL_FALSE; GLboolean __GLEW_EXT_texture_rectangle = GL_FALSE; GLboolean __GLEW_EXT_texture_sRGB = GL_FALSE; GLboolean __GLEW_EXT_texture_shared_exponent = GL_FALSE; +GLboolean __GLEW_EXT_texture_snorm = GL_FALSE; GLboolean __GLEW_EXT_texture_swizzle = GL_FALSE; GLboolean __GLEW_EXT_timer_query = GL_FALSE; GLboolean __GLEW_EXT_transform_feedback = GL_FALSE; @@ -2048,6 +2248,7 @@ GLboolean __GLEW_MESA_ycbcr_texture = GL_FALSE; GLboolean __GLEW_NV_blend_square = GL_FALSE; GLboolean __GLEW_NV_conditional_render = GL_FALSE; GLboolean __GLEW_NV_copy_depth_to_color = GL_FALSE; +GLboolean __GLEW_NV_copy_image = GL_FALSE; GLboolean __GLEW_NV_depth_buffer_float = GL_FALSE; GLboolean __GLEW_NV_depth_clamp = GL_FALSE; GLboolean __GLEW_NV_depth_range_unclamped = GL_FALSE; @@ -2070,14 +2271,17 @@ GLboolean __GLEW_NV_multisample_filter_hint = GL_FALSE; GLboolean __GLEW_NV_occlusion_query = GL_FALSE; GLboolean __GLEW_NV_packed_depth_stencil = GL_FALSE; GLboolean __GLEW_NV_parameter_buffer_object = GL_FALSE; +GLboolean __GLEW_NV_parameter_buffer_object2 = GL_FALSE; GLboolean __GLEW_NV_pixel_data_range = GL_FALSE; GLboolean __GLEW_NV_point_sprite = GL_FALSE; GLboolean __GLEW_NV_present_video = GL_FALSE; GLboolean __GLEW_NV_primitive_restart = GL_FALSE; GLboolean __GLEW_NV_register_combiners = GL_FALSE; GLboolean __GLEW_NV_register_combiners2 = GL_FALSE; +GLboolean __GLEW_NV_shader_buffer_load = GL_FALSE; GLboolean __GLEW_NV_texgen_emboss = GL_FALSE; GLboolean __GLEW_NV_texgen_reflection = GL_FALSE; +GLboolean __GLEW_NV_texture_barrier = GL_FALSE; GLboolean __GLEW_NV_texture_compression_vtc = GL_FALSE; GLboolean __GLEW_NV_texture_env_combine4 = GL_FALSE; GLboolean __GLEW_NV_texture_expand_normal = GL_FALSE; @@ -2086,8 +2290,10 @@ GLboolean __GLEW_NV_texture_shader = GL_FALSE; GLboolean __GLEW_NV_texture_shader2 = GL_FALSE; GLboolean __GLEW_NV_texture_shader3 = GL_FALSE; GLboolean __GLEW_NV_transform_feedback = GL_FALSE; +GLboolean __GLEW_NV_transform_feedback2 = GL_FALSE; GLboolean __GLEW_NV_vertex_array_range = GL_FALSE; GLboolean __GLEW_NV_vertex_array_range2 = GL_FALSE; +GLboolean __GLEW_NV_vertex_buffer_unified_memory = GL_FALSE; GLboolean __GLEW_NV_vertex_program = GL_FALSE; GLboolean __GLEW_NV_vertex_program1_1 = GL_FALSE; GLboolean __GLEW_NV_vertex_program2 = GL_FALSE; @@ -2463,8 +2669,6 @@ static GLboolean _glewInit_GL_VERSION_3_0 (GLEW_CONTEXT_ARG_DEF_INIT) r = ((glBeginConditionalRender = (PFNGLBEGINCONDITIONALRENDERPROC)glewGetProcAddress((const GLubyte*)"glBeginConditionalRender")) == NULL) || r; r = ((glBeginTransformFeedback = (PFNGLBEGINTRANSFORMFEEDBACKPROC)glewGetProcAddress((const GLubyte*)"glBeginTransformFeedback")) == NULL) || r; - r = ((glBindBufferBase = (PFNGLBINDBUFFERBASEPROC)glewGetProcAddress((const GLubyte*)"glBindBufferBase")) == NULL) || r; - r = ((glBindBufferRange = (PFNGLBINDBUFFERRANGEPROC)glewGetProcAddress((const GLubyte*)"glBindBufferRange")) == NULL) || r; r = ((glBindFragDataLocation = (PFNGLBINDFRAGDATALOCATIONPROC)glewGetProcAddress((const GLubyte*)"glBindFragDataLocation")) == NULL) || r; r = ((glClampColor = (PFNGLCLAMPCOLORPROC)glewGetProcAddress((const GLubyte*)"glClampColor")) == NULL) || r; r = ((glClearBufferfi = (PFNGLCLEARBUFFERFIPROC)glewGetProcAddress((const GLubyte*)"glClearBufferfi")) == NULL) || r; @@ -2478,7 +2682,6 @@ static GLboolean _glewInit_GL_VERSION_3_0 (GLEW_CONTEXT_ARG_DEF_INIT) r = ((glEndTransformFeedback = (PFNGLENDTRANSFORMFEEDBACKPROC)glewGetProcAddress((const GLubyte*)"glEndTransformFeedback")) == NULL) || r; r = ((glGetBooleani_v = (PFNGLGETBOOLEANI_VPROC)glewGetProcAddress((const GLubyte*)"glGetBooleani_v")) == NULL) || r; r = ((glGetFragDataLocation = (PFNGLGETFRAGDATALOCATIONPROC)glewGetProcAddress((const GLubyte*)"glGetFragDataLocation")) == NULL) || r; - r = ((glGetIntegeri_v = (PFNGLGETINTEGERI_VPROC)glewGetProcAddress((const GLubyte*)"glGetIntegeri_v")) == NULL) || r; r = ((glGetStringi = (PFNGLGETSTRINGIPROC)glewGetProcAddress((const GLubyte*)"glGetStringi")) == NULL) || r; r = ((glGetTexParameterIiv = (PFNGLGETTEXPARAMETERIIVPROC)glewGetProcAddress((const GLubyte*)"glGetTexParameterIiv")) == NULL) || r; r = ((glGetTexParameterIuiv = (PFNGLGETTEXPARAMETERIUIVPROC)glewGetProcAddress((const GLubyte*)"glGetTexParameterIuiv")) == NULL) || r; @@ -2525,6 +2728,37 @@ static GLboolean _glewInit_GL_VERSION_3_0 (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_VERSION_3_0 */ +#ifdef GL_VERSION_3_1 + +static GLboolean _glewInit_GL_VERSION_3_1 (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glDrawArraysInstanced = (PFNGLDRAWARRAYSINSTANCEDPROC)glewGetProcAddress((const GLubyte*)"glDrawArraysInstanced")) == NULL) || r; + r = ((glDrawElementsInstanced = (PFNGLDRAWELEMENTSINSTANCEDPROC)glewGetProcAddress((const GLubyte*)"glDrawElementsInstanced")) == NULL) || r; + r = ((glPrimitiveRestartIndex = (PFNGLPRIMITIVERESTARTINDEXPROC)glewGetProcAddress((const GLubyte*)"glPrimitiveRestartIndex")) == NULL) || r; + r = ((glTexBuffer = (PFNGLTEXBUFFERPROC)glewGetProcAddress((const GLubyte*)"glTexBuffer")) == NULL) || r; + + return r; +} + +#endif /* GL_VERSION_3_1 */ + +#ifdef GL_VERSION_3_2 + +static GLboolean _glewInit_GL_VERSION_3_2 (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glFramebufferTexture = (PFNGLFRAMEBUFFERTEXTUREPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture")) == NULL) || r; + r = ((glGetBufferParameteri64v = (PFNGLGETBUFFERPARAMETERI64VPROC)glewGetProcAddress((const GLubyte*)"glGetBufferParameteri64v")) == NULL) || r; + r = ((glGetInteger64i_v = (PFNGLGETINTEGER64I_VPROC)glewGetProcAddress((const GLubyte*)"glGetInteger64i_v")) == NULL) || r; + + return r; +} + +#endif /* GL_VERSION_3_2 */ + #ifdef GL_3DFX_multisample #endif /* GL_3DFX_multisample */ @@ -2546,6 +2780,67 @@ static GLboolean _glewInit_GL_3DFX_tbuffer (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_3DFX_texture_compression_FXT1 */ +#ifdef GL_AMD_draw_buffers_blend + +static GLboolean _glewInit_GL_AMD_draw_buffers_blend (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBlendEquationIndexedAMD = (PFNGLBLENDEQUATIONINDEXEDAMDPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationIndexedAMD")) == NULL) || r; + r = ((glBlendEquationSeparateIndexedAMD = (PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationSeparateIndexedAMD")) == NULL) || r; + r = ((glBlendFuncIndexedAMD = (PFNGLBLENDFUNCINDEXEDAMDPROC)glewGetProcAddress((const GLubyte*)"glBlendFuncIndexedAMD")) == NULL) || r; + r = ((glBlendFuncSeparateIndexedAMD = (PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC)glewGetProcAddress((const GLubyte*)"glBlendFuncSeparateIndexedAMD")) == NULL) || r; + + return r; +} + +#endif /* GL_AMD_draw_buffers_blend */ + +#ifdef GL_AMD_performance_monitor + +static GLboolean _glewInit_GL_AMD_performance_monitor (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBeginPerfMonitorAMD = (PFNGLBEGINPERFMONITORAMDPROC)glewGetProcAddress((const GLubyte*)"glBeginPerfMonitorAMD")) == NULL) || r; + r = ((glDeletePerfMonitorsAMD = (PFNGLDELETEPERFMONITORSAMDPROC)glewGetProcAddress((const GLubyte*)"glDeletePerfMonitorsAMD")) == NULL) || r; + r = ((glEndPerfMonitorAMD = (PFNGLENDPERFMONITORAMDPROC)glewGetProcAddress((const GLubyte*)"glEndPerfMonitorAMD")) == NULL) || r; + r = ((glGenPerfMonitorsAMD = (PFNGLGENPERFMONITORSAMDPROC)glewGetProcAddress((const GLubyte*)"glGenPerfMonitorsAMD")) == NULL) || r; + r = ((glGetPerfMonitorCounterDataAMD = (PFNGLGETPERFMONITORCOUNTERDATAAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorCounterDataAMD")) == NULL) || r; + r = ((glGetPerfMonitorCounterInfoAMD = (PFNGLGETPERFMONITORCOUNTERINFOAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorCounterInfoAMD")) == NULL) || r; + r = ((glGetPerfMonitorCounterStringAMD = (PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorCounterStringAMD")) == NULL) || r; + r = ((glGetPerfMonitorCountersAMD = (PFNGLGETPERFMONITORCOUNTERSAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorCountersAMD")) == NULL) || r; + r = ((glGetPerfMonitorGroupStringAMD = (PFNGLGETPERFMONITORGROUPSTRINGAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorGroupStringAMD")) == NULL) || r; + r = ((glGetPerfMonitorGroupsAMD = (PFNGLGETPERFMONITORGROUPSAMDPROC)glewGetProcAddress((const GLubyte*)"glGetPerfMonitorGroupsAMD")) == NULL) || r; + r = ((glSelectPerfMonitorCountersAMD = (PFNGLSELECTPERFMONITORCOUNTERSAMDPROC)glewGetProcAddress((const GLubyte*)"glSelectPerfMonitorCountersAMD")) == NULL) || r; + + return r; +} + +#endif /* GL_AMD_performance_monitor */ + +#ifdef GL_AMD_texture_texture4 + +#endif /* GL_AMD_texture_texture4 */ + +#ifdef GL_AMD_vertex_shader_tessellator + +static GLboolean _glewInit_GL_AMD_vertex_shader_tessellator (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glTessellationFactorAMD = (PFNGLTESSELLATIONFACTORAMDPROC)glewGetProcAddress((const GLubyte*)"glTessellationFactorAMD")) == NULL) || r; + r = ((glTessellationModeAMD = (PFNGLTESSELLATIONMODEAMDPROC)glewGetProcAddress((const GLubyte*)"glTessellationModeAMD")) == NULL) || r; + + return r; +} + +#endif /* GL_AMD_vertex_shader_tessellator */ + +#ifdef GL_APPLE_aux_depth_stencil + +#endif /* GL_APPLE_aux_depth_stencil */ + #ifdef GL_APPLE_client_storage #endif /* GL_APPLE_client_storage */ @@ -2605,10 +2900,33 @@ static GLboolean _glewInit_GL_APPLE_flush_buffer_range (GLEW_CONTEXT_ARG_DEF_INI #endif /* GL_APPLE_flush_buffer_range */ +#ifdef GL_APPLE_object_purgeable + +static GLboolean _glewInit_GL_APPLE_object_purgeable (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glGetObjectParameterivAPPLE = (PFNGLGETOBJECTPARAMETERIVAPPLEPROC)glewGetProcAddress((const GLubyte*)"glGetObjectParameterivAPPLE")) == NULL) || r; + r = ((glObjectPurgeableAPPLE = (PFNGLOBJECTPURGEABLEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glObjectPurgeableAPPLE")) == NULL) || r; + r = ((glObjectUnpurgeableAPPLE = (PFNGLOBJECTUNPURGEABLEAPPLEPROC)glewGetProcAddress((const GLubyte*)"glObjectUnpurgeableAPPLE")) == NULL) || r; + + return r; +} + +#endif /* GL_APPLE_object_purgeable */ + #ifdef GL_APPLE_pixel_buffer #endif /* GL_APPLE_pixel_buffer */ +#ifdef GL_APPLE_rgb_422 + +#endif /* GL_APPLE_rgb_422 */ + +#ifdef GL_APPLE_row_bytes + +#endif /* GL_APPLE_row_bytes */ + #ifdef GL_APPLE_specular_vector #endif /* GL_APPLE_specular_vector */ @@ -2662,6 +2980,25 @@ static GLboolean _glewInit_GL_APPLE_vertex_array_range (GLEW_CONTEXT_ARG_DEF_INI #endif /* GL_APPLE_vertex_array_range */ +#ifdef GL_APPLE_vertex_program_evaluators + +static GLboolean _glewInit_GL_APPLE_vertex_program_evaluators (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glDisableVertexAttribAPPLE = (PFNGLDISABLEVERTEXATTRIBAPPLEPROC)glewGetProcAddress((const GLubyte*)"glDisableVertexAttribAPPLE")) == NULL) || r; + r = ((glEnableVertexAttribAPPLE = (PFNGLENABLEVERTEXATTRIBAPPLEPROC)glewGetProcAddress((const GLubyte*)"glEnableVertexAttribAPPLE")) == NULL) || r; + r = ((glIsVertexAttribEnabledAPPLE = (PFNGLISVERTEXATTRIBENABLEDAPPLEPROC)glewGetProcAddress((const GLubyte*)"glIsVertexAttribEnabledAPPLE")) == NULL) || r; + r = ((glMapVertexAttrib1dAPPLE = (PFNGLMAPVERTEXATTRIB1DAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMapVertexAttrib1dAPPLE")) == NULL) || r; + r = ((glMapVertexAttrib1fAPPLE = (PFNGLMAPVERTEXATTRIB1FAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMapVertexAttrib1fAPPLE")) == NULL) || r; + r = ((glMapVertexAttrib2dAPPLE = (PFNGLMAPVERTEXATTRIB2DAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMapVertexAttrib2dAPPLE")) == NULL) || r; + r = ((glMapVertexAttrib2fAPPLE = (PFNGLMAPVERTEXATTRIB2FAPPLEPROC)glewGetProcAddress((const GLubyte*)"glMapVertexAttrib2fAPPLE")) == NULL) || r; + + return r; +} + +#endif /* GL_APPLE_vertex_program_evaluators */ + #ifdef GL_APPLE_ycbcr_422 #endif /* GL_APPLE_ycbcr_422 */ @@ -2679,10 +3016,31 @@ static GLboolean _glewInit_GL_ARB_color_buffer_float (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_color_buffer_float */ +#ifdef GL_ARB_compatibility + +#endif /* GL_ARB_compatibility */ + +#ifdef GL_ARB_copy_buffer + +static GLboolean _glewInit_GL_ARB_copy_buffer (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glCopyBufferSubData = (PFNGLCOPYBUFFERSUBDATAPROC)glewGetProcAddress((const GLubyte*)"glCopyBufferSubData")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_copy_buffer */ + #ifdef GL_ARB_depth_buffer_float #endif /* GL_ARB_depth_buffer_float */ +#ifdef GL_ARB_depth_clamp + +#endif /* GL_ARB_depth_clamp */ + #ifdef GL_ARB_depth_texture #endif /* GL_ARB_depth_texture */ @@ -2700,6 +3058,38 @@ static GLboolean _glewInit_GL_ARB_draw_buffers (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_draw_buffers */ +#ifdef GL_ARB_draw_buffers_blend + +static GLboolean _glewInit_GL_ARB_draw_buffers_blend (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBlendEquationSeparateiARB = (PFNGLBLENDEQUATIONSEPARATEIARBPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationSeparateiARB")) == NULL) || r; + r = ((glBlendEquationiARB = (PFNGLBLENDEQUATIONIARBPROC)glewGetProcAddress((const GLubyte*)"glBlendEquationiARB")) == NULL) || r; + r = ((glBlendFuncSeparateiARB = (PFNGLBLENDFUNCSEPARATEIARBPROC)glewGetProcAddress((const GLubyte*)"glBlendFuncSeparateiARB")) == NULL) || r; + r = ((glBlendFunciARB = (PFNGLBLENDFUNCIARBPROC)glewGetProcAddress((const GLubyte*)"glBlendFunciARB")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_draw_buffers_blend */ + +#ifdef GL_ARB_draw_elements_base_vertex + +static GLboolean _glewInit_GL_ARB_draw_elements_base_vertex (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glDrawElementsBaseVertex = (PFNGLDRAWELEMENTSBASEVERTEXPROC)glewGetProcAddress((const GLubyte*)"glDrawElementsBaseVertex")) == NULL) || r; + r = ((glDrawElementsInstancedBaseVertex = (PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC)glewGetProcAddress((const GLubyte*)"glDrawElementsInstancedBaseVertex")) == NULL) || r; + r = ((glDrawRangeElementsBaseVertex = (PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC)glewGetProcAddress((const GLubyte*)"glDrawRangeElementsBaseVertex")) == NULL) || r; + r = ((glMultiDrawElementsBaseVertex = (PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC)glewGetProcAddress((const GLubyte*)"glMultiDrawElementsBaseVertex")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_draw_elements_base_vertex */ + #ifdef GL_ARB_draw_instanced static GLboolean _glewInit_GL_ARB_draw_instanced (GLEW_CONTEXT_ARG_DEF_INIT) @@ -2714,6 +3104,10 @@ static GLboolean _glewInit_GL_ARB_draw_instanced (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_draw_instanced */ +#ifdef GL_ARB_fragment_coord_conventions + +#endif /* GL_ARB_fragment_coord_conventions */ + #ifdef GL_ARB_fragment_program #endif /* GL_ARB_fragment_program */ @@ -2739,10 +3133,10 @@ static GLboolean _glewInit_GL_ARB_framebuffer_object (GLEW_CONTEXT_ARG_DEF_INIT) r = ((glDeleteFramebuffers = (PFNGLDELETEFRAMEBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glDeleteFramebuffers")) == NULL) || r; r = ((glDeleteRenderbuffers = (PFNGLDELETERENDERBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glDeleteRenderbuffers")) == NULL) || r; r = ((glFramebufferRenderbuffer = (PFNGLFRAMEBUFFERRENDERBUFFERPROC)glewGetProcAddress((const GLubyte*)"glFramebufferRenderbuffer")) == NULL) || r; - r = ((glFramebufferTextureLayer = (PFNGLFRAMEBUFFERTEXTURELAYERPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTextureLayer")) == NULL) || r; r = ((glFramebufferTexture1D = (PFNGLFRAMEBUFFERTEXTURE1DPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture1D")) == NULL) || r; r = ((glFramebufferTexture2D = (PFNGLFRAMEBUFFERTEXTURE2DPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture2D")) == NULL) || r; r = ((glFramebufferTexture3D = (PFNGLFRAMEBUFFERTEXTURE3DPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTexture3D")) == NULL) || r; + r = ((glFramebufferTextureLayer = (PFNGLFRAMEBUFFERTEXTURELAYERPROC)glewGetProcAddress((const GLubyte*)"glFramebufferTextureLayer")) == NULL) || r; r = ((glGenFramebuffers = (PFNGLGENFRAMEBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glGenFramebuffers")) == NULL) || r; r = ((glGenRenderbuffers = (PFNGLGENRENDERBUFFERSPROC)glewGetProcAddress((const GLubyte*)"glGenRenderbuffers")) == NULL) || r; r = ((glGenerateMipmap = (PFNGLGENERATEMIPMAPPROC)glewGetProcAddress((const GLubyte*)"glGenerateMipmap")) == NULL) || r; @@ -2976,6 +3370,36 @@ static GLboolean _glewInit_GL_ARB_point_parameters (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_point_sprite */ +#ifdef GL_ARB_provoking_vertex + +static GLboolean _glewInit_GL_ARB_provoking_vertex (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glProvokingVertex = (PFNGLPROVOKINGVERTEXPROC)glewGetProcAddress((const GLubyte*)"glProvokingVertex")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_provoking_vertex */ + +#ifdef GL_ARB_sample_shading + +static GLboolean _glewInit_GL_ARB_sample_shading (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glMinSampleShadingARB = (PFNGLMINSAMPLESHADINGARBPROC)glewGetProcAddress((const GLubyte*)"glMinSampleShadingARB")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_sample_shading */ + +#ifdef GL_ARB_seamless_cube_map + +#endif /* GL_ARB_seamless_cube_map */ + #ifdef GL_ARB_shader_objects static GLboolean _glewInit_GL_ARB_shader_objects (GLEW_CONTEXT_ARG_DEF_INIT) @@ -3027,6 +3451,10 @@ static GLboolean _glewInit_GL_ARB_shader_objects (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_shader_objects */ +#ifdef GL_ARB_shader_texture_lod + +#endif /* GL_ARB_shader_texture_lod */ + #ifdef GL_ARB_shading_language_100 #endif /* GL_ARB_shading_language_100 */ @@ -3039,6 +3467,25 @@ static GLboolean _glewInit_GL_ARB_shader_objects (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_shadow_ambient */ +#ifdef GL_ARB_sync + +static GLboolean _glewInit_GL_ARB_sync (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glClientWaitSync = (PFNGLCLIENTWAITSYNCPROC)glewGetProcAddress((const GLubyte*)"glClientWaitSync")) == NULL) || r; + r = ((glDeleteSync = (PFNGLDELETESYNCPROC)glewGetProcAddress((const GLubyte*)"glDeleteSync")) == NULL) || r; + r = ((glFenceSync = (PFNGLFENCESYNCPROC)glewGetProcAddress((const GLubyte*)"glFenceSync")) == NULL) || r; + r = ((glGetInteger64v = (PFNGLGETINTEGER64VPROC)glewGetProcAddress((const GLubyte*)"glGetInteger64v")) == NULL) || r; + r = ((glGetSynciv = (PFNGLGETSYNCIVPROC)glewGetProcAddress((const GLubyte*)"glGetSynciv")) == NULL) || r; + r = ((glIsSync = (PFNGLISSYNCPROC)glewGetProcAddress((const GLubyte*)"glIsSync")) == NULL) || r; + r = ((glWaitSync = (PFNGLWAITSYNCPROC)glewGetProcAddress((const GLubyte*)"glWaitSync")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_sync */ + #ifdef GL_ARB_texture_border_clamp #endif /* GL_ARB_texture_border_clamp */ @@ -3083,6 +3530,10 @@ static GLboolean _glewInit_GL_ARB_texture_compression (GLEW_CONTEXT_ARG_DEF_INIT #endif /* GL_ARB_texture_cube_map */ +#ifdef GL_ARB_texture_cube_map_array + +#endif /* GL_ARB_texture_cube_map_array */ + #ifdef GL_ARB_texture_env_add #endif /* GL_ARB_texture_env_add */ @@ -3103,14 +3554,38 @@ static GLboolean _glewInit_GL_ARB_texture_compression (GLEW_CONTEXT_ARG_DEF_INIT #endif /* GL_ARB_texture_float */ +#ifdef GL_ARB_texture_gather + +#endif /* GL_ARB_texture_gather */ + #ifdef GL_ARB_texture_mirrored_repeat #endif /* GL_ARB_texture_mirrored_repeat */ +#ifdef GL_ARB_texture_multisample + +static GLboolean _glewInit_GL_ARB_texture_multisample (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glGetMultisamplefv = (PFNGLGETMULTISAMPLEFVPROC)glewGetProcAddress((const GLubyte*)"glGetMultisamplefv")) == NULL) || r; + r = ((glSampleMaski = (PFNGLSAMPLEMASKIPROC)glewGetProcAddress((const GLubyte*)"glSampleMaski")) == NULL) || r; + r = ((glTexImage2DMultisample = (PFNGLTEXIMAGE2DMULTISAMPLEPROC)glewGetProcAddress((const GLubyte*)"glTexImage2DMultisample")) == NULL) || r; + r = ((glTexImage3DMultisample = (PFNGLTEXIMAGE3DMULTISAMPLEPROC)glewGetProcAddress((const GLubyte*)"glTexImage3DMultisample")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_texture_multisample */ + #ifdef GL_ARB_texture_non_power_of_two #endif /* GL_ARB_texture_non_power_of_two */ +#ifdef GL_ARB_texture_query_lod + +#endif /* GL_ARB_texture_query_lod */ + #ifdef GL_ARB_texture_rectangle #endif /* GL_ARB_texture_rectangle */ @@ -3135,6 +3610,32 @@ static GLboolean _glewInit_GL_ARB_transpose_matrix (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ARB_transpose_matrix */ +#ifdef GL_ARB_uniform_buffer_object + +static GLboolean _glewInit_GL_ARB_uniform_buffer_object (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBindBufferBase = (PFNGLBINDBUFFERBASEPROC)glewGetProcAddress((const GLubyte*)"glBindBufferBase")) == NULL) || r; + r = ((glBindBufferRange = (PFNGLBINDBUFFERRANGEPROC)glewGetProcAddress((const GLubyte*)"glBindBufferRange")) == NULL) || r; + r = ((glGetActiveUniformBlockName = (PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniformBlockName")) == NULL) || r; + r = ((glGetActiveUniformBlockiv = (PFNGLGETACTIVEUNIFORMBLOCKIVPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniformBlockiv")) == NULL) || r; + r = ((glGetActiveUniformName = (PFNGLGETACTIVEUNIFORMNAMEPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniformName")) == NULL) || r; + r = ((glGetActiveUniformsiv = (PFNGLGETACTIVEUNIFORMSIVPROC)glewGetProcAddress((const GLubyte*)"glGetActiveUniformsiv")) == NULL) || r; + r = ((glGetIntegeri_v = (PFNGLGETINTEGERI_VPROC)glewGetProcAddress((const GLubyte*)"glGetIntegeri_v")) == NULL) || r; + r = ((glGetUniformBlockIndex = (PFNGLGETUNIFORMBLOCKINDEXPROC)glewGetProcAddress((const GLubyte*)"glGetUniformBlockIndex")) == NULL) || r; + r = ((glGetUniformIndices = (PFNGLGETUNIFORMINDICESPROC)glewGetProcAddress((const GLubyte*)"glGetUniformIndices")) == NULL) || r; + r = ((glUniformBlockBinding = (PFNGLUNIFORMBLOCKBINDINGPROC)glewGetProcAddress((const GLubyte*)"glUniformBlockBinding")) == NULL) || r; + + return r; +} + +#endif /* GL_ARB_uniform_buffer_object */ + +#ifdef GL_ARB_vertex_array_bgra + +#endif /* GL_ARB_vertex_array_bgra */ + #ifdef GL_ARB_vertex_array_object static GLboolean _glewInit_GL_ARB_vertex_array_object (GLEW_CONTEXT_ARG_DEF_INIT) @@ -3413,6 +3914,10 @@ static GLboolean _glewInit_GL_ATI_map_object_buffer (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_ATI_map_object_buffer */ +#ifdef GL_ATI_meminfo + +#endif /* GL_ATI_meminfo */ + #ifdef GL_ATI_pn_triangles static GLboolean _glewInit_GL_ATI_pn_triangles (GLEW_CONTEXT_ARG_DEF_INIT) @@ -3795,7 +4300,14 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glCopyTextureSubImage2DEXT = (PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTextureSubImage2DEXT")) == NULL) || r; r = ((glCopyTextureSubImage3DEXT = (PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glCopyTextureSubImage3DEXT")) == NULL) || r; r = ((glDisableClientStateIndexedEXT = (PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC)glewGetProcAddress((const GLubyte*)"glDisableClientStateIndexedEXT")) == NULL) || r; + r = ((glDisableClientStateiEXT = (PFNGLDISABLECLIENTSTATEIEXTPROC)glewGetProcAddress((const GLubyte*)"glDisableClientStateiEXT")) == NULL) || r; + r = ((glDisableVertexArrayAttribEXT = (PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC)glewGetProcAddress((const GLubyte*)"glDisableVertexArrayAttribEXT")) == NULL) || r; + r = ((glDisableVertexArrayEXT = (PFNGLDISABLEVERTEXARRAYEXTPROC)glewGetProcAddress((const GLubyte*)"glDisableVertexArrayEXT")) == NULL) || r; r = ((glEnableClientStateIndexedEXT = (PFNGLENABLECLIENTSTATEINDEXEDEXTPROC)glewGetProcAddress((const GLubyte*)"glEnableClientStateIndexedEXT")) == NULL) || r; + r = ((glEnableClientStateiEXT = (PFNGLENABLECLIENTSTATEIEXTPROC)glewGetProcAddress((const GLubyte*)"glEnableClientStateiEXT")) == NULL) || r; + r = ((glEnableVertexArrayAttribEXT = (PFNGLENABLEVERTEXARRAYATTRIBEXTPROC)glewGetProcAddress((const GLubyte*)"glEnableVertexArrayAttribEXT")) == NULL) || r; + r = ((glEnableVertexArrayEXT = (PFNGLENABLEVERTEXARRAYEXTPROC)glewGetProcAddress((const GLubyte*)"glEnableVertexArrayEXT")) == NULL) || r; + r = ((glFlushMappedNamedBufferRangeEXT = (PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC)glewGetProcAddress((const GLubyte*)"glFlushMappedNamedBufferRangeEXT")) == NULL) || r; r = ((glFramebufferDrawBufferEXT = (PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferDrawBufferEXT")) == NULL) || r; r = ((glFramebufferDrawBuffersEXT = (PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferDrawBuffersEXT")) == NULL) || r; r = ((glFramebufferReadBufferEXT = (PFNGLFRAMEBUFFERREADBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glFramebufferReadBufferEXT")) == NULL) || r; @@ -3804,7 +4316,9 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glGetCompressedMultiTexImageEXT = (PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC)glewGetProcAddress((const GLubyte*)"glGetCompressedMultiTexImageEXT")) == NULL) || r; r = ((glGetCompressedTextureImageEXT = (PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC)glewGetProcAddress((const GLubyte*)"glGetCompressedTextureImageEXT")) == NULL) || r; r = ((glGetDoubleIndexedvEXT = (PFNGLGETDOUBLEINDEXEDVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetDoubleIndexedvEXT")) == NULL) || r; + r = ((glGetDoublei_vEXT = (PFNGLGETDOUBLEI_VEXTPROC)glewGetProcAddress((const GLubyte*)"glGetDoublei_vEXT")) == NULL) || r; r = ((glGetFloatIndexedvEXT = (PFNGLGETFLOATINDEXEDVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFloatIndexedvEXT")) == NULL) || r; + r = ((glGetFloati_vEXT = (PFNGLGETFLOATI_VEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFloati_vEXT")) == NULL) || r; r = ((glGetFramebufferParameterivEXT = (PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetFramebufferParameterivEXT")) == NULL) || r; r = ((glGetMultiTexEnvfvEXT = (PFNGLGETMULTITEXENVFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetMultiTexEnvfvEXT")) == NULL) || r; r = ((glGetMultiTexEnvivEXT = (PFNGLGETMULTITEXENVIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetMultiTexEnvivEXT")) == NULL) || r; @@ -3830,6 +4344,7 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glGetNamedProgramivEXT = (PFNGLGETNAMEDPROGRAMIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetNamedProgramivEXT")) == NULL) || r; r = ((glGetNamedRenderbufferParameterivEXT = (PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetNamedRenderbufferParameterivEXT")) == NULL) || r; r = ((glGetPointerIndexedvEXT = (PFNGLGETPOINTERINDEXEDVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetPointerIndexedvEXT")) == NULL) || r; + r = ((glGetPointeri_vEXT = (PFNGLGETPOINTERI_VEXTPROC)glewGetProcAddress((const GLubyte*)"glGetPointeri_vEXT")) == NULL) || r; r = ((glGetTextureImageEXT = (PFNGLGETTEXTUREIMAGEEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureImageEXT")) == NULL) || r; r = ((glGetTextureLevelParameterfvEXT = (PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureLevelParameterfvEXT")) == NULL) || r; r = ((glGetTextureLevelParameterivEXT = (PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureLevelParameterivEXT")) == NULL) || r; @@ -3837,7 +4352,12 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glGetTextureParameterIuivEXT = (PFNGLGETTEXTUREPARAMETERIUIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureParameterIuivEXT")) == NULL) || r; r = ((glGetTextureParameterfvEXT = (PFNGLGETTEXTUREPARAMETERFVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureParameterfvEXT")) == NULL) || r; r = ((glGetTextureParameterivEXT = (PFNGLGETTEXTUREPARAMETERIVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetTextureParameterivEXT")) == NULL) || r; + r = ((glGetVertexArrayIntegeri_vEXT = (PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVertexArrayIntegeri_vEXT")) == NULL) || r; + r = ((glGetVertexArrayIntegervEXT = (PFNGLGETVERTEXARRAYINTEGERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVertexArrayIntegervEXT")) == NULL) || r; + r = ((glGetVertexArrayPointeri_vEXT = (PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVertexArrayPointeri_vEXT")) == NULL) || r; + r = ((glGetVertexArrayPointervEXT = (PFNGLGETVERTEXARRAYPOINTERVEXTPROC)glewGetProcAddress((const GLubyte*)"glGetVertexArrayPointervEXT")) == NULL) || r; r = ((glMapNamedBufferEXT = (PFNGLMAPNAMEDBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glMapNamedBufferEXT")) == NULL) || r; + r = ((glMapNamedBufferRangeEXT = (PFNGLMAPNAMEDBUFFERRANGEEXTPROC)glewGetProcAddress((const GLubyte*)"glMapNamedBufferRangeEXT")) == NULL) || r; r = ((glMatrixFrustumEXT = (PFNGLMATRIXFRUSTUMEXTPROC)glewGetProcAddress((const GLubyte*)"glMatrixFrustumEXT")) == NULL) || r; r = ((glMatrixLoadIdentityEXT = (PFNGLMATRIXLOADIDENTITYEXTPROC)glewGetProcAddress((const GLubyte*)"glMatrixLoadIdentityEXT")) == NULL) || r; r = ((glMatrixLoadTransposedEXT = (PFNGLMATRIXLOADTRANSPOSEDEXTPROC)glewGetProcAddress((const GLubyte*)"glMatrixLoadTransposedEXT")) == NULL) || r; @@ -3884,6 +4404,7 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glMultiTexSubImage3DEXT = (PFNGLMULTITEXSUBIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glMultiTexSubImage3DEXT")) == NULL) || r; r = ((glNamedBufferDataEXT = (PFNGLNAMEDBUFFERDATAEXTPROC)glewGetProcAddress((const GLubyte*)"glNamedBufferDataEXT")) == NULL) || r; r = ((glNamedBufferSubDataEXT = (PFNGLNAMEDBUFFERSUBDATAEXTPROC)glewGetProcAddress((const GLubyte*)"glNamedBufferSubDataEXT")) == NULL) || r; + r = ((glNamedCopyBufferSubDataEXT = (PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC)glewGetProcAddress((const GLubyte*)"glNamedCopyBufferSubDataEXT")) == NULL) || r; r = ((glNamedFramebufferRenderbufferEXT = (PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glNamedFramebufferRenderbufferEXT")) == NULL) || r; r = ((glNamedFramebufferTexture1DEXT = (PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC)glewGetProcAddress((const GLubyte*)"glNamedFramebufferTexture1DEXT")) == NULL) || r; r = ((glNamedFramebufferTexture2DEXT = (PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glNamedFramebufferTexture2DEXT")) == NULL) || r; @@ -3955,6 +4476,17 @@ static GLboolean _glewInit_GL_EXT_direct_state_access (GLEW_CONTEXT_ARG_DEF_INIT r = ((glTextureSubImage2DEXT = (PFNGLTEXTURESUBIMAGE2DEXTPROC)glewGetProcAddress((const GLubyte*)"glTextureSubImage2DEXT")) == NULL) || r; r = ((glTextureSubImage3DEXT = (PFNGLTEXTURESUBIMAGE3DEXTPROC)glewGetProcAddress((const GLubyte*)"glTextureSubImage3DEXT")) == NULL) || r; r = ((glUnmapNamedBufferEXT = (PFNGLUNMAPNAMEDBUFFEREXTPROC)glewGetProcAddress((const GLubyte*)"glUnmapNamedBufferEXT")) == NULL) || r; + r = ((glVertexArrayColorOffsetEXT = (PFNGLVERTEXARRAYCOLOROFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayColorOffsetEXT")) == NULL) || r; + r = ((glVertexArrayEdgeFlagOffsetEXT = (PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayEdgeFlagOffsetEXT")) == NULL) || r; + r = ((glVertexArrayFogCoordOffsetEXT = (PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayFogCoordOffsetEXT")) == NULL) || r; + r = ((glVertexArrayIndexOffsetEXT = (PFNGLVERTEXARRAYINDEXOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayIndexOffsetEXT")) == NULL) || r; + r = ((glVertexArrayMultiTexCoordOffsetEXT = (PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayMultiTexCoordOffsetEXT")) == NULL) || r; + r = ((glVertexArrayNormalOffsetEXT = (PFNGLVERTEXARRAYNORMALOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayNormalOffsetEXT")) == NULL) || r; + r = ((glVertexArraySecondaryColorOffsetEXT = (PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArraySecondaryColorOffsetEXT")) == NULL) || r; + r = ((glVertexArrayTexCoordOffsetEXT = (PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayTexCoordOffsetEXT")) == NULL) || r; + r = ((glVertexArrayVertexAttribIOffsetEXT = (PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayVertexAttribIOffsetEXT")) == NULL) || r; + r = ((glVertexArrayVertexAttribOffsetEXT = (PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayVertexAttribOffsetEXT")) == NULL) || r; + r = ((glVertexArrayVertexOffsetEXT = (PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC)glewGetProcAddress((const GLubyte*)"glVertexArrayVertexOffsetEXT")) == NULL) || r; return r; } @@ -4372,6 +4904,19 @@ static GLboolean _glewInit_GL_EXT_polygon_offset (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_EXT_polygon_offset */ +#ifdef GL_EXT_provoking_vertex + +static GLboolean _glewInit_GL_EXT_provoking_vertex (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glProvokingVertexEXT = (PFNGLPROVOKINGVERTEXEXTPROC)glewGetProcAddress((const GLubyte*)"glProvokingVertexEXT")) == NULL) || r; + + return r; +} + +#endif /* GL_EXT_provoking_vertex */ + #ifdef GL_EXT_rescale_normal #endif /* GL_EXT_rescale_normal */ @@ -4419,6 +4964,21 @@ static GLboolean _glewInit_GL_EXT_secondary_color (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_EXT_secondary_color */ +#ifdef GL_EXT_separate_shader_objects + +static GLboolean _glewInit_GL_EXT_separate_shader_objects (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glActiveProgramEXT = (PFNGLACTIVEPROGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glActiveProgramEXT")) == NULL) || r; + r = ((glCreateShaderProgramEXT = (PFNGLCREATESHADERPROGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glCreateShaderProgramEXT")) == NULL) || r; + r = ((glUseShaderProgramEXT = (PFNGLUSESHADERPROGRAMEXTPROC)glewGetProcAddress((const GLubyte*)"glUseShaderProgramEXT")) == NULL) || r; + + return r; +} + +#endif /* GL_EXT_separate_shader_objects */ + #ifdef GL_EXT_separate_specular_color #endif /* GL_EXT_separate_specular_color */ @@ -4614,6 +5174,10 @@ static GLboolean _glewInit_GL_EXT_texture_perturb_normal (GLEW_CONTEXT_ARG_DEF_I #endif /* GL_EXT_texture_shared_exponent */ +#ifdef GL_EXT_texture_snorm + +#endif /* GL_EXT_texture_snorm */ + #ifdef GL_EXT_texture_swizzle #endif /* GL_EXT_texture_swizzle */ @@ -4989,6 +5553,19 @@ static GLboolean _glewInit_GL_NV_conditional_render (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_NV_copy_depth_to_color */ +#ifdef GL_NV_copy_image + +static GLboolean _glewInit_GL_NV_copy_image (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glCopyImageSubDataNV = (PFNGLCOPYIMAGESUBDATANVPROC)glewGetProcAddress((const GLubyte*)"glCopyImageSubDataNV")) == NULL) || r; + + return r; +} + +#endif /* GL_NV_copy_image */ + #ifdef GL_NV_depth_buffer_float static GLboolean _glewInit_GL_NV_depth_buffer_float (GLEW_CONTEXT_ARG_DEF_INIT) @@ -5263,6 +5840,10 @@ static GLboolean _glewInit_GL_NV_parameter_buffer_object (GLEW_CONTEXT_ARG_DEF_I #endif /* GL_NV_parameter_buffer_object */ +#ifdef GL_NV_parameter_buffer_object2 + +#endif /* GL_NV_parameter_buffer_object2 */ + #ifdef GL_NV_pixel_data_range static GLboolean _glewInit_GL_NV_pixel_data_range (GLEW_CONTEXT_ARG_DEF_INIT) @@ -5303,7 +5884,6 @@ static GLboolean _glewInit_GL_NV_present_video (GLEW_CONTEXT_ARG_DEF_INIT) r = ((glGetVideouivNV = (PFNGLGETVIDEOUIVNVPROC)glewGetProcAddress((const GLubyte*)"glGetVideouivNV")) == NULL) || r; r = ((glPresentFrameDualFillNV = (PFNGLPRESENTFRAMEDUALFILLNVPROC)glewGetProcAddress((const GLubyte*)"glPresentFrameDualFillNV")) == NULL) || r; r = ((glPresentFrameKeyedNV = (PFNGLPRESENTFRAMEKEYEDNVPROC)glewGetProcAddress((const GLubyte*)"glPresentFrameKeyedNV")) == NULL) || r; - r = ((glVideoParameterivNV = (PFNGLVIDEOPARAMETERIVNVPROC)glewGetProcAddress((const GLubyte*)"glVideoParameterivNV")) == NULL) || r; return r; } @@ -5363,6 +5943,32 @@ static GLboolean _glewInit_GL_NV_register_combiners2 (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_NV_register_combiners2 */ +#ifdef GL_NV_shader_buffer_load + +static GLboolean _glewInit_GL_NV_shader_buffer_load (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glGetBufferParameterui64vNV = (PFNGLGETBUFFERPARAMETERUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glGetBufferParameterui64vNV")) == NULL) || r; + r = ((glGetIntegerui64vNV = (PFNGLGETINTEGERUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glGetIntegerui64vNV")) == NULL) || r; + r = ((glGetNamedBufferParameterui64vNV = (PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glGetNamedBufferParameterui64vNV")) == NULL) || r; + r = ((glGetUniformui64vNV = (PFNGLGETUNIFORMUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glGetUniformui64vNV")) == NULL) || r; + r = ((glIsBufferResidentNV = (PFNGLISBUFFERRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glIsBufferResidentNV")) == NULL) || r; + r = ((glIsNamedBufferResidentNV = (PFNGLISNAMEDBUFFERRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glIsNamedBufferResidentNV")) == NULL) || r; + r = ((glMakeBufferNonResidentNV = (PFNGLMAKEBUFFERNONRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glMakeBufferNonResidentNV")) == NULL) || r; + r = ((glMakeBufferResidentNV = (PFNGLMAKEBUFFERRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glMakeBufferResidentNV")) == NULL) || r; + r = ((glMakeNamedBufferNonResidentNV = (PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glMakeNamedBufferNonResidentNV")) == NULL) || r; + r = ((glMakeNamedBufferResidentNV = (PFNGLMAKENAMEDBUFFERRESIDENTNVPROC)glewGetProcAddress((const GLubyte*)"glMakeNamedBufferResidentNV")) == NULL) || r; + r = ((glProgramUniformui64NV = (PFNGLPROGRAMUNIFORMUI64NVPROC)glewGetProcAddress((const GLubyte*)"glProgramUniformui64NV")) == NULL) || r; + r = ((glProgramUniformui64vNV = (PFNGLPROGRAMUNIFORMUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glProgramUniformui64vNV")) == NULL) || r; + r = ((glUniformui64NV = (PFNGLUNIFORMUI64NVPROC)glewGetProcAddress((const GLubyte*)"glUniformui64NV")) == NULL) || r; + r = ((glUniformui64vNV = (PFNGLUNIFORMUI64VNVPROC)glewGetProcAddress((const GLubyte*)"glUniformui64vNV")) == NULL) || r; + + return r; +} + +#endif /* GL_NV_shader_buffer_load */ + #ifdef GL_NV_texgen_emboss #endif /* GL_NV_texgen_emboss */ @@ -5371,6 +5977,19 @@ static GLboolean _glewInit_GL_NV_register_combiners2 (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_NV_texgen_reflection */ +#ifdef GL_NV_texture_barrier + +static GLboolean _glewInit_GL_NV_texture_barrier (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glTextureBarrierNV = (PFNGLTEXTUREBARRIERNVPROC)glewGetProcAddress((const GLubyte*)"glTextureBarrierNV")) == NULL) || r; + + return r; +} + +#endif /* GL_NV_texture_barrier */ + #ifdef GL_NV_texture_compression_vtc #endif /* GL_NV_texture_compression_vtc */ @@ -5422,6 +6041,25 @@ static GLboolean _glewInit_GL_NV_transform_feedback (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_NV_transform_feedback */ +#ifdef GL_NV_transform_feedback2 + +static GLboolean _glewInit_GL_NV_transform_feedback2 (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBindTransformFeedbackNV = (PFNGLBINDTRANSFORMFEEDBACKNVPROC)glewGetProcAddress((const GLubyte*)"glBindTransformFeedbackNV")) == NULL) || r; + r = ((glDeleteTransformFeedbacksNV = (PFNGLDELETETRANSFORMFEEDBACKSNVPROC)glewGetProcAddress((const GLubyte*)"glDeleteTransformFeedbacksNV")) == NULL) || r; + r = ((glDrawTransformFeedbackNV = (PFNGLDRAWTRANSFORMFEEDBACKNVPROC)glewGetProcAddress((const GLubyte*)"glDrawTransformFeedbackNV")) == NULL) || r; + r = ((glGenTransformFeedbacksNV = (PFNGLGENTRANSFORMFEEDBACKSNVPROC)glewGetProcAddress((const GLubyte*)"glGenTransformFeedbacksNV")) == NULL) || r; + r = ((glIsTransformFeedbackNV = (PFNGLISTRANSFORMFEEDBACKNVPROC)glewGetProcAddress((const GLubyte*)"glIsTransformFeedbackNV")) == NULL) || r; + r = ((glPauseTransformFeedbackNV = (PFNGLPAUSETRANSFORMFEEDBACKNVPROC)glewGetProcAddress((const GLubyte*)"glPauseTransformFeedbackNV")) == NULL) || r; + r = ((glResumeTransformFeedbackNV = (PFNGLRESUMETRANSFORMFEEDBACKNVPROC)glewGetProcAddress((const GLubyte*)"glResumeTransformFeedbackNV")) == NULL) || r; + + return r; +} + +#endif /* GL_NV_transform_feedback2 */ + #ifdef GL_NV_vertex_array_range static GLboolean _glewInit_GL_NV_vertex_array_range (GLEW_CONTEXT_ARG_DEF_INIT) @@ -5440,6 +6078,30 @@ static GLboolean _glewInit_GL_NV_vertex_array_range (GLEW_CONTEXT_ARG_DEF_INIT) #endif /* GL_NV_vertex_array_range2 */ +#ifdef GL_NV_vertex_buffer_unified_memory + +static GLboolean _glewInit_GL_NV_vertex_buffer_unified_memory (GLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glBufferAddressRangeNV = (PFNGLBUFFERADDRESSRANGENVPROC)glewGetProcAddress((const GLubyte*)"glBufferAddressRangeNV")) == NULL) || r; + r = ((glColorFormatNV = (PFNGLCOLORFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glColorFormatNV")) == NULL) || r; + r = ((glEdgeFlagFormatNV = (PFNGLEDGEFLAGFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glEdgeFlagFormatNV")) == NULL) || r; + r = ((glFogCoordFormatNV = (PFNGLFOGCOORDFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glFogCoordFormatNV")) == NULL) || r; + r = ((glGetIntegerui64i_vNV = (PFNGLGETINTEGERUI64I_VNVPROC)glewGetProcAddress((const GLubyte*)"glGetIntegerui64i_vNV")) == NULL) || r; + r = ((glIndexFormatNV = (PFNGLINDEXFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glIndexFormatNV")) == NULL) || r; + r = ((glNormalFormatNV = (PFNGLNORMALFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glNormalFormatNV")) == NULL) || r; + r = ((glSecondaryColorFormatNV = (PFNGLSECONDARYCOLORFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glSecondaryColorFormatNV")) == NULL) || r; + r = ((glTexCoordFormatNV = (PFNGLTEXCOORDFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glTexCoordFormatNV")) == NULL) || r; + r = ((glVertexAttribFormatNV = (PFNGLVERTEXATTRIBFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribFormatNV")) == NULL) || r; + r = ((glVertexAttribIFormatNV = (PFNGLVERTEXATTRIBIFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glVertexAttribIFormatNV")) == NULL) || r; + r = ((glVertexFormatNV = (PFNGLVERTEXFORMATNVPROC)glewGetProcAddress((const GLubyte*)"glVertexFormatNV")) == NULL) || r; + + return r; +} + +#endif /* GL_NV_vertex_buffer_unified_memory */ + #ifdef GL_NV_vertex_program static GLboolean _glewInit_GL_NV_vertex_program (GLEW_CONTEXT_ARG_DEF_INIT) @@ -6153,81 +6815,37 @@ static GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) { const GLubyte* s; - GLuint dot, major, minor; + GLuint dot; + GLint major, minor; /* query opengl version */ s = glGetString(GL_VERSION); dot = _glewStrCLen(s, '.'); - major = dot-1; - minor = dot+1; - if (dot == 0 || s[minor] == '\0') + if (dot == 0) return GLEW_ERROR_NO_GL_VERSION; - if (s[major] == '1' && s[minor] == '0') + + major = s[dot-1]-'0'; + minor = s[dot+1]-'0'; + + if (minor < 0 || minor > 9) + minor = 0; + if (major<0 || major>9) + return GLEW_ERROR_NO_GL_VERSION; + + + if (major == 1 && minor == 0) { - return GLEW_ERROR_GL_VERSION_10_ONLY; + return GLEW_ERROR_GL_VERSION_10_ONLY; } else { - CONST_CAST(GLEW_VERSION_1_1) = GL_TRUE; - if (s[major] >= '2') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_3) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_4) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_5) = GL_TRUE; - CONST_CAST(GLEW_VERSION_2_0) = GL_TRUE; - if (s[minor] >= '1') - { - CONST_CAST(GLEW_VERSION_2_1) = GL_TRUE; - } - } - else - { - if (s[minor] >= '5') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_3) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_4) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_5) = GL_TRUE; - CONST_CAST(GLEW_VERSION_2_0) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_1) = GL_FALSE; - } - if (s[minor] == '4') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_3) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_4) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_5) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_0) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_1) = GL_FALSE; - } - if (s[minor] == '3') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_3) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_4) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_5) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_0) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_1) = GL_FALSE; - } - if (s[minor] == '2') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_TRUE; - CONST_CAST(GLEW_VERSION_1_3) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_4) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_5) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_0) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_1) = GL_FALSE; - } - if (s[minor] < '2') - { - CONST_CAST(GLEW_VERSION_1_2) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_3) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_4) = GL_FALSE; - CONST_CAST(GLEW_VERSION_1_5) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_0) = GL_FALSE; - CONST_CAST(GLEW_VERSION_2_1) = GL_FALSE; - } - } + CONST_CAST(GLEW_VERSION_3_0) = ( major >= 3 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_2_1) = GLEW_VERSION_3_0 == GL_TRUE || ( major == 2 && minor >= 1 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_2_0) = GLEW_VERSION_2_1 == GL_TRUE || ( major == 2 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_1_5) = GLEW_VERSION_2_0 == GL_TRUE || ( major == 1 && minor >= 5 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_1_4) = GLEW_VERSION_1_5 == GL_TRUE || ( major == 1 && minor >= 4 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_1_3) = GLEW_VERSION_1_4 == GL_TRUE || ( major == 1 && minor >= 3 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_1_2) = GLEW_VERSION_1_3 == GL_TRUE || ( major == 1 && minor >= 2 ) ? GL_TRUE : GL_FALSE; + CONST_CAST(GLEW_VERSION_1_1) = GLEW_VERSION_1_2 == GL_TRUE || ( major == 1 && minor >= 1 ) ? GL_TRUE : GL_FALSE; } /* initialize extensions */ #ifdef GL_VERSION_1_2 @@ -6251,6 +6869,12 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_VERSION_3_0 if (glewExperimental || GLEW_VERSION_3_0) CONST_CAST(GLEW_VERSION_3_0) = !_glewInit_GL_VERSION_3_0(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_VERSION_3_0 */ +#ifdef GL_VERSION_3_1 + if (glewExperimental || GLEW_VERSION_3_1) CONST_CAST(GLEW_VERSION_3_1) = !_glewInit_GL_VERSION_3_1(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_VERSION_3_1 */ +#ifdef GL_VERSION_3_2 + if (glewExperimental || GLEW_VERSION_3_2) CONST_CAST(GLEW_VERSION_3_2) = !_glewInit_GL_VERSION_3_2(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_VERSION_3_2 */ #ifdef GL_3DFX_multisample CONST_CAST(GLEW_3DFX_multisample) = glewGetExtension("GL_3DFX_multisample"); #endif /* GL_3DFX_multisample */ @@ -6261,6 +6885,24 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_3DFX_texture_compression_FXT1 CONST_CAST(GLEW_3DFX_texture_compression_FXT1) = glewGetExtension("GL_3DFX_texture_compression_FXT1"); #endif /* GL_3DFX_texture_compression_FXT1 */ +#ifdef GL_AMD_draw_buffers_blend + CONST_CAST(GLEW_AMD_draw_buffers_blend) = glewGetExtension("GL_AMD_draw_buffers_blend"); + if (glewExperimental || GLEW_AMD_draw_buffers_blend) CONST_CAST(GLEW_AMD_draw_buffers_blend) = !_glewInit_GL_AMD_draw_buffers_blend(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_AMD_draw_buffers_blend */ +#ifdef GL_AMD_performance_monitor + CONST_CAST(GLEW_AMD_performance_monitor) = glewGetExtension("GL_AMD_performance_monitor"); + if (glewExperimental || GLEW_AMD_performance_monitor) CONST_CAST(GLEW_AMD_performance_monitor) = !_glewInit_GL_AMD_performance_monitor(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_AMD_performance_monitor */ +#ifdef GL_AMD_texture_texture4 + CONST_CAST(GLEW_AMD_texture_texture4) = glewGetExtension("GL_AMD_texture_texture4"); +#endif /* GL_AMD_texture_texture4 */ +#ifdef GL_AMD_vertex_shader_tessellator + CONST_CAST(GLEW_AMD_vertex_shader_tessellator) = glewGetExtension("GL_AMD_vertex_shader_tessellator"); + if (glewExperimental || GLEW_AMD_vertex_shader_tessellator) CONST_CAST(GLEW_AMD_vertex_shader_tessellator) = !_glewInit_GL_AMD_vertex_shader_tessellator(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_AMD_vertex_shader_tessellator */ +#ifdef GL_APPLE_aux_depth_stencil + CONST_CAST(GLEW_APPLE_aux_depth_stencil) = glewGetExtension("GL_APPLE_aux_depth_stencil"); +#endif /* GL_APPLE_aux_depth_stencil */ #ifdef GL_APPLE_client_storage CONST_CAST(GLEW_APPLE_client_storage) = glewGetExtension("GL_APPLE_client_storage"); #endif /* GL_APPLE_client_storage */ @@ -6279,9 +6921,19 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_APPLE_flush_buffer_range) = glewGetExtension("GL_APPLE_flush_buffer_range"); if (glewExperimental || GLEW_APPLE_flush_buffer_range) CONST_CAST(GLEW_APPLE_flush_buffer_range) = !_glewInit_GL_APPLE_flush_buffer_range(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_APPLE_flush_buffer_range */ +#ifdef GL_APPLE_object_purgeable + CONST_CAST(GLEW_APPLE_object_purgeable) = glewGetExtension("GL_APPLE_object_purgeable"); + if (glewExperimental || GLEW_APPLE_object_purgeable) CONST_CAST(GLEW_APPLE_object_purgeable) = !_glewInit_GL_APPLE_object_purgeable(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_APPLE_object_purgeable */ #ifdef GL_APPLE_pixel_buffer CONST_CAST(GLEW_APPLE_pixel_buffer) = glewGetExtension("GL_APPLE_pixel_buffer"); #endif /* GL_APPLE_pixel_buffer */ +#ifdef GL_APPLE_rgb_422 + CONST_CAST(GLEW_APPLE_rgb_422) = glewGetExtension("GL_APPLE_rgb_422"); +#endif /* GL_APPLE_rgb_422 */ +#ifdef GL_APPLE_row_bytes + CONST_CAST(GLEW_APPLE_row_bytes) = glewGetExtension("GL_APPLE_row_bytes"); +#endif /* GL_APPLE_row_bytes */ #ifdef GL_APPLE_specular_vector CONST_CAST(GLEW_APPLE_specular_vector) = glewGetExtension("GL_APPLE_specular_vector"); #endif /* GL_APPLE_specular_vector */ @@ -6300,6 +6952,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_APPLE_vertex_array_range) = glewGetExtension("GL_APPLE_vertex_array_range"); if (glewExperimental || GLEW_APPLE_vertex_array_range) CONST_CAST(GLEW_APPLE_vertex_array_range) = !_glewInit_GL_APPLE_vertex_array_range(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_APPLE_vertex_array_range */ +#ifdef GL_APPLE_vertex_program_evaluators + CONST_CAST(GLEW_APPLE_vertex_program_evaluators) = glewGetExtension("GL_APPLE_vertex_program_evaluators"); + if (glewExperimental || GLEW_APPLE_vertex_program_evaluators) CONST_CAST(GLEW_APPLE_vertex_program_evaluators) = !_glewInit_GL_APPLE_vertex_program_evaluators(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_APPLE_vertex_program_evaluators */ #ifdef GL_APPLE_ycbcr_422 CONST_CAST(GLEW_APPLE_ycbcr_422) = glewGetExtension("GL_APPLE_ycbcr_422"); #endif /* GL_APPLE_ycbcr_422 */ @@ -6307,9 +6963,19 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_ARB_color_buffer_float) = glewGetExtension("GL_ARB_color_buffer_float"); if (glewExperimental || GLEW_ARB_color_buffer_float) CONST_CAST(GLEW_ARB_color_buffer_float) = !_glewInit_GL_ARB_color_buffer_float(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ARB_color_buffer_float */ +#ifdef GL_ARB_compatibility + CONST_CAST(GLEW_ARB_compatibility) = glewGetExtension("GL_ARB_compatibility"); +#endif /* GL_ARB_compatibility */ +#ifdef GL_ARB_copy_buffer + CONST_CAST(GLEW_ARB_copy_buffer) = glewGetExtension("GL_ARB_copy_buffer"); + if (glewExperimental || GLEW_ARB_copy_buffer) CONST_CAST(GLEW_ARB_copy_buffer) = !_glewInit_GL_ARB_copy_buffer(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_copy_buffer */ #ifdef GL_ARB_depth_buffer_float CONST_CAST(GLEW_ARB_depth_buffer_float) = glewGetExtension("GL_ARB_depth_buffer_float"); #endif /* GL_ARB_depth_buffer_float */ +#ifdef GL_ARB_depth_clamp + CONST_CAST(GLEW_ARB_depth_clamp) = glewGetExtension("GL_ARB_depth_clamp"); +#endif /* GL_ARB_depth_clamp */ #ifdef GL_ARB_depth_texture CONST_CAST(GLEW_ARB_depth_texture) = glewGetExtension("GL_ARB_depth_texture"); #endif /* GL_ARB_depth_texture */ @@ -6317,10 +6983,21 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_ARB_draw_buffers) = glewGetExtension("GL_ARB_draw_buffers"); if (glewExperimental || GLEW_ARB_draw_buffers) CONST_CAST(GLEW_ARB_draw_buffers) = !_glewInit_GL_ARB_draw_buffers(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ARB_draw_buffers */ +#ifdef GL_ARB_draw_buffers_blend + CONST_CAST(GLEW_ARB_draw_buffers_blend) = glewGetExtension("GL_ARB_draw_buffers_blend"); + if (glewExperimental || GLEW_ARB_draw_buffers_blend) CONST_CAST(GLEW_ARB_draw_buffers_blend) = !_glewInit_GL_ARB_draw_buffers_blend(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_draw_buffers_blend */ +#ifdef GL_ARB_draw_elements_base_vertex + CONST_CAST(GLEW_ARB_draw_elements_base_vertex) = glewGetExtension("GL_ARB_draw_elements_base_vertex"); + if (glewExperimental || GLEW_ARB_draw_elements_base_vertex) CONST_CAST(GLEW_ARB_draw_elements_base_vertex) = !_glewInit_GL_ARB_draw_elements_base_vertex(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_draw_elements_base_vertex */ #ifdef GL_ARB_draw_instanced CONST_CAST(GLEW_ARB_draw_instanced) = glewGetExtension("GL_ARB_draw_instanced"); if (glewExperimental || GLEW_ARB_draw_instanced) CONST_CAST(GLEW_ARB_draw_instanced) = !_glewInit_GL_ARB_draw_instanced(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ARB_draw_instanced */ +#ifdef GL_ARB_fragment_coord_conventions + CONST_CAST(GLEW_ARB_fragment_coord_conventions) = glewGetExtension("GL_ARB_fragment_coord_conventions"); +#endif /* GL_ARB_fragment_coord_conventions */ #ifdef GL_ARB_fragment_program CONST_CAST(GLEW_ARB_fragment_program) = glewGetExtension("GL_ARB_fragment_program"); #endif /* GL_ARB_fragment_program */ @@ -6385,10 +7062,24 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_ARB_point_sprite CONST_CAST(GLEW_ARB_point_sprite) = glewGetExtension("GL_ARB_point_sprite"); #endif /* GL_ARB_point_sprite */ +#ifdef GL_ARB_provoking_vertex + CONST_CAST(GLEW_ARB_provoking_vertex) = glewGetExtension("GL_ARB_provoking_vertex"); + if (glewExperimental || GLEW_ARB_provoking_vertex) CONST_CAST(GLEW_ARB_provoking_vertex) = !_glewInit_GL_ARB_provoking_vertex(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_provoking_vertex */ +#ifdef GL_ARB_sample_shading + CONST_CAST(GLEW_ARB_sample_shading) = glewGetExtension("GL_ARB_sample_shading"); + if (glewExperimental || GLEW_ARB_sample_shading) CONST_CAST(GLEW_ARB_sample_shading) = !_glewInit_GL_ARB_sample_shading(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_sample_shading */ +#ifdef GL_ARB_seamless_cube_map + CONST_CAST(GLEW_ARB_seamless_cube_map) = glewGetExtension("GL_ARB_seamless_cube_map"); +#endif /* GL_ARB_seamless_cube_map */ #ifdef GL_ARB_shader_objects CONST_CAST(GLEW_ARB_shader_objects) = glewGetExtension("GL_ARB_shader_objects"); if (glewExperimental || GLEW_ARB_shader_objects) CONST_CAST(GLEW_ARB_shader_objects) = !_glewInit_GL_ARB_shader_objects(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ARB_shader_objects */ +#ifdef GL_ARB_shader_texture_lod + CONST_CAST(GLEW_ARB_shader_texture_lod) = glewGetExtension("GL_ARB_shader_texture_lod"); +#endif /* GL_ARB_shader_texture_lod */ #ifdef GL_ARB_shading_language_100 CONST_CAST(GLEW_ARB_shading_language_100) = glewGetExtension("GL_ARB_shading_language_100"); #endif /* GL_ARB_shading_language_100 */ @@ -6398,6 +7089,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_ARB_shadow_ambient CONST_CAST(GLEW_ARB_shadow_ambient) = glewGetExtension("GL_ARB_shadow_ambient"); #endif /* GL_ARB_shadow_ambient */ +#ifdef GL_ARB_sync + CONST_CAST(GLEW_ARB_sync) = glewGetExtension("GL_ARB_sync"); + if (glewExperimental || GLEW_ARB_sync) CONST_CAST(GLEW_ARB_sync) = !_glewInit_GL_ARB_sync(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_sync */ #ifdef GL_ARB_texture_border_clamp CONST_CAST(GLEW_ARB_texture_border_clamp) = glewGetExtension("GL_ARB_texture_border_clamp"); #endif /* GL_ARB_texture_border_clamp */ @@ -6415,6 +7110,9 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_ARB_texture_cube_map CONST_CAST(GLEW_ARB_texture_cube_map) = glewGetExtension("GL_ARB_texture_cube_map"); #endif /* GL_ARB_texture_cube_map */ +#ifdef GL_ARB_texture_cube_map_array + CONST_CAST(GLEW_ARB_texture_cube_map_array) = glewGetExtension("GL_ARB_texture_cube_map_array"); +#endif /* GL_ARB_texture_cube_map_array */ #ifdef GL_ARB_texture_env_add CONST_CAST(GLEW_ARB_texture_env_add) = glewGetExtension("GL_ARB_texture_env_add"); #endif /* GL_ARB_texture_env_add */ @@ -6430,12 +7128,22 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_ARB_texture_float CONST_CAST(GLEW_ARB_texture_float) = glewGetExtension("GL_ARB_texture_float"); #endif /* GL_ARB_texture_float */ +#ifdef GL_ARB_texture_gather + CONST_CAST(GLEW_ARB_texture_gather) = glewGetExtension("GL_ARB_texture_gather"); +#endif /* GL_ARB_texture_gather */ #ifdef GL_ARB_texture_mirrored_repeat CONST_CAST(GLEW_ARB_texture_mirrored_repeat) = glewGetExtension("GL_ARB_texture_mirrored_repeat"); #endif /* GL_ARB_texture_mirrored_repeat */ +#ifdef GL_ARB_texture_multisample + CONST_CAST(GLEW_ARB_texture_multisample) = glewGetExtension("GL_ARB_texture_multisample"); + if (glewExperimental || GLEW_ARB_texture_multisample) CONST_CAST(GLEW_ARB_texture_multisample) = !_glewInit_GL_ARB_texture_multisample(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_texture_multisample */ #ifdef GL_ARB_texture_non_power_of_two CONST_CAST(GLEW_ARB_texture_non_power_of_two) = glewGetExtension("GL_ARB_texture_non_power_of_two"); #endif /* GL_ARB_texture_non_power_of_two */ +#ifdef GL_ARB_texture_query_lod + CONST_CAST(GLEW_ARB_texture_query_lod) = glewGetExtension("GL_ARB_texture_query_lod"); +#endif /* GL_ARB_texture_query_lod */ #ifdef GL_ARB_texture_rectangle CONST_CAST(GLEW_ARB_texture_rectangle) = glewGetExtension("GL_ARB_texture_rectangle"); #endif /* GL_ARB_texture_rectangle */ @@ -6446,6 +7154,13 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_ARB_transpose_matrix) = glewGetExtension("GL_ARB_transpose_matrix"); if (glewExperimental || GLEW_ARB_transpose_matrix) CONST_CAST(GLEW_ARB_transpose_matrix) = !_glewInit_GL_ARB_transpose_matrix(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ARB_transpose_matrix */ +#ifdef GL_ARB_uniform_buffer_object + CONST_CAST(GLEW_ARB_uniform_buffer_object) = glewGetExtension("GL_ARB_uniform_buffer_object"); + if (glewExperimental || GLEW_ARB_uniform_buffer_object) CONST_CAST(GLEW_ARB_uniform_buffer_object) = !_glewInit_GL_ARB_uniform_buffer_object(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_ARB_uniform_buffer_object */ +#ifdef GL_ARB_vertex_array_bgra + CONST_CAST(GLEW_ARB_vertex_array_bgra) = glewGetExtension("GL_ARB_vertex_array_bgra"); +#endif /* GL_ARB_vertex_array_bgra */ #ifdef GL_ARB_vertex_array_object CONST_CAST(GLEW_ARB_vertex_array_object) = glewGetExtension("GL_ARB_vertex_array_object"); if (glewExperimental || GLEW_ARB_vertex_array_object) CONST_CAST(GLEW_ARB_vertex_array_object) = !_glewInit_GL_ARB_vertex_array_object(GLEW_CONTEXT_ARG_VAR_INIT); @@ -6502,6 +7217,9 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_ATI_map_object_buffer) = glewGetExtension("GL_ATI_map_object_buffer"); if (glewExperimental || GLEW_ATI_map_object_buffer) CONST_CAST(GLEW_ATI_map_object_buffer) = !_glewInit_GL_ATI_map_object_buffer(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_ATI_map_object_buffer */ +#ifdef GL_ATI_meminfo + CONST_CAST(GLEW_ATI_meminfo) = glewGetExtension("GL_ATI_meminfo"); +#endif /* GL_ATI_meminfo */ #ifdef GL_ATI_pn_triangles CONST_CAST(GLEW_ATI_pn_triangles) = glewGetExtension("GL_ATI_pn_triangles"); if (glewExperimental || GLEW_ATI_pn_triangles) CONST_CAST(GLEW_ATI_pn_triangles) = !_glewInit_GL_ATI_pn_triangles(GLEW_CONTEXT_ARG_VAR_INIT); @@ -6727,6 +7445,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_EXT_polygon_offset) = glewGetExtension("GL_EXT_polygon_offset"); if (glewExperimental || GLEW_EXT_polygon_offset) CONST_CAST(GLEW_EXT_polygon_offset) = !_glewInit_GL_EXT_polygon_offset(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_EXT_polygon_offset */ +#ifdef GL_EXT_provoking_vertex + CONST_CAST(GLEW_EXT_provoking_vertex) = glewGetExtension("GL_EXT_provoking_vertex"); + if (glewExperimental || GLEW_EXT_provoking_vertex) CONST_CAST(GLEW_EXT_provoking_vertex) = !_glewInit_GL_EXT_provoking_vertex(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_EXT_provoking_vertex */ #ifdef GL_EXT_rescale_normal CONST_CAST(GLEW_EXT_rescale_normal) = glewGetExtension("GL_EXT_rescale_normal"); #endif /* GL_EXT_rescale_normal */ @@ -6738,6 +7460,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_EXT_secondary_color) = glewGetExtension("GL_EXT_secondary_color"); if (glewExperimental || GLEW_EXT_secondary_color) CONST_CAST(GLEW_EXT_secondary_color) = !_glewInit_GL_EXT_secondary_color(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_EXT_secondary_color */ +#ifdef GL_EXT_separate_shader_objects + CONST_CAST(GLEW_EXT_separate_shader_objects) = glewGetExtension("GL_EXT_separate_shader_objects"); + if (glewExperimental || GLEW_EXT_separate_shader_objects) CONST_CAST(GLEW_EXT_separate_shader_objects) = !_glewInit_GL_EXT_separate_shader_objects(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_EXT_separate_shader_objects */ #ifdef GL_EXT_separate_specular_color CONST_CAST(GLEW_EXT_separate_specular_color) = glewGetExtension("GL_EXT_separate_specular_color"); #endif /* GL_EXT_separate_specular_color */ @@ -6835,6 +7561,9 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_EXT_texture_shared_exponent CONST_CAST(GLEW_EXT_texture_shared_exponent) = glewGetExtension("GL_EXT_texture_shared_exponent"); #endif /* GL_EXT_texture_shared_exponent */ +#ifdef GL_EXT_texture_snorm + CONST_CAST(GLEW_EXT_texture_snorm) = glewGetExtension("GL_EXT_texture_snorm"); +#endif /* GL_EXT_texture_snorm */ #ifdef GL_EXT_texture_swizzle CONST_CAST(GLEW_EXT_texture_swizzle) = glewGetExtension("GL_EXT_texture_swizzle"); #endif /* GL_EXT_texture_swizzle */ @@ -6947,6 +7676,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_NV_copy_depth_to_color CONST_CAST(GLEW_NV_copy_depth_to_color) = glewGetExtension("GL_NV_copy_depth_to_color"); #endif /* GL_NV_copy_depth_to_color */ +#ifdef GL_NV_copy_image + CONST_CAST(GLEW_NV_copy_image) = glewGetExtension("GL_NV_copy_image"); + if (glewExperimental || GLEW_NV_copy_image) CONST_CAST(GLEW_NV_copy_image) = !_glewInit_GL_NV_copy_image(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_NV_copy_image */ #ifdef GL_NV_depth_buffer_float CONST_CAST(GLEW_NV_depth_buffer_float) = glewGetExtension("GL_NV_depth_buffer_float"); if (glewExperimental || GLEW_NV_depth_buffer_float) CONST_CAST(GLEW_NV_depth_buffer_float) = !_glewInit_GL_NV_depth_buffer_float(GLEW_CONTEXT_ARG_VAR_INIT); @@ -7024,6 +7757,9 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_NV_parameter_buffer_object) = glewGetExtension("GL_NV_parameter_buffer_object"); if (glewExperimental || GLEW_NV_parameter_buffer_object) CONST_CAST(GLEW_NV_parameter_buffer_object) = !_glewInit_GL_NV_parameter_buffer_object(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_NV_parameter_buffer_object */ +#ifdef GL_NV_parameter_buffer_object2 + CONST_CAST(GLEW_NV_parameter_buffer_object2) = glewGetExtension("GL_NV_parameter_buffer_object2"); +#endif /* GL_NV_parameter_buffer_object2 */ #ifdef GL_NV_pixel_data_range CONST_CAST(GLEW_NV_pixel_data_range) = glewGetExtension("GL_NV_pixel_data_range"); if (glewExperimental || GLEW_NV_pixel_data_range) CONST_CAST(GLEW_NV_pixel_data_range) = !_glewInit_GL_NV_pixel_data_range(GLEW_CONTEXT_ARG_VAR_INIT); @@ -7048,12 +7784,20 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_NV_register_combiners2) = glewGetExtension("GL_NV_register_combiners2"); if (glewExperimental || GLEW_NV_register_combiners2) CONST_CAST(GLEW_NV_register_combiners2) = !_glewInit_GL_NV_register_combiners2(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_NV_register_combiners2 */ +#ifdef GL_NV_shader_buffer_load + CONST_CAST(GLEW_NV_shader_buffer_load) = glewGetExtension("GL_NV_shader_buffer_load"); + if (glewExperimental || GLEW_NV_shader_buffer_load) CONST_CAST(GLEW_NV_shader_buffer_load) = !_glewInit_GL_NV_shader_buffer_load(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_NV_shader_buffer_load */ #ifdef GL_NV_texgen_emboss CONST_CAST(GLEW_NV_texgen_emboss) = glewGetExtension("GL_NV_texgen_emboss"); #endif /* GL_NV_texgen_emboss */ #ifdef GL_NV_texgen_reflection CONST_CAST(GLEW_NV_texgen_reflection) = glewGetExtension("GL_NV_texgen_reflection"); #endif /* GL_NV_texgen_reflection */ +#ifdef GL_NV_texture_barrier + CONST_CAST(GLEW_NV_texture_barrier) = glewGetExtension("GL_NV_texture_barrier"); + if (glewExperimental || GLEW_NV_texture_barrier) CONST_CAST(GLEW_NV_texture_barrier) = !_glewInit_GL_NV_texture_barrier(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_NV_texture_barrier */ #ifdef GL_NV_texture_compression_vtc CONST_CAST(GLEW_NV_texture_compression_vtc) = glewGetExtension("GL_NV_texture_compression_vtc"); #endif /* GL_NV_texture_compression_vtc */ @@ -7079,6 +7823,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLEW_NV_transform_feedback) = glewGetExtension("GL_NV_transform_feedback"); if (glewExperimental || GLEW_NV_transform_feedback) CONST_CAST(GLEW_NV_transform_feedback) = !_glewInit_GL_NV_transform_feedback(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GL_NV_transform_feedback */ +#ifdef GL_NV_transform_feedback2 + CONST_CAST(GLEW_NV_transform_feedback2) = glewGetExtension("GL_NV_transform_feedback2"); + if (glewExperimental || GLEW_NV_transform_feedback2) CONST_CAST(GLEW_NV_transform_feedback2) = !_glewInit_GL_NV_transform_feedback2(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_NV_transform_feedback2 */ #ifdef GL_NV_vertex_array_range CONST_CAST(GLEW_NV_vertex_array_range) = glewGetExtension("GL_NV_vertex_array_range"); if (glewExperimental || GLEW_NV_vertex_array_range) CONST_CAST(GLEW_NV_vertex_array_range) = !_glewInit_GL_NV_vertex_array_range(GLEW_CONTEXT_ARG_VAR_INIT); @@ -7086,6 +7834,10 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) #ifdef GL_NV_vertex_array_range2 CONST_CAST(GLEW_NV_vertex_array_range2) = glewGetExtension("GL_NV_vertex_array_range2"); #endif /* GL_NV_vertex_array_range2 */ +#ifdef GL_NV_vertex_buffer_unified_memory + CONST_CAST(GLEW_NV_vertex_buffer_unified_memory) = glewGetExtension("GL_NV_vertex_buffer_unified_memory"); + if (glewExperimental || GLEW_NV_vertex_buffer_unified_memory) CONST_CAST(GLEW_NV_vertex_buffer_unified_memory) = !_glewInit_GL_NV_vertex_buffer_unified_memory(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GL_NV_vertex_buffer_unified_memory */ #ifdef GL_NV_vertex_program CONST_CAST(GLEW_NV_vertex_program) = glewGetExtension("GL_NV_vertex_program"); if (glewExperimental || GLEW_NV_vertex_program) CONST_CAST(GLEW_NV_vertex_program) = !_glewInit_GL_NV_vertex_program(GLEW_CONTEXT_ARG_VAR_INIT); @@ -7352,6 +8104,16 @@ GLenum glewContextInit (GLEW_CONTEXT_ARG_DEF_LIST) PFNWGLSETSTEREOEMITTERSTATE3DLPROC __wglewSetStereoEmitterState3DL = NULL; +PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC __wglewBlitContextFramebufferAMD = NULL; +PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC __wglewCreateAssociatedContextAMD = NULL; +PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC __wglewCreateAssociatedContextAttribsAMD = NULL; +PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC __wglewDeleteAssociatedContextAMD = NULL; +PFNWGLGETCONTEXTGPUIDAMDPROC __wglewGetContextGPUIDAMD = NULL; +PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC __wglewGetCurrentAssociatedContextAMD = NULL; +PFNWGLGETGPUIDSAMDPROC __wglewGetGPUIDsAMD = NULL; +PFNWGLGETGPUINFOAMDPROC __wglewGetGPUInfoAMD = NULL; +PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC __wglewMakeAssociatedContextCurrentAMD = NULL; + PFNWGLCREATEBUFFERREGIONARBPROC __wglewCreateBufferRegionARB = NULL; PFNWGLDELETEBUFFERREGIONARBPROC __wglewDeleteBufferRegionARB = NULL; PFNWGLRESTOREBUFFERREGIONARBPROC __wglewRestoreBufferRegionARB = NULL; @@ -7437,6 +8199,8 @@ PFNWGLENDFRAMETRACKINGI3DPROC __wglewEndFrameTrackingI3D = NULL; PFNWGLGETFRAMEUSAGEI3DPROC __wglewGetFrameUsageI3D = NULL; PFNWGLQUERYFRAMETRACKINGI3DPROC __wglewQueryFrameTrackingI3D = NULL; +PFNWGLCOPYIMAGESUBDATANVPROC __wglewCopyImageSubDataNV = NULL; + PFNWGLCREATEAFFINITYDCNVPROC __wglewCreateAffinityDCNV = NULL; PFNWGLDELETEDCNVPROC __wglewDeleteDCNV = NULL; PFNWGLENUMGPUDEVICESNVPROC __wglewEnumGpuDevicesNV = NULL; @@ -7472,8 +8236,10 @@ PFNWGLWAITFORMSCOMLPROC __wglewWaitForMscOML = NULL; PFNWGLWAITFORSBCOMLPROC __wglewWaitForSbcOML = NULL; GLboolean __WGLEW_3DFX_multisample = GL_FALSE; GLboolean __WGLEW_3DL_stereo_control = GL_FALSE; +GLboolean __WGLEW_AMD_gpu_association = GL_FALSE; GLboolean __WGLEW_ARB_buffer_region = GL_FALSE; GLboolean __WGLEW_ARB_create_context = GL_FALSE; +GLboolean __WGLEW_ARB_create_context_profile = GL_FALSE; GLboolean __WGLEW_ARB_extensions_string = GL_FALSE; GLboolean __WGLEW_ARB_framebuffer_sRGB = GL_FALSE; GLboolean __WGLEW_ARB_make_current_read = GL_FALSE; @@ -7500,6 +8266,7 @@ GLboolean __WGLEW_I3D_genlock = GL_FALSE; GLboolean __WGLEW_I3D_image_buffer = GL_FALSE; GLboolean __WGLEW_I3D_swap_frame_lock = GL_FALSE; GLboolean __WGLEW_I3D_swap_frame_usage = GL_FALSE; +GLboolean __WGLEW_NV_copy_image = GL_FALSE; GLboolean __WGLEW_NV_float_buffer = GL_FALSE; GLboolean __WGLEW_NV_gpu_affinity = GL_FALSE; GLboolean __WGLEW_NV_present_video = GL_FALSE; @@ -7529,6 +8296,27 @@ static GLboolean _glewInit_WGL_3DL_stereo_control (WGLEW_CONTEXT_ARG_DEF_INIT) #endif /* WGL_3DL_stereo_control */ +#ifdef WGL_AMD_gpu_association + +static GLboolean _glewInit_WGL_AMD_gpu_association (WGLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((wglBlitContextFramebufferAMD = (PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC)glewGetProcAddress((const GLubyte*)"wglBlitContextFramebufferAMD")) == NULL) || r; + r = ((wglCreateAssociatedContextAMD = (PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC)glewGetProcAddress((const GLubyte*)"wglCreateAssociatedContextAMD")) == NULL) || r; + r = ((wglCreateAssociatedContextAttribsAMD = (PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC)glewGetProcAddress((const GLubyte*)"wglCreateAssociatedContextAttribsAMD")) == NULL) || r; + r = ((wglDeleteAssociatedContextAMD = (PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC)glewGetProcAddress((const GLubyte*)"wglDeleteAssociatedContextAMD")) == NULL) || r; + r = ((wglGetContextGPUIDAMD = (PFNWGLGETCONTEXTGPUIDAMDPROC)glewGetProcAddress((const GLubyte*)"wglGetContextGPUIDAMD")) == NULL) || r; + r = ((wglGetCurrentAssociatedContextAMD = (PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC)glewGetProcAddress((const GLubyte*)"wglGetCurrentAssociatedContextAMD")) == NULL) || r; + r = ((wglGetGPUIDsAMD = (PFNWGLGETGPUIDSAMDPROC)glewGetProcAddress((const GLubyte*)"wglGetGPUIDsAMD")) == NULL) || r; + r = ((wglGetGPUInfoAMD = (PFNWGLGETGPUINFOAMDPROC)glewGetProcAddress((const GLubyte*)"wglGetGPUInfoAMD")) == NULL) || r; + r = ((wglMakeAssociatedContextCurrentAMD = (PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC)glewGetProcAddress((const GLubyte*)"wglMakeAssociatedContextCurrentAMD")) == NULL) || r; + + return r; +} + +#endif /* WGL_AMD_gpu_association */ + #ifdef WGL_ARB_buffer_region static GLboolean _glewInit_WGL_ARB_buffer_region (WGLEW_CONTEXT_ARG_DEF_INIT) @@ -7558,6 +8346,10 @@ static GLboolean _glewInit_WGL_ARB_create_context (WGLEW_CONTEXT_ARG_DEF_INIT) #endif /* WGL_ARB_create_context */ +#ifdef WGL_ARB_create_context_profile + +#endif /* WGL_ARB_create_context_profile */ + #ifdef WGL_ARB_extensions_string static GLboolean _glewInit_WGL_ARB_extensions_string (WGLEW_CONTEXT_ARG_DEF_INIT) @@ -7859,6 +8651,19 @@ static GLboolean _glewInit_WGL_I3D_swap_frame_usage (WGLEW_CONTEXT_ARG_DEF_INIT) #endif /* WGL_I3D_swap_frame_usage */ +#ifdef WGL_NV_copy_image + +static GLboolean _glewInit_WGL_NV_copy_image (WGLEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((wglCopyImageSubDataNV = (PFNWGLCOPYIMAGESUBDATANVPROC)glewGetProcAddress((const GLubyte*)"wglCopyImageSubDataNV")) == NULL) || r; + + return r; +} + +#endif /* WGL_NV_copy_image */ + #ifdef WGL_NV_float_buffer #endif /* WGL_NV_float_buffer */ @@ -8014,6 +8819,10 @@ GLenum wglewContextInit (WGLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(WGLEW_3DL_stereo_control) = wglewGetExtension("WGL_3DL_stereo_control"); if (glewExperimental || WGLEW_3DL_stereo_control|| crippled) CONST_CAST(WGLEW_3DL_stereo_control)= !_glewInit_WGL_3DL_stereo_control(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* WGL_3DL_stereo_control */ +#ifdef WGL_AMD_gpu_association + CONST_CAST(WGLEW_AMD_gpu_association) = wglewGetExtension("WGL_AMD_gpu_association"); + if (glewExperimental || WGLEW_AMD_gpu_association|| crippled) CONST_CAST(WGLEW_AMD_gpu_association)= !_glewInit_WGL_AMD_gpu_association(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* WGL_AMD_gpu_association */ #ifdef WGL_ARB_buffer_region CONST_CAST(WGLEW_ARB_buffer_region) = wglewGetExtension("WGL_ARB_buffer_region"); if (glewExperimental || WGLEW_ARB_buffer_region|| crippled) CONST_CAST(WGLEW_ARB_buffer_region)= !_glewInit_WGL_ARB_buffer_region(GLEW_CONTEXT_ARG_VAR_INIT); @@ -8022,6 +8831,9 @@ GLenum wglewContextInit (WGLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(WGLEW_ARB_create_context) = wglewGetExtension("WGL_ARB_create_context"); if (glewExperimental || WGLEW_ARB_create_context|| crippled) CONST_CAST(WGLEW_ARB_create_context)= !_glewInit_WGL_ARB_create_context(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* WGL_ARB_create_context */ +#ifdef WGL_ARB_create_context_profile + CONST_CAST(WGLEW_ARB_create_context_profile) = wglewGetExtension("WGL_ARB_create_context_profile"); +#endif /* WGL_ARB_create_context_profile */ #ifdef WGL_ARB_extensions_string CONST_CAST(WGLEW_ARB_extensions_string) = wglewGetExtension("WGL_ARB_extensions_string"); if (glewExperimental || WGLEW_ARB_extensions_string|| crippled) CONST_CAST(WGLEW_ARB_extensions_string)= !_glewInit_WGL_ARB_extensions_string(GLEW_CONTEXT_ARG_VAR_INIT); @@ -8117,6 +8929,10 @@ GLenum wglewContextInit (WGLEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(WGLEW_I3D_swap_frame_usage) = wglewGetExtension("WGL_I3D_swap_frame_usage"); if (glewExperimental || WGLEW_I3D_swap_frame_usage|| crippled) CONST_CAST(WGLEW_I3D_swap_frame_usage)= !_glewInit_WGL_I3D_swap_frame_usage(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* WGL_I3D_swap_frame_usage */ +#ifdef WGL_NV_copy_image + CONST_CAST(WGLEW_NV_copy_image) = wglewGetExtension("WGL_NV_copy_image"); + if (glewExperimental || WGLEW_NV_copy_image|| crippled) CONST_CAST(WGLEW_NV_copy_image)= !_glewInit_WGL_NV_copy_image(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* WGL_NV_copy_image */ #ifdef WGL_NV_float_buffer CONST_CAST(WGLEW_NV_float_buffer) = wglewGetExtension("WGL_NV_float_buffer"); #endif /* WGL_NV_float_buffer */ @@ -8187,6 +9003,8 @@ PFNGLXGETCONTEXTIDEXTPROC __glewXGetContextIDEXT = NULL; PFNGLXIMPORTCONTEXTEXTPROC __glewXImportContextEXT = NULL; PFNGLXQUERYCONTEXTINFOEXTPROC __glewXQueryContextInfoEXT = NULL; +PFNGLXSWAPINTERVALEXTPROC __glewXSwapIntervalEXT = NULL; + PFNGLXBINDTEXIMAGEEXTPROC __glewXBindTexImageEXT = NULL; PFNGLXRELEASETEXIMAGEEXTPROC __glewXReleaseTexImageEXT = NULL; @@ -8200,6 +9018,8 @@ PFNGLXRELEASEBUFFERSMESAPROC __glewXReleaseBuffersMESA = NULL; PFNGLXSET3DFXMODEMESAPROC __glewXSet3DfxModeMESA = NULL; +PFNGLXCOPYIMAGESUBDATANVPROC __glewXCopyImageSubDataNV = NULL; + PFNGLXBINDVIDEODEVICENVPROC __glewXBindVideoDeviceNV = NULL; PFNGLXENUMERATEVIDEODEVICESNVPROC __glewXEnumerateVideoDevicesNV = NULL; @@ -8285,6 +9105,7 @@ GLboolean __GLXEW_VERSION_1_3 = GL_FALSE; GLboolean __GLXEW_VERSION_1_4 = GL_FALSE; GLboolean __GLXEW_3DFX_multisample = GL_FALSE; GLboolean __GLXEW_ARB_create_context = GL_FALSE; +GLboolean __GLXEW_ARB_create_context_profile = GL_FALSE; GLboolean __GLXEW_ARB_fbconfig_float = GL_FALSE; GLboolean __GLXEW_ARB_framebuffer_sRGB = GL_FALSE; GLboolean __GLXEW_ARB_get_proc_address = GL_FALSE; @@ -8295,6 +9116,7 @@ GLboolean __GLXEW_EXT_fbconfig_packed_float = GL_FALSE; GLboolean __GLXEW_EXT_framebuffer_sRGB = GL_FALSE; GLboolean __GLXEW_EXT_import_context = GL_FALSE; GLboolean __GLXEW_EXT_scene_marker = GL_FALSE; +GLboolean __GLXEW_EXT_swap_control = GL_FALSE; GLboolean __GLXEW_EXT_texture_from_pixmap = GL_FALSE; GLboolean __GLXEW_EXT_visual_info = GL_FALSE; GLboolean __GLXEW_EXT_visual_rating = GL_FALSE; @@ -8303,6 +9125,7 @@ GLboolean __GLXEW_MESA_copy_sub_buffer = GL_FALSE; GLboolean __GLXEW_MESA_pixmap_colormap = GL_FALSE; GLboolean __GLXEW_MESA_release_buffers = GL_FALSE; GLboolean __GLXEW_MESA_set_3dfx_mode = GL_FALSE; +GLboolean __GLXEW_NV_copy_image = GL_FALSE; GLboolean __GLXEW_NV_float_buffer = GL_FALSE; GLboolean __GLXEW_NV_present_video = GL_FALSE; GLboolean __GLXEW_NV_swap_group = GL_FALSE; @@ -8395,6 +9218,10 @@ static GLboolean _glewInit_GLX_ARB_create_context (GLXEW_CONTEXT_ARG_DEF_INIT) #endif /* GLX_ARB_create_context */ +#ifdef GLX_ARB_create_context_profile + +#endif /* GLX_ARB_create_context_profile */ + #ifdef GLX_ARB_fbconfig_float #endif /* GLX_ARB_fbconfig_float */ @@ -8458,6 +9285,19 @@ static GLboolean _glewInit_GLX_EXT_import_context (GLXEW_CONTEXT_ARG_DEF_INIT) #endif /* GLX_EXT_scene_marker */ +#ifdef GLX_EXT_swap_control + +static GLboolean _glewInit_GLX_EXT_swap_control (GLXEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glXSwapIntervalEXT = (PFNGLXSWAPINTERVALEXTPROC)glewGetProcAddress((const GLubyte*)"glXSwapIntervalEXT")) == NULL) || r; + + return r; +} + +#endif /* GLX_EXT_swap_control */ + #ifdef GLX_EXT_texture_from_pixmap static GLboolean _glewInit_GLX_EXT_texture_from_pixmap (GLXEW_CONTEXT_ARG_DEF_INIT) @@ -8545,6 +9385,19 @@ static GLboolean _glewInit_GLX_MESA_set_3dfx_mode (GLXEW_CONTEXT_ARG_DEF_INIT) #endif /* GLX_MESA_set_3dfx_mode */ +#ifdef GLX_NV_copy_image + +static GLboolean _glewInit_GLX_NV_copy_image (GLXEW_CONTEXT_ARG_DEF_INIT) +{ + GLboolean r = GL_FALSE; + + r = ((glXCopyImageSubDataNV = (PFNGLXCOPYIMAGESUBDATANVPROC)glewGetProcAddress((const GLubyte*)"glXCopyImageSubDataNV")) == NULL) || r; + + return r; +} + +#endif /* GLX_NV_copy_image */ + #ifdef GLX_NV_float_buffer #endif /* GLX_NV_float_buffer */ @@ -8841,10 +9694,10 @@ GLboolean glxewGetExtension (const char* name) { GLubyte* p; GLubyte* end; - GLuint len = _glewStrLen((const GLubyte*)name); -/* if (glXQueryExtensionsString == NULL || glXGetCurrentDisplay == NULL) return GL_FALSE; */ -/* p = (GLubyte*)glXQueryExtensionsString(glXGetCurrentDisplay(), DefaultScreen(glXGetCurrentDisplay())); */ - if (glXGetClientString == NULL || glXGetCurrentDisplay == NULL) return GL_FALSE; + GLuint len; + + if (glXGetCurrentDisplay == NULL) return GL_FALSE; + len = _glewStrLen((const GLubyte*)name); p = (GLubyte*)glXGetClientString(glXGetCurrentDisplay(), GLX_EXTENSIONS); if (0 == p) return GL_FALSE; end = p + _glewStrLen(p); @@ -8897,6 +9750,9 @@ GLenum glxewContextInit (GLXEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLXEW_ARB_create_context) = glxewGetExtension("GLX_ARB_create_context"); if (glewExperimental || GLXEW_ARB_create_context) CONST_CAST(GLXEW_ARB_create_context) = !_glewInit_GLX_ARB_create_context(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GLX_ARB_create_context */ +#ifdef GLX_ARB_create_context_profile + CONST_CAST(GLXEW_ARB_create_context_profile) = glxewGetExtension("GLX_ARB_create_context_profile"); +#endif /* GLX_ARB_create_context_profile */ #ifdef GLX_ARB_fbconfig_float CONST_CAST(GLXEW_ARB_fbconfig_float) = glxewGetExtension("GLX_ARB_fbconfig_float"); #endif /* GLX_ARB_fbconfig_float */ @@ -8929,6 +9785,10 @@ GLenum glxewContextInit (GLXEW_CONTEXT_ARG_DEF_LIST) #ifdef GLX_EXT_scene_marker CONST_CAST(GLXEW_EXT_scene_marker) = glxewGetExtension("GLX_EXT_scene_marker"); #endif /* GLX_EXT_scene_marker */ +#ifdef GLX_EXT_swap_control + CONST_CAST(GLXEW_EXT_swap_control) = glxewGetExtension("GLX_EXT_swap_control"); + if (glewExperimental || GLXEW_EXT_swap_control) CONST_CAST(GLXEW_EXT_swap_control) = !_glewInit_GLX_EXT_swap_control(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GLX_EXT_swap_control */ #ifdef GLX_EXT_texture_from_pixmap CONST_CAST(GLXEW_EXT_texture_from_pixmap) = glxewGetExtension("GLX_EXT_texture_from_pixmap"); if (glewExperimental || GLXEW_EXT_texture_from_pixmap) CONST_CAST(GLXEW_EXT_texture_from_pixmap) = !_glewInit_GLX_EXT_texture_from_pixmap(GLEW_CONTEXT_ARG_VAR_INIT); @@ -8959,6 +9819,10 @@ GLenum glxewContextInit (GLXEW_CONTEXT_ARG_DEF_LIST) CONST_CAST(GLXEW_MESA_set_3dfx_mode) = glxewGetExtension("GLX_MESA_set_3dfx_mode"); if (glewExperimental || GLXEW_MESA_set_3dfx_mode) CONST_CAST(GLXEW_MESA_set_3dfx_mode) = !_glewInit_GLX_MESA_set_3dfx_mode(GLEW_CONTEXT_ARG_VAR_INIT); #endif /* GLX_MESA_set_3dfx_mode */ +#ifdef GLX_NV_copy_image + CONST_CAST(GLXEW_NV_copy_image) = glxewGetExtension("GLX_NV_copy_image"); + if (glewExperimental || GLXEW_NV_copy_image) CONST_CAST(GLXEW_NV_copy_image) = !_glewInit_GLX_NV_copy_image(GLEW_CONTEXT_ARG_VAR_INIT); +#endif /* GLX_NV_copy_image */ #ifdef GLX_NV_float_buffer CONST_CAST(GLXEW_NV_float_buffer) = glxewGetExtension("GLX_NV_float_buffer"); #endif /* GLX_NV_float_buffer */ @@ -9076,10 +9940,10 @@ const GLubyte* glewGetString (GLenum name) static const GLubyte* _glewString[] = { (const GLubyte*)NULL, - (const GLubyte*)"1.5.1", + (const GLubyte*)"1.5.2", (const GLubyte*)"1", (const GLubyte*)"5", - (const GLubyte*)"1" + (const GLubyte*)"2" }; const int max_string = sizeof(_glewString)/sizeof(*_glewString) - 1; return _glewString[(int)name > max_string ? 0 : (int)name]; @@ -9175,6 +10039,20 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_VERSION_3_1 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"3_1", 3)) + { + ret = GLEW_VERSION_3_1; + continue; + } +#endif +#ifdef GL_VERSION_3_2 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"3_2", 3)) + { + ret = GLEW_VERSION_3_2; + continue; + } +#endif } if (_glewStrSame2(&pos, &len, (const GLubyte*)"3DFX_", 5)) { @@ -9200,8 +10078,46 @@ GLboolean glewIsSupported (const char* name) } #endif } + if (_glewStrSame2(&pos, &len, (const GLubyte*)"AMD_", 4)) + { +#ifdef GL_AMD_draw_buffers_blend + if (_glewStrSame3(&pos, &len, (const GLubyte*)"draw_buffers_blend", 18)) + { + ret = GLEW_AMD_draw_buffers_blend; + continue; + } +#endif +#ifdef GL_AMD_performance_monitor + if (_glewStrSame3(&pos, &len, (const GLubyte*)"performance_monitor", 19)) + { + ret = GLEW_AMD_performance_monitor; + continue; + } +#endif +#ifdef GL_AMD_texture_texture4 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_texture4", 16)) + { + ret = GLEW_AMD_texture_texture4; + continue; + } +#endif +#ifdef GL_AMD_vertex_shader_tessellator + if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_shader_tessellator", 25)) + { + ret = GLEW_AMD_vertex_shader_tessellator; + continue; + } +#endif + } if (_glewStrSame2(&pos, &len, (const GLubyte*)"APPLE_", 6)) { +#ifdef GL_APPLE_aux_depth_stencil + if (_glewStrSame3(&pos, &len, (const GLubyte*)"aux_depth_stencil", 17)) + { + ret = GLEW_APPLE_aux_depth_stencil; + continue; + } +#endif #ifdef GL_APPLE_client_storage if (_glewStrSame3(&pos, &len, (const GLubyte*)"client_storage", 14)) { @@ -9237,6 +10153,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_APPLE_object_purgeable + if (_glewStrSame3(&pos, &len, (const GLubyte*)"object_purgeable", 16)) + { + ret = GLEW_APPLE_object_purgeable; + continue; + } +#endif #ifdef GL_APPLE_pixel_buffer if (_glewStrSame3(&pos, &len, (const GLubyte*)"pixel_buffer", 12)) { @@ -9244,6 +10167,20 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_APPLE_rgb_422 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"rgb_422", 7)) + { + ret = GLEW_APPLE_rgb_422; + continue; + } +#endif +#ifdef GL_APPLE_row_bytes + if (_glewStrSame3(&pos, &len, (const GLubyte*)"row_bytes", 9)) + { + ret = GLEW_APPLE_row_bytes; + continue; + } +#endif #ifdef GL_APPLE_specular_vector if (_glewStrSame3(&pos, &len, (const GLubyte*)"specular_vector", 15)) { @@ -9279,6 +10216,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_APPLE_vertex_program_evaluators + if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_program_evaluators", 25)) + { + ret = GLEW_APPLE_vertex_program_evaluators; + continue; + } +#endif #ifdef GL_APPLE_ycbcr_422 if (_glewStrSame3(&pos, &len, (const GLubyte*)"ycbcr_422", 9)) { @@ -9296,6 +10240,20 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_compatibility + if (_glewStrSame3(&pos, &len, (const GLubyte*)"compatibility", 13)) + { + ret = GLEW_ARB_compatibility; + continue; + } +#endif +#ifdef GL_ARB_copy_buffer + if (_glewStrSame3(&pos, &len, (const GLubyte*)"copy_buffer", 11)) + { + ret = GLEW_ARB_copy_buffer; + continue; + } +#endif #ifdef GL_ARB_depth_buffer_float if (_glewStrSame3(&pos, &len, (const GLubyte*)"depth_buffer_float", 18)) { @@ -9303,6 +10261,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_depth_clamp + if (_glewStrSame3(&pos, &len, (const GLubyte*)"depth_clamp", 11)) + { + ret = GLEW_ARB_depth_clamp; + continue; + } +#endif #ifdef GL_ARB_depth_texture if (_glewStrSame3(&pos, &len, (const GLubyte*)"depth_texture", 13)) { @@ -9317,6 +10282,20 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_draw_buffers_blend + if (_glewStrSame3(&pos, &len, (const GLubyte*)"draw_buffers_blend", 18)) + { + ret = GLEW_ARB_draw_buffers_blend; + continue; + } +#endif +#ifdef GL_ARB_draw_elements_base_vertex + if (_glewStrSame3(&pos, &len, (const GLubyte*)"draw_elements_base_vertex", 25)) + { + ret = GLEW_ARB_draw_elements_base_vertex; + continue; + } +#endif #ifdef GL_ARB_draw_instanced if (_glewStrSame3(&pos, &len, (const GLubyte*)"draw_instanced", 14)) { @@ -9324,6 +10303,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_fragment_coord_conventions + if (_glewStrSame3(&pos, &len, (const GLubyte*)"fragment_coord_conventions", 26)) + { + ret = GLEW_ARB_fragment_coord_conventions; + continue; + } +#endif #ifdef GL_ARB_fragment_program if (_glewStrSame3(&pos, &len, (const GLubyte*)"fragment_program", 16)) { @@ -9450,6 +10436,27 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_provoking_vertex + if (_glewStrSame3(&pos, &len, (const GLubyte*)"provoking_vertex", 16)) + { + ret = GLEW_ARB_provoking_vertex; + continue; + } +#endif +#ifdef GL_ARB_sample_shading + if (_glewStrSame3(&pos, &len, (const GLubyte*)"sample_shading", 14)) + { + ret = GLEW_ARB_sample_shading; + continue; + } +#endif +#ifdef GL_ARB_seamless_cube_map + if (_glewStrSame3(&pos, &len, (const GLubyte*)"seamless_cube_map", 17)) + { + ret = GLEW_ARB_seamless_cube_map; + continue; + } +#endif #ifdef GL_ARB_shader_objects if (_glewStrSame3(&pos, &len, (const GLubyte*)"shader_objects", 14)) { @@ -9457,6 +10464,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_shader_texture_lod + if (_glewStrSame3(&pos, &len, (const GLubyte*)"shader_texture_lod", 18)) + { + ret = GLEW_ARB_shader_texture_lod; + continue; + } +#endif #ifdef GL_ARB_shading_language_100 if (_glewStrSame3(&pos, &len, (const GLubyte*)"shading_language_100", 20)) { @@ -9478,6 +10492,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_sync + if (_glewStrSame3(&pos, &len, (const GLubyte*)"sync", 4)) + { + ret = GLEW_ARB_sync; + continue; + } +#endif #ifdef GL_ARB_texture_border_clamp if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_border_clamp", 20)) { @@ -9513,6 +10534,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_texture_cube_map_array + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_cube_map_array", 22)) + { + ret = GLEW_ARB_texture_cube_map_array; + continue; + } +#endif #ifdef GL_ARB_texture_env_add if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_env_add", 15)) { @@ -9548,6 +10576,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_texture_gather + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_gather", 14)) + { + ret = GLEW_ARB_texture_gather; + continue; + } +#endif #ifdef GL_ARB_texture_mirrored_repeat if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_mirrored_repeat", 23)) { @@ -9555,6 +10590,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_texture_multisample + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_multisample", 19)) + { + ret = GLEW_ARB_texture_multisample; + continue; + } +#endif #ifdef GL_ARB_texture_non_power_of_two if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_non_power_of_two", 24)) { @@ -9562,6 +10604,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_texture_query_lod + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_query_lod", 17)) + { + ret = GLEW_ARB_texture_query_lod; + continue; + } +#endif #ifdef GL_ARB_texture_rectangle if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_rectangle", 17)) { @@ -9583,6 +10632,20 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ARB_uniform_buffer_object + if (_glewStrSame3(&pos, &len, (const GLubyte*)"uniform_buffer_object", 21)) + { + ret = GLEW_ARB_uniform_buffer_object; + continue; + } +#endif +#ifdef GL_ARB_vertex_array_bgra + if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_array_bgra", 17)) + { + ret = GLEW_ARB_vertex_array_bgra; + continue; + } +#endif #ifdef GL_ARB_vertex_array_object if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_array_object", 19)) { @@ -9694,6 +10757,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_ATI_meminfo + if (_glewStrSame3(&pos, &len, (const GLubyte*)"meminfo", 7)) + { + ret = GLEW_ATI_meminfo; + continue; + } +#endif #ifdef GL_ATI_pn_triangles if (_glewStrSame3(&pos, &len, (const GLubyte*)"pn_triangles", 12)) { @@ -10131,6 +11201,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_EXT_provoking_vertex + if (_glewStrSame3(&pos, &len, (const GLubyte*)"provoking_vertex", 16)) + { + ret = GLEW_EXT_provoking_vertex; + continue; + } +#endif #ifdef GL_EXT_rescale_normal if (_glewStrSame3(&pos, &len, (const GLubyte*)"rescale_normal", 14)) { @@ -10152,6 +11229,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_EXT_separate_shader_objects + if (_glewStrSame3(&pos, &len, (const GLubyte*)"separate_shader_objects", 23)) + { + ret = GLEW_EXT_separate_shader_objects; + continue; + } +#endif #ifdef GL_EXT_separate_specular_color if (_glewStrSame3(&pos, &len, (const GLubyte*)"separate_specular_color", 23)) { @@ -10362,6 +11446,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_EXT_texture_snorm + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_snorm", 13)) + { + ret = GLEW_EXT_texture_snorm; + continue; + } +#endif #ifdef GL_EXT_texture_swizzle if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_swizzle", 15)) { @@ -10613,6 +11704,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_copy_image + if (_glewStrSame3(&pos, &len, (const GLubyte*)"copy_image", 10)) + { + ret = GLEW_NV_copy_image; + continue; + } +#endif #ifdef GL_NV_depth_buffer_float if (_glewStrSame3(&pos, &len, (const GLubyte*)"depth_buffer_float", 18)) { @@ -10767,6 +11865,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_parameter_buffer_object2 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"parameter_buffer_object2", 24)) + { + ret = GLEW_NV_parameter_buffer_object2; + continue; + } +#endif #ifdef GL_NV_pixel_data_range if (_glewStrSame3(&pos, &len, (const GLubyte*)"pixel_data_range", 16)) { @@ -10809,6 +11914,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_shader_buffer_load + if (_glewStrSame3(&pos, &len, (const GLubyte*)"shader_buffer_load", 18)) + { + ret = GLEW_NV_shader_buffer_load; + continue; + } +#endif #ifdef GL_NV_texgen_emboss if (_glewStrSame3(&pos, &len, (const GLubyte*)"texgen_emboss", 13)) { @@ -10823,6 +11935,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_texture_barrier + if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_barrier", 15)) + { + ret = GLEW_NV_texture_barrier; + continue; + } +#endif #ifdef GL_NV_texture_compression_vtc if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_compression_vtc", 23)) { @@ -10879,6 +11998,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_transform_feedback2 + if (_glewStrSame3(&pos, &len, (const GLubyte*)"transform_feedback2", 19)) + { + ret = GLEW_NV_transform_feedback2; + continue; + } +#endif #ifdef GL_NV_vertex_array_range if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_array_range", 18)) { @@ -10893,6 +12019,13 @@ GLboolean glewIsSupported (const char* name) continue; } #endif +#ifdef GL_NV_vertex_buffer_unified_memory + if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_buffer_unified_memory", 28)) + { + ret = GLEW_NV_vertex_buffer_unified_memory; + continue; + } +#endif #ifdef GL_NV_vertex_program if (_glewStrSame3(&pos, &len, (const GLubyte*)"vertex_program", 14)) { @@ -11507,6 +12640,16 @@ GLboolean wglewIsSupported (const char* name) } #endif } + if (_glewStrSame2(&pos, &len, (const GLubyte*)"AMD_", 4)) + { +#ifdef WGL_AMD_gpu_association + if (_glewStrSame3(&pos, &len, (const GLubyte*)"gpu_association", 15)) + { + ret = WGLEW_AMD_gpu_association; + continue; + } +#endif + } if (_glewStrSame2(&pos, &len, (const GLubyte*)"ARB_", 4)) { #ifdef WGL_ARB_buffer_region @@ -11523,6 +12666,13 @@ GLboolean wglewIsSupported (const char* name) continue; } #endif +#ifdef WGL_ARB_create_context_profile + if (_glewStrSame3(&pos, &len, (const GLubyte*)"create_context_profile", 22)) + { + ret = WGLEW_ARB_create_context_profile; + continue; + } +#endif #ifdef WGL_ARB_extensions_string if (_glewStrSame3(&pos, &len, (const GLubyte*)"extensions_string", 17)) { @@ -11717,6 +12867,13 @@ GLboolean wglewIsSupported (const char* name) } if (_glewStrSame2(&pos, &len, (const GLubyte*)"NV_", 3)) { +#ifdef WGL_NV_copy_image + if (_glewStrSame3(&pos, &len, (const GLubyte*)"copy_image", 10)) + { + ret = WGLEW_NV_copy_image; + continue; + } +#endif #ifdef WGL_NV_float_buffer if (_glewStrSame3(&pos, &len, (const GLubyte*)"float_buffer", 12)) { @@ -11848,6 +13005,13 @@ GLboolean glxewIsSupported (const char* name) continue; } #endif +#ifdef GLX_ARB_create_context_profile + if (_glewStrSame3(&pos, &len, (const GLubyte*)"create_context_profile", 22)) + { + ret = GLXEW_ARB_create_context_profile; + continue; + } +#endif #ifdef GLX_ARB_fbconfig_float if (_glewStrSame3(&pos, &len, (const GLubyte*)"fbconfig_float", 14)) { @@ -11924,6 +13088,13 @@ GLboolean glxewIsSupported (const char* name) continue; } #endif +#ifdef GLX_EXT_swap_control + if (_glewStrSame3(&pos, &len, (const GLubyte*)"swap_control", 12)) + { + ret = GLXEW_EXT_swap_control; + continue; + } +#endif #ifdef GLX_EXT_texture_from_pixmap if (_glewStrSame3(&pos, &len, (const GLubyte*)"texture_from_pixmap", 19)) { @@ -11986,6 +13157,13 @@ GLboolean glxewIsSupported (const char* name) } if (_glewStrSame2(&pos, &len, (const GLubyte*)"NV_", 3)) { +#ifdef GLX_NV_copy_image + if (_glewStrSame3(&pos, &len, (const GLubyte*)"copy_image", 10)) + { + ret = GLXEW_NV_copy_image; + continue; + } +#endif #ifdef GLX_NV_float_buffer if (_glewStrSame3(&pos, &len, (const GLubyte*)"float_buffer", 12)) { diff --git a/src/glew/glewinfo.c b/src/glew/glewinfo.c index da2b241dea..6847cbb865 100644 --- a/src/glew/glewinfo.c +++ b/src/glew/glewinfo.c @@ -389,8 +389,6 @@ static void _glewInfo_GL_VERSION_3_0 (void) glewInfoFunc("glBeginConditionalRender", glBeginConditionalRender == NULL); glewInfoFunc("glBeginTransformFeedback", glBeginTransformFeedback == NULL); - glewInfoFunc("glBindBufferBase", glBindBufferBase == NULL); - glewInfoFunc("glBindBufferRange", glBindBufferRange == NULL); glewInfoFunc("glBindFragDataLocation", glBindFragDataLocation == NULL); glewInfoFunc("glClampColor", glClampColor == NULL); glewInfoFunc("glClearBufferfi", glClearBufferfi == NULL); @@ -404,7 +402,6 @@ static void _glewInfo_GL_VERSION_3_0 (void) glewInfoFunc("glEndTransformFeedback", glEndTransformFeedback == NULL); glewInfoFunc("glGetBooleani_v", glGetBooleani_v == NULL); glewInfoFunc("glGetFragDataLocation", glGetFragDataLocation == NULL); - glewInfoFunc("glGetIntegeri_v", glGetIntegeri_v == NULL); glewInfoFunc("glGetStringi", glGetStringi == NULL); glewInfoFunc("glGetTexParameterIiv", glGetTexParameterIiv == NULL); glewInfoFunc("glGetTexParameterIuiv", glGetTexParameterIuiv == NULL); @@ -449,6 +446,33 @@ static void _glewInfo_GL_VERSION_3_0 (void) #endif /* GL_VERSION_3_0 */ +#ifdef GL_VERSION_3_1 + +static void _glewInfo_GL_VERSION_3_1 (void) +{ + glewPrintExt("GL_VERSION_3_1", GLEW_VERSION_3_1, GLEW_VERSION_3_1, GLEW_VERSION_3_1); + + glewInfoFunc("glDrawArraysInstanced", glDrawArraysInstanced == NULL); + glewInfoFunc("glDrawElementsInstanced", glDrawElementsInstanced == NULL); + glewInfoFunc("glPrimitiveRestartIndex", glPrimitiveRestartIndex == NULL); + glewInfoFunc("glTexBuffer", glTexBuffer == NULL); +} + +#endif /* GL_VERSION_3_1 */ + +#ifdef GL_VERSION_3_2 + +static void _glewInfo_GL_VERSION_3_2 (void) +{ + glewPrintExt("GL_VERSION_3_2", GLEW_VERSION_3_2, GLEW_VERSION_3_2, GLEW_VERSION_3_2); + + glewInfoFunc("glFramebufferTexture", glFramebufferTexture == NULL); + glewInfoFunc("glGetBufferParameteri64v", glGetBufferParameteri64v == NULL); + glewInfoFunc("glGetInteger64i_v", glGetInteger64i_v == NULL); +} + +#endif /* GL_VERSION_3_2 */ + #ifdef GL_3DFX_multisample static void _glewInfo_GL_3DFX_multisample (void) @@ -478,6 +502,71 @@ static void _glewInfo_GL_3DFX_texture_compression_FXT1 (void) #endif /* GL_3DFX_texture_compression_FXT1 */ +#ifdef GL_AMD_draw_buffers_blend + +static void _glewInfo_GL_AMD_draw_buffers_blend (void) +{ + glewPrintExt("GL_AMD_draw_buffers_blend", GLEW_AMD_draw_buffers_blend, glewIsSupported("GL_AMD_draw_buffers_blend"), glewGetExtension("GL_AMD_draw_buffers_blend")); + + glewInfoFunc("glBlendEquationIndexedAMD", glBlendEquationIndexedAMD == NULL); + glewInfoFunc("glBlendEquationSeparateIndexedAMD", glBlendEquationSeparateIndexedAMD == NULL); + glewInfoFunc("glBlendFuncIndexedAMD", glBlendFuncIndexedAMD == NULL); + glewInfoFunc("glBlendFuncSeparateIndexedAMD", glBlendFuncSeparateIndexedAMD == NULL); +} + +#endif /* GL_AMD_draw_buffers_blend */ + +#ifdef GL_AMD_performance_monitor + +static void _glewInfo_GL_AMD_performance_monitor (void) +{ + glewPrintExt("GL_AMD_performance_monitor", GLEW_AMD_performance_monitor, glewIsSupported("GL_AMD_performance_monitor"), glewGetExtension("GL_AMD_performance_monitor")); + + glewInfoFunc("glBeginPerfMonitorAMD", glBeginPerfMonitorAMD == NULL); + glewInfoFunc("glDeletePerfMonitorsAMD", glDeletePerfMonitorsAMD == NULL); + glewInfoFunc("glEndPerfMonitorAMD", glEndPerfMonitorAMD == NULL); + glewInfoFunc("glGenPerfMonitorsAMD", glGenPerfMonitorsAMD == NULL); + glewInfoFunc("glGetPerfMonitorCounterDataAMD", glGetPerfMonitorCounterDataAMD == NULL); + glewInfoFunc("glGetPerfMonitorCounterInfoAMD", glGetPerfMonitorCounterInfoAMD == NULL); + glewInfoFunc("glGetPerfMonitorCounterStringAMD", glGetPerfMonitorCounterStringAMD == NULL); + glewInfoFunc("glGetPerfMonitorCountersAMD", glGetPerfMonitorCountersAMD == NULL); + glewInfoFunc("glGetPerfMonitorGroupStringAMD", glGetPerfMonitorGroupStringAMD == NULL); + glewInfoFunc("glGetPerfMonitorGroupsAMD", glGetPerfMonitorGroupsAMD == NULL); + glewInfoFunc("glSelectPerfMonitorCountersAMD", glSelectPerfMonitorCountersAMD == NULL); +} + +#endif /* GL_AMD_performance_monitor */ + +#ifdef GL_AMD_texture_texture4 + +static void _glewInfo_GL_AMD_texture_texture4 (void) +{ + glewPrintExt("GL_AMD_texture_texture4", GLEW_AMD_texture_texture4, glewIsSupported("GL_AMD_texture_texture4"), glewGetExtension("GL_AMD_texture_texture4")); +} + +#endif /* GL_AMD_texture_texture4 */ + +#ifdef GL_AMD_vertex_shader_tessellator + +static void _glewInfo_GL_AMD_vertex_shader_tessellator (void) +{ + glewPrintExt("GL_AMD_vertex_shader_tessellator", GLEW_AMD_vertex_shader_tessellator, glewIsSupported("GL_AMD_vertex_shader_tessellator"), glewGetExtension("GL_AMD_vertex_shader_tessellator")); + + glewInfoFunc("glTessellationFactorAMD", glTessellationFactorAMD == NULL); + glewInfoFunc("glTessellationModeAMD", glTessellationModeAMD == NULL); +} + +#endif /* GL_AMD_vertex_shader_tessellator */ + +#ifdef GL_APPLE_aux_depth_stencil + +static void _glewInfo_GL_APPLE_aux_depth_stencil (void) +{ + glewPrintExt("GL_APPLE_aux_depth_stencil", GLEW_APPLE_aux_depth_stencil, glewIsSupported("GL_APPLE_aux_depth_stencil"), glewGetExtension("GL_APPLE_aux_depth_stencil")); +} + +#endif /* GL_APPLE_aux_depth_stencil */ + #ifdef GL_APPLE_client_storage static void _glewInfo_GL_APPLE_client_storage (void) @@ -541,6 +630,19 @@ static void _glewInfo_GL_APPLE_flush_buffer_range (void) #endif /* GL_APPLE_flush_buffer_range */ +#ifdef GL_APPLE_object_purgeable + +static void _glewInfo_GL_APPLE_object_purgeable (void) +{ + glewPrintExt("GL_APPLE_object_purgeable", GLEW_APPLE_object_purgeable, glewIsSupported("GL_APPLE_object_purgeable"), glewGetExtension("GL_APPLE_object_purgeable")); + + glewInfoFunc("glGetObjectParameterivAPPLE", glGetObjectParameterivAPPLE == NULL); + glewInfoFunc("glObjectPurgeableAPPLE", glObjectPurgeableAPPLE == NULL); + glewInfoFunc("glObjectUnpurgeableAPPLE", glObjectUnpurgeableAPPLE == NULL); +} + +#endif /* GL_APPLE_object_purgeable */ + #ifdef GL_APPLE_pixel_buffer static void _glewInfo_GL_APPLE_pixel_buffer (void) @@ -550,6 +652,24 @@ static void _glewInfo_GL_APPLE_pixel_buffer (void) #endif /* GL_APPLE_pixel_buffer */ +#ifdef GL_APPLE_rgb_422 + +static void _glewInfo_GL_APPLE_rgb_422 (void) +{ + glewPrintExt("GL_APPLE_rgb_422", GLEW_APPLE_rgb_422, glewIsSupported("GL_APPLE_rgb_422"), glewGetExtension("GL_APPLE_rgb_422")); +} + +#endif /* GL_APPLE_rgb_422 */ + +#ifdef GL_APPLE_row_bytes + +static void _glewInfo_GL_APPLE_row_bytes (void) +{ + glewPrintExt("GL_APPLE_row_bytes", GLEW_APPLE_row_bytes, glewIsSupported("GL_APPLE_row_bytes"), glewGetExtension("GL_APPLE_row_bytes")); +} + +#endif /* GL_APPLE_row_bytes */ + #ifdef GL_APPLE_specular_vector static void _glewInfo_GL_APPLE_specular_vector (void) @@ -607,6 +727,23 @@ static void _glewInfo_GL_APPLE_vertex_array_range (void) #endif /* GL_APPLE_vertex_array_range */ +#ifdef GL_APPLE_vertex_program_evaluators + +static void _glewInfo_GL_APPLE_vertex_program_evaluators (void) +{ + glewPrintExt("GL_APPLE_vertex_program_evaluators", GLEW_APPLE_vertex_program_evaluators, glewIsSupported("GL_APPLE_vertex_program_evaluators"), glewGetExtension("GL_APPLE_vertex_program_evaluators")); + + glewInfoFunc("glDisableVertexAttribAPPLE", glDisableVertexAttribAPPLE == NULL); + glewInfoFunc("glEnableVertexAttribAPPLE", glEnableVertexAttribAPPLE == NULL); + glewInfoFunc("glIsVertexAttribEnabledAPPLE", glIsVertexAttribEnabledAPPLE == NULL); + glewInfoFunc("glMapVertexAttrib1dAPPLE", glMapVertexAttrib1dAPPLE == NULL); + glewInfoFunc("glMapVertexAttrib1fAPPLE", glMapVertexAttrib1fAPPLE == NULL); + glewInfoFunc("glMapVertexAttrib2dAPPLE", glMapVertexAttrib2dAPPLE == NULL); + glewInfoFunc("glMapVertexAttrib2fAPPLE", glMapVertexAttrib2fAPPLE == NULL); +} + +#endif /* GL_APPLE_vertex_program_evaluators */ + #ifdef GL_APPLE_ycbcr_422 static void _glewInfo_GL_APPLE_ycbcr_422 (void) @@ -627,6 +764,26 @@ static void _glewInfo_GL_ARB_color_buffer_float (void) #endif /* GL_ARB_color_buffer_float */ +#ifdef GL_ARB_compatibility + +static void _glewInfo_GL_ARB_compatibility (void) +{ + glewPrintExt("GL_ARB_compatibility", GLEW_ARB_compatibility, glewIsSupported("GL_ARB_compatibility"), glewGetExtension("GL_ARB_compatibility")); +} + +#endif /* GL_ARB_compatibility */ + +#ifdef GL_ARB_copy_buffer + +static void _glewInfo_GL_ARB_copy_buffer (void) +{ + glewPrintExt("GL_ARB_copy_buffer", GLEW_ARB_copy_buffer, glewIsSupported("GL_ARB_copy_buffer"), glewGetExtension("GL_ARB_copy_buffer")); + + glewInfoFunc("glCopyBufferSubData", glCopyBufferSubData == NULL); +} + +#endif /* GL_ARB_copy_buffer */ + #ifdef GL_ARB_depth_buffer_float static void _glewInfo_GL_ARB_depth_buffer_float (void) @@ -636,6 +793,15 @@ static void _glewInfo_GL_ARB_depth_buffer_float (void) #endif /* GL_ARB_depth_buffer_float */ +#ifdef GL_ARB_depth_clamp + +static void _glewInfo_GL_ARB_depth_clamp (void) +{ + glewPrintExt("GL_ARB_depth_clamp", GLEW_ARB_depth_clamp, glewIsSupported("GL_ARB_depth_clamp"), glewGetExtension("GL_ARB_depth_clamp")); +} + +#endif /* GL_ARB_depth_clamp */ + #ifdef GL_ARB_depth_texture static void _glewInfo_GL_ARB_depth_texture (void) @@ -656,6 +822,34 @@ static void _glewInfo_GL_ARB_draw_buffers (void) #endif /* GL_ARB_draw_buffers */ +#ifdef GL_ARB_draw_buffers_blend + +static void _glewInfo_GL_ARB_draw_buffers_blend (void) +{ + glewPrintExt("GL_ARB_draw_buffers_blend", GLEW_ARB_draw_buffers_blend, glewIsSupported("GL_ARB_draw_buffers_blend"), glewGetExtension("GL_ARB_draw_buffers_blend")); + + glewInfoFunc("glBlendEquationSeparateiARB", glBlendEquationSeparateiARB == NULL); + glewInfoFunc("glBlendEquationiARB", glBlendEquationiARB == NULL); + glewInfoFunc("glBlendFuncSeparateiARB", glBlendFuncSeparateiARB == NULL); + glewInfoFunc("glBlendFunciARB", glBlendFunciARB == NULL); +} + +#endif /* GL_ARB_draw_buffers_blend */ + +#ifdef GL_ARB_draw_elements_base_vertex + +static void _glewInfo_GL_ARB_draw_elements_base_vertex (void) +{ + glewPrintExt("GL_ARB_draw_elements_base_vertex", GLEW_ARB_draw_elements_base_vertex, glewIsSupported("GL_ARB_draw_elements_base_vertex"), glewGetExtension("GL_ARB_draw_elements_base_vertex")); + + glewInfoFunc("glDrawElementsBaseVertex", glDrawElementsBaseVertex == NULL); + glewInfoFunc("glDrawElementsInstancedBaseVertex", glDrawElementsInstancedBaseVertex == NULL); + glewInfoFunc("glDrawRangeElementsBaseVertex", glDrawRangeElementsBaseVertex == NULL); + glewInfoFunc("glMultiDrawElementsBaseVertex", glMultiDrawElementsBaseVertex == NULL); +} + +#endif /* GL_ARB_draw_elements_base_vertex */ + #ifdef GL_ARB_draw_instanced static void _glewInfo_GL_ARB_draw_instanced (void) @@ -668,6 +862,15 @@ static void _glewInfo_GL_ARB_draw_instanced (void) #endif /* GL_ARB_draw_instanced */ +#ifdef GL_ARB_fragment_coord_conventions + +static void _glewInfo_GL_ARB_fragment_coord_conventions (void) +{ + glewPrintExt("GL_ARB_fragment_coord_conventions", GLEW_ARB_fragment_coord_conventions, glewIsSupported("GL_ARB_fragment_coord_conventions"), glewGetExtension("GL_ARB_fragment_coord_conventions")); +} + +#endif /* GL_ARB_fragment_coord_conventions */ + #ifdef GL_ARB_fragment_program static void _glewInfo_GL_ARB_fragment_program (void) @@ -708,10 +911,10 @@ static void _glewInfo_GL_ARB_framebuffer_object (void) glewInfoFunc("glDeleteFramebuffers", glDeleteFramebuffers == NULL); glewInfoFunc("glDeleteRenderbuffers", glDeleteRenderbuffers == NULL); glewInfoFunc("glFramebufferRenderbuffer", glFramebufferRenderbuffer == NULL); - glewInfoFunc("glFramebufferTextureLayer", glFramebufferTextureLayer == NULL); glewInfoFunc("glFramebufferTexture1D", glFramebufferTexture1D == NULL); glewInfoFunc("glFramebufferTexture2D", glFramebufferTexture2D == NULL); glewInfoFunc("glFramebufferTexture3D", glFramebufferTexture3D == NULL); + glewInfoFunc("glFramebufferTextureLayer", glFramebufferTextureLayer == NULL); glewInfoFunc("glGenFramebuffers", glGenFramebuffers == NULL); glewInfoFunc("glGenRenderbuffers", glGenRenderbuffers == NULL); glewInfoFunc("glGenerateMipmap", glGenerateMipmap == NULL); @@ -950,6 +1153,37 @@ static void _glewInfo_GL_ARB_point_sprite (void) #endif /* GL_ARB_point_sprite */ +#ifdef GL_ARB_provoking_vertex + +static void _glewInfo_GL_ARB_provoking_vertex (void) +{ + glewPrintExt("GL_ARB_provoking_vertex", GLEW_ARB_provoking_vertex, glewIsSupported("GL_ARB_provoking_vertex"), glewGetExtension("GL_ARB_provoking_vertex")); + + glewInfoFunc("glProvokingVertex", glProvokingVertex == NULL); +} + +#endif /* GL_ARB_provoking_vertex */ + +#ifdef GL_ARB_sample_shading + +static void _glewInfo_GL_ARB_sample_shading (void) +{ + glewPrintExt("GL_ARB_sample_shading", GLEW_ARB_sample_shading, glewIsSupported("GL_ARB_sample_shading"), glewGetExtension("GL_ARB_sample_shading")); + + glewInfoFunc("glMinSampleShadingARB", glMinSampleShadingARB == NULL); +} + +#endif /* GL_ARB_sample_shading */ + +#ifdef GL_ARB_seamless_cube_map + +static void _glewInfo_GL_ARB_seamless_cube_map (void) +{ + glewPrintExt("GL_ARB_seamless_cube_map", GLEW_ARB_seamless_cube_map, glewIsSupported("GL_ARB_seamless_cube_map"), glewGetExtension("GL_ARB_seamless_cube_map")); +} + +#endif /* GL_ARB_seamless_cube_map */ + #ifdef GL_ARB_shader_objects static void _glewInfo_GL_ARB_shader_objects (void) @@ -999,6 +1233,15 @@ static void _glewInfo_GL_ARB_shader_objects (void) #endif /* GL_ARB_shader_objects */ +#ifdef GL_ARB_shader_texture_lod + +static void _glewInfo_GL_ARB_shader_texture_lod (void) +{ + glewPrintExt("GL_ARB_shader_texture_lod", GLEW_ARB_shader_texture_lod, glewIsSupported("GL_ARB_shader_texture_lod"), glewGetExtension("GL_ARB_shader_texture_lod")); +} + +#endif /* GL_ARB_shader_texture_lod */ + #ifdef GL_ARB_shading_language_100 static void _glewInfo_GL_ARB_shading_language_100 (void) @@ -1026,6 +1269,23 @@ static void _glewInfo_GL_ARB_shadow_ambient (void) #endif /* GL_ARB_shadow_ambient */ +#ifdef GL_ARB_sync + +static void _glewInfo_GL_ARB_sync (void) +{ + glewPrintExt("GL_ARB_sync", GLEW_ARB_sync, glewIsSupported("GL_ARB_sync"), glewGetExtension("GL_ARB_sync")); + + glewInfoFunc("glClientWaitSync", glClientWaitSync == NULL); + glewInfoFunc("glDeleteSync", glDeleteSync == NULL); + glewInfoFunc("glFenceSync", glFenceSync == NULL); + glewInfoFunc("glGetInteger64v", glGetInteger64v == NULL); + glewInfoFunc("glGetSynciv", glGetSynciv == NULL); + glewInfoFunc("glIsSync", glIsSync == NULL); + glewInfoFunc("glWaitSync", glWaitSync == NULL); +} + +#endif /* GL_ARB_sync */ + #ifdef GL_ARB_texture_border_clamp static void _glewInfo_GL_ARB_texture_border_clamp (void) @@ -1081,6 +1341,15 @@ static void _glewInfo_GL_ARB_texture_cube_map (void) #endif /* GL_ARB_texture_cube_map */ +#ifdef GL_ARB_texture_cube_map_array + +static void _glewInfo_GL_ARB_texture_cube_map_array (void) +{ + glewPrintExt("GL_ARB_texture_cube_map_array", GLEW_ARB_texture_cube_map_array, glewIsSupported("GL_ARB_texture_cube_map_array"), glewGetExtension("GL_ARB_texture_cube_map_array")); +} + +#endif /* GL_ARB_texture_cube_map_array */ + #ifdef GL_ARB_texture_env_add static void _glewInfo_GL_ARB_texture_env_add (void) @@ -1126,6 +1395,15 @@ static void _glewInfo_GL_ARB_texture_float (void) #endif /* GL_ARB_texture_float */ +#ifdef GL_ARB_texture_gather + +static void _glewInfo_GL_ARB_texture_gather (void) +{ + glewPrintExt("GL_ARB_texture_gather", GLEW_ARB_texture_gather, glewIsSupported("GL_ARB_texture_gather"), glewGetExtension("GL_ARB_texture_gather")); +} + +#endif /* GL_ARB_texture_gather */ + #ifdef GL_ARB_texture_mirrored_repeat static void _glewInfo_GL_ARB_texture_mirrored_repeat (void) @@ -1135,6 +1413,20 @@ static void _glewInfo_GL_ARB_texture_mirrored_repeat (void) #endif /* GL_ARB_texture_mirrored_repeat */ +#ifdef GL_ARB_texture_multisample + +static void _glewInfo_GL_ARB_texture_multisample (void) +{ + glewPrintExt("GL_ARB_texture_multisample", GLEW_ARB_texture_multisample, glewIsSupported("GL_ARB_texture_multisample"), glewGetExtension("GL_ARB_texture_multisample")); + + glewInfoFunc("glGetMultisamplefv", glGetMultisamplefv == NULL); + glewInfoFunc("glSampleMaski", glSampleMaski == NULL); + glewInfoFunc("glTexImage2DMultisample", glTexImage2DMultisample == NULL); + glewInfoFunc("glTexImage3DMultisample", glTexImage3DMultisample == NULL); +} + +#endif /* GL_ARB_texture_multisample */ + #ifdef GL_ARB_texture_non_power_of_two static void _glewInfo_GL_ARB_texture_non_power_of_two (void) @@ -1144,6 +1436,15 @@ static void _glewInfo_GL_ARB_texture_non_power_of_two (void) #endif /* GL_ARB_texture_non_power_of_two */ +#ifdef GL_ARB_texture_query_lod + +static void _glewInfo_GL_ARB_texture_query_lod (void) +{ + glewPrintExt("GL_ARB_texture_query_lod", GLEW_ARB_texture_query_lod, glewIsSupported("GL_ARB_texture_query_lod"), glewGetExtension("GL_ARB_texture_query_lod")); +} + +#endif /* GL_ARB_texture_query_lod */ + #ifdef GL_ARB_texture_rectangle static void _glewInfo_GL_ARB_texture_rectangle (void) @@ -1176,6 +1477,35 @@ static void _glewInfo_GL_ARB_transpose_matrix (void) #endif /* GL_ARB_transpose_matrix */ +#ifdef GL_ARB_uniform_buffer_object + +static void _glewInfo_GL_ARB_uniform_buffer_object (void) +{ + glewPrintExt("GL_ARB_uniform_buffer_object", GLEW_ARB_uniform_buffer_object, glewIsSupported("GL_ARB_uniform_buffer_object"), glewGetExtension("GL_ARB_uniform_buffer_object")); + + glewInfoFunc("glBindBufferBase", glBindBufferBase == NULL); + glewInfoFunc("glBindBufferRange", glBindBufferRange == NULL); + glewInfoFunc("glGetActiveUniformBlockName", glGetActiveUniformBlockName == NULL); + glewInfoFunc("glGetActiveUniformBlockiv", glGetActiveUniformBlockiv == NULL); + glewInfoFunc("glGetActiveUniformName", glGetActiveUniformName == NULL); + glewInfoFunc("glGetActiveUniformsiv", glGetActiveUniformsiv == NULL); + glewInfoFunc("glGetIntegeri_v", glGetIntegeri_v == NULL); + glewInfoFunc("glGetUniformBlockIndex", glGetUniformBlockIndex == NULL); + glewInfoFunc("glGetUniformIndices", glGetUniformIndices == NULL); + glewInfoFunc("glUniformBlockBinding", glUniformBlockBinding == NULL); +} + +#endif /* GL_ARB_uniform_buffer_object */ + +#ifdef GL_ARB_vertex_array_bgra + +static void _glewInfo_GL_ARB_vertex_array_bgra (void) +{ + glewPrintExt("GL_ARB_vertex_array_bgra", GLEW_ARB_vertex_array_bgra, glewIsSupported("GL_ARB_vertex_array_bgra"), glewGetExtension("GL_ARB_vertex_array_bgra")); +} + +#endif /* GL_ARB_vertex_array_bgra */ + #ifdef GL_ARB_vertex_array_object static void _glewInfo_GL_ARB_vertex_array_object (void) @@ -1452,6 +1782,15 @@ static void _glewInfo_GL_ATI_map_object_buffer (void) #endif /* GL_ATI_map_object_buffer */ +#ifdef GL_ATI_meminfo + +static void _glewInfo_GL_ATI_meminfo (void) +{ + glewPrintExt("GL_ATI_meminfo", GLEW_ATI_meminfo, glewIsSupported("GL_ATI_meminfo"), glewGetExtension("GL_ATI_meminfo")); +} + +#endif /* GL_ATI_meminfo */ + #ifdef GL_ATI_pn_triangles static void _glewInfo_GL_ATI_pn_triangles (void) @@ -1870,7 +2209,14 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glCopyTextureSubImage2DEXT", glCopyTextureSubImage2DEXT == NULL); glewInfoFunc("glCopyTextureSubImage3DEXT", glCopyTextureSubImage3DEXT == NULL); glewInfoFunc("glDisableClientStateIndexedEXT", glDisableClientStateIndexedEXT == NULL); + glewInfoFunc("glDisableClientStateiEXT", glDisableClientStateiEXT == NULL); + glewInfoFunc("glDisableVertexArrayAttribEXT", glDisableVertexArrayAttribEXT == NULL); + glewInfoFunc("glDisableVertexArrayEXT", glDisableVertexArrayEXT == NULL); glewInfoFunc("glEnableClientStateIndexedEXT", glEnableClientStateIndexedEXT == NULL); + glewInfoFunc("glEnableClientStateiEXT", glEnableClientStateiEXT == NULL); + glewInfoFunc("glEnableVertexArrayAttribEXT", glEnableVertexArrayAttribEXT == NULL); + glewInfoFunc("glEnableVertexArrayEXT", glEnableVertexArrayEXT == NULL); + glewInfoFunc("glFlushMappedNamedBufferRangeEXT", glFlushMappedNamedBufferRangeEXT == NULL); glewInfoFunc("glFramebufferDrawBufferEXT", glFramebufferDrawBufferEXT == NULL); glewInfoFunc("glFramebufferDrawBuffersEXT", glFramebufferDrawBuffersEXT == NULL); glewInfoFunc("glFramebufferReadBufferEXT", glFramebufferReadBufferEXT == NULL); @@ -1879,7 +2225,9 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glGetCompressedMultiTexImageEXT", glGetCompressedMultiTexImageEXT == NULL); glewInfoFunc("glGetCompressedTextureImageEXT", glGetCompressedTextureImageEXT == NULL); glewInfoFunc("glGetDoubleIndexedvEXT", glGetDoubleIndexedvEXT == NULL); + glewInfoFunc("glGetDoublei_vEXT", glGetDoublei_vEXT == NULL); glewInfoFunc("glGetFloatIndexedvEXT", glGetFloatIndexedvEXT == NULL); + glewInfoFunc("glGetFloati_vEXT", glGetFloati_vEXT == NULL); glewInfoFunc("glGetFramebufferParameterivEXT", glGetFramebufferParameterivEXT == NULL); glewInfoFunc("glGetMultiTexEnvfvEXT", glGetMultiTexEnvfvEXT == NULL); glewInfoFunc("glGetMultiTexEnvivEXT", glGetMultiTexEnvivEXT == NULL); @@ -1905,6 +2253,7 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glGetNamedProgramivEXT", glGetNamedProgramivEXT == NULL); glewInfoFunc("glGetNamedRenderbufferParameterivEXT", glGetNamedRenderbufferParameterivEXT == NULL); glewInfoFunc("glGetPointerIndexedvEXT", glGetPointerIndexedvEXT == NULL); + glewInfoFunc("glGetPointeri_vEXT", glGetPointeri_vEXT == NULL); glewInfoFunc("glGetTextureImageEXT", glGetTextureImageEXT == NULL); glewInfoFunc("glGetTextureLevelParameterfvEXT", glGetTextureLevelParameterfvEXT == NULL); glewInfoFunc("glGetTextureLevelParameterivEXT", glGetTextureLevelParameterivEXT == NULL); @@ -1912,7 +2261,12 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glGetTextureParameterIuivEXT", glGetTextureParameterIuivEXT == NULL); glewInfoFunc("glGetTextureParameterfvEXT", glGetTextureParameterfvEXT == NULL); glewInfoFunc("glGetTextureParameterivEXT", glGetTextureParameterivEXT == NULL); + glewInfoFunc("glGetVertexArrayIntegeri_vEXT", glGetVertexArrayIntegeri_vEXT == NULL); + glewInfoFunc("glGetVertexArrayIntegervEXT", glGetVertexArrayIntegervEXT == NULL); + glewInfoFunc("glGetVertexArrayPointeri_vEXT", glGetVertexArrayPointeri_vEXT == NULL); + glewInfoFunc("glGetVertexArrayPointervEXT", glGetVertexArrayPointervEXT == NULL); glewInfoFunc("glMapNamedBufferEXT", glMapNamedBufferEXT == NULL); + glewInfoFunc("glMapNamedBufferRangeEXT", glMapNamedBufferRangeEXT == NULL); glewInfoFunc("glMatrixFrustumEXT", glMatrixFrustumEXT == NULL); glewInfoFunc("glMatrixLoadIdentityEXT", glMatrixLoadIdentityEXT == NULL); glewInfoFunc("glMatrixLoadTransposedEXT", glMatrixLoadTransposedEXT == NULL); @@ -1959,6 +2313,7 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glMultiTexSubImage3DEXT", glMultiTexSubImage3DEXT == NULL); glewInfoFunc("glNamedBufferDataEXT", glNamedBufferDataEXT == NULL); glewInfoFunc("glNamedBufferSubDataEXT", glNamedBufferSubDataEXT == NULL); + glewInfoFunc("glNamedCopyBufferSubDataEXT", glNamedCopyBufferSubDataEXT == NULL); glewInfoFunc("glNamedFramebufferRenderbufferEXT", glNamedFramebufferRenderbufferEXT == NULL); glewInfoFunc("glNamedFramebufferTexture1DEXT", glNamedFramebufferTexture1DEXT == NULL); glewInfoFunc("glNamedFramebufferTexture2DEXT", glNamedFramebufferTexture2DEXT == NULL); @@ -2030,6 +2385,17 @@ static void _glewInfo_GL_EXT_direct_state_access (void) glewInfoFunc("glTextureSubImage2DEXT", glTextureSubImage2DEXT == NULL); glewInfoFunc("glTextureSubImage3DEXT", glTextureSubImage3DEXT == NULL); glewInfoFunc("glUnmapNamedBufferEXT", glUnmapNamedBufferEXT == NULL); + glewInfoFunc("glVertexArrayColorOffsetEXT", glVertexArrayColorOffsetEXT == NULL); + glewInfoFunc("glVertexArrayEdgeFlagOffsetEXT", glVertexArrayEdgeFlagOffsetEXT == NULL); + glewInfoFunc("glVertexArrayFogCoordOffsetEXT", glVertexArrayFogCoordOffsetEXT == NULL); + glewInfoFunc("glVertexArrayIndexOffsetEXT", glVertexArrayIndexOffsetEXT == NULL); + glewInfoFunc("glVertexArrayMultiTexCoordOffsetEXT", glVertexArrayMultiTexCoordOffsetEXT == NULL); + glewInfoFunc("glVertexArrayNormalOffsetEXT", glVertexArrayNormalOffsetEXT == NULL); + glewInfoFunc("glVertexArraySecondaryColorOffsetEXT", glVertexArraySecondaryColorOffsetEXT == NULL); + glewInfoFunc("glVertexArrayTexCoordOffsetEXT", glVertexArrayTexCoordOffsetEXT == NULL); + glewInfoFunc("glVertexArrayVertexAttribIOffsetEXT", glVertexArrayVertexAttribIOffsetEXT == NULL); + glewInfoFunc("glVertexArrayVertexAttribOffsetEXT", glVertexArrayVertexAttribOffsetEXT == NULL); + glewInfoFunc("glVertexArrayVertexOffsetEXT", glVertexArrayVertexOffsetEXT == NULL); } #endif /* GL_EXT_direct_state_access */ @@ -2448,6 +2814,17 @@ static void _glewInfo_GL_EXT_polygon_offset (void) #endif /* GL_EXT_polygon_offset */ +#ifdef GL_EXT_provoking_vertex + +static void _glewInfo_GL_EXT_provoking_vertex (void) +{ + glewPrintExt("GL_EXT_provoking_vertex", GLEW_EXT_provoking_vertex, glewIsSupported("GL_EXT_provoking_vertex"), glewGetExtension("GL_EXT_provoking_vertex")); + + glewInfoFunc("glProvokingVertexEXT", glProvokingVertexEXT == NULL); +} + +#endif /* GL_EXT_provoking_vertex */ + #ifdef GL_EXT_rescale_normal static void _glewInfo_GL_EXT_rescale_normal (void) @@ -2496,6 +2873,19 @@ static void _glewInfo_GL_EXT_secondary_color (void) #endif /* GL_EXT_secondary_color */ +#ifdef GL_EXT_separate_shader_objects + +static void _glewInfo_GL_EXT_separate_shader_objects (void) +{ + glewPrintExt("GL_EXT_separate_shader_objects", GLEW_EXT_separate_shader_objects, glewIsSupported("GL_EXT_separate_shader_objects"), glewGetExtension("GL_EXT_separate_shader_objects")); + + glewInfoFunc("glActiveProgramEXT", glActiveProgramEXT == NULL); + glewInfoFunc("glCreateShaderProgramEXT", glCreateShaderProgramEXT == NULL); + glewInfoFunc("glUseShaderProgramEXT", glUseShaderProgramEXT == NULL); +} + +#endif /* GL_EXT_separate_shader_objects */ + #ifdef GL_EXT_separate_specular_color static void _glewInfo_GL_EXT_separate_specular_color (void) @@ -2792,6 +3182,15 @@ static void _glewInfo_GL_EXT_texture_shared_exponent (void) #endif /* GL_EXT_texture_shared_exponent */ +#ifdef GL_EXT_texture_snorm + +static void _glewInfo_GL_EXT_texture_snorm (void) +{ + glewPrintExt("GL_EXT_texture_snorm", GLEW_EXT_texture_snorm, glewIsSupported("GL_EXT_texture_snorm"), glewGetExtension("GL_EXT_texture_snorm")); +} + +#endif /* GL_EXT_texture_snorm */ + #ifdef GL_EXT_texture_swizzle static void _glewInfo_GL_EXT_texture_swizzle (void) @@ -3215,6 +3614,17 @@ static void _glewInfo_GL_NV_copy_depth_to_color (void) #endif /* GL_NV_copy_depth_to_color */ +#ifdef GL_NV_copy_image + +static void _glewInfo_GL_NV_copy_image (void) +{ + glewPrintExt("GL_NV_copy_image", GLEW_NV_copy_image, glewIsSupported("GL_NV_copy_image"), glewGetExtension("GL_NV_copy_image")); + + glewInfoFunc("glCopyImageSubDataNV", glCopyImageSubDataNV == NULL); +} + +#endif /* GL_NV_copy_image */ + #ifdef GL_NV_depth_buffer_float static void _glewInfo_GL_NV_depth_buffer_float (void) @@ -3522,6 +3932,15 @@ static void _glewInfo_GL_NV_parameter_buffer_object (void) #endif /* GL_NV_parameter_buffer_object */ +#ifdef GL_NV_parameter_buffer_object2 + +static void _glewInfo_GL_NV_parameter_buffer_object2 (void) +{ + glewPrintExt("GL_NV_parameter_buffer_object2", GLEW_NV_parameter_buffer_object2, glewIsSupported("GL_NV_parameter_buffer_object2"), glewGetExtension("GL_NV_parameter_buffer_object2")); +} + +#endif /* GL_NV_parameter_buffer_object2 */ + #ifdef GL_NV_pixel_data_range static void _glewInfo_GL_NV_pixel_data_range (void) @@ -3558,7 +3977,6 @@ static void _glewInfo_GL_NV_present_video (void) glewInfoFunc("glGetVideouivNV", glGetVideouivNV == NULL); glewInfoFunc("glPresentFrameDualFillNV", glPresentFrameDualFillNV == NULL); glewInfoFunc("glPresentFrameKeyedNV", glPresentFrameKeyedNV == NULL); - glewInfoFunc("glVideoParameterivNV", glVideoParameterivNV == NULL); } #endif /* GL_NV_present_video */ @@ -3610,6 +4028,30 @@ static void _glewInfo_GL_NV_register_combiners2 (void) #endif /* GL_NV_register_combiners2 */ +#ifdef GL_NV_shader_buffer_load + +static void _glewInfo_GL_NV_shader_buffer_load (void) +{ + glewPrintExt("GL_NV_shader_buffer_load", GLEW_NV_shader_buffer_load, glewIsSupported("GL_NV_shader_buffer_load"), glewGetExtension("GL_NV_shader_buffer_load")); + + glewInfoFunc("glGetBufferParameterui64vNV", glGetBufferParameterui64vNV == NULL); + glewInfoFunc("glGetIntegerui64vNV", glGetIntegerui64vNV == NULL); + glewInfoFunc("glGetNamedBufferParameterui64vNV", glGetNamedBufferParameterui64vNV == NULL); + glewInfoFunc("glGetUniformui64vNV", glGetUniformui64vNV == NULL); + glewInfoFunc("glIsBufferResidentNV", glIsBufferResidentNV == NULL); + glewInfoFunc("glIsNamedBufferResidentNV", glIsNamedBufferResidentNV == NULL); + glewInfoFunc("glMakeBufferNonResidentNV", glMakeBufferNonResidentNV == NULL); + glewInfoFunc("glMakeBufferResidentNV", glMakeBufferResidentNV == NULL); + glewInfoFunc("glMakeNamedBufferNonResidentNV", glMakeNamedBufferNonResidentNV == NULL); + glewInfoFunc("glMakeNamedBufferResidentNV", glMakeNamedBufferResidentNV == NULL); + glewInfoFunc("glProgramUniformui64NV", glProgramUniformui64NV == NULL); + glewInfoFunc("glProgramUniformui64vNV", glProgramUniformui64vNV == NULL); + glewInfoFunc("glUniformui64NV", glUniformui64NV == NULL); + glewInfoFunc("glUniformui64vNV", glUniformui64vNV == NULL); +} + +#endif /* GL_NV_shader_buffer_load */ + #ifdef GL_NV_texgen_emboss static void _glewInfo_GL_NV_texgen_emboss (void) @@ -3628,6 +4070,17 @@ static void _glewInfo_GL_NV_texgen_reflection (void) #endif /* GL_NV_texgen_reflection */ +#ifdef GL_NV_texture_barrier + +static void _glewInfo_GL_NV_texture_barrier (void) +{ + glewPrintExt("GL_NV_texture_barrier", GLEW_NV_texture_barrier, glewIsSupported("GL_NV_texture_barrier"), glewGetExtension("GL_NV_texture_barrier")); + + glewInfoFunc("glTextureBarrierNV", glTextureBarrierNV == NULL); +} + +#endif /* GL_NV_texture_barrier */ + #ifdef GL_NV_texture_compression_vtc static void _glewInfo_GL_NV_texture_compression_vtc (void) @@ -3712,6 +4165,23 @@ static void _glewInfo_GL_NV_transform_feedback (void) #endif /* GL_NV_transform_feedback */ +#ifdef GL_NV_transform_feedback2 + +static void _glewInfo_GL_NV_transform_feedback2 (void) +{ + glewPrintExt("GL_NV_transform_feedback2", GLEW_NV_transform_feedback2, glewIsSupported("GL_NV_transform_feedback2"), glewGetExtension("GL_NV_transform_feedback2")); + + glewInfoFunc("glBindTransformFeedbackNV", glBindTransformFeedbackNV == NULL); + glewInfoFunc("glDeleteTransformFeedbacksNV", glDeleteTransformFeedbacksNV == NULL); + glewInfoFunc("glDrawTransformFeedbackNV", glDrawTransformFeedbackNV == NULL); + glewInfoFunc("glGenTransformFeedbacksNV", glGenTransformFeedbacksNV == NULL); + glewInfoFunc("glIsTransformFeedbackNV", glIsTransformFeedbackNV == NULL); + glewInfoFunc("glPauseTransformFeedbackNV", glPauseTransformFeedbackNV == NULL); + glewInfoFunc("glResumeTransformFeedbackNV", glResumeTransformFeedbackNV == NULL); +} + +#endif /* GL_NV_transform_feedback2 */ + #ifdef GL_NV_vertex_array_range static void _glewInfo_GL_NV_vertex_array_range (void) @@ -3733,6 +4203,28 @@ static void _glewInfo_GL_NV_vertex_array_range2 (void) #endif /* GL_NV_vertex_array_range2 */ +#ifdef GL_NV_vertex_buffer_unified_memory + +static void _glewInfo_GL_NV_vertex_buffer_unified_memory (void) +{ + glewPrintExt("GL_NV_vertex_buffer_unified_memory", GLEW_NV_vertex_buffer_unified_memory, glewIsSupported("GL_NV_vertex_buffer_unified_memory"), glewGetExtension("GL_NV_vertex_buffer_unified_memory")); + + glewInfoFunc("glBufferAddressRangeNV", glBufferAddressRangeNV == NULL); + glewInfoFunc("glColorFormatNV", glColorFormatNV == NULL); + glewInfoFunc("glEdgeFlagFormatNV", glEdgeFlagFormatNV == NULL); + glewInfoFunc("glFogCoordFormatNV", glFogCoordFormatNV == NULL); + glewInfoFunc("glGetIntegerui64i_vNV", glGetIntegerui64i_vNV == NULL); + glewInfoFunc("glIndexFormatNV", glIndexFormatNV == NULL); + glewInfoFunc("glNormalFormatNV", glNormalFormatNV == NULL); + glewInfoFunc("glSecondaryColorFormatNV", glSecondaryColorFormatNV == NULL); + glewInfoFunc("glTexCoordFormatNV", glTexCoordFormatNV == NULL); + glewInfoFunc("glVertexAttribFormatNV", glVertexAttribFormatNV == NULL); + glewInfoFunc("glVertexAttribIFormatNV", glVertexAttribIFormatNV == NULL); + glewInfoFunc("glVertexFormatNV", glVertexFormatNV == NULL); +} + +#endif /* GL_NV_vertex_buffer_unified_memory */ + #ifdef GL_NV_vertex_program static void _glewInfo_GL_NV_vertex_program (void) @@ -4652,6 +5144,25 @@ static void _glewInfo_WGL_3DL_stereo_control (void) #endif /* WGL_3DL_stereo_control */ +#ifdef WGL_AMD_gpu_association + +static void _glewInfo_WGL_AMD_gpu_association (void) +{ + glewPrintExt("WGL_AMD_gpu_association", WGLEW_AMD_gpu_association, wglewIsSupported("WGL_AMD_gpu_association"), wglewGetExtension("WGL_AMD_gpu_association")); + + glewInfoFunc("wglBlitContextFramebufferAMD", wglBlitContextFramebufferAMD == NULL); + glewInfoFunc("wglCreateAssociatedContextAMD", wglCreateAssociatedContextAMD == NULL); + glewInfoFunc("wglCreateAssociatedContextAttribsAMD", wglCreateAssociatedContextAttribsAMD == NULL); + glewInfoFunc("wglDeleteAssociatedContextAMD", wglDeleteAssociatedContextAMD == NULL); + glewInfoFunc("wglGetContextGPUIDAMD", wglGetContextGPUIDAMD == NULL); + glewInfoFunc("wglGetCurrentAssociatedContextAMD", wglGetCurrentAssociatedContextAMD == NULL); + glewInfoFunc("wglGetGPUIDsAMD", wglGetGPUIDsAMD == NULL); + glewInfoFunc("wglGetGPUInfoAMD", wglGetGPUInfoAMD == NULL); + glewInfoFunc("wglMakeAssociatedContextCurrentAMD", wglMakeAssociatedContextCurrentAMD == NULL); +} + +#endif /* WGL_AMD_gpu_association */ + #ifdef WGL_ARB_buffer_region static void _glewInfo_WGL_ARB_buffer_region (void) @@ -4677,6 +5188,15 @@ static void _glewInfo_WGL_ARB_create_context (void) #endif /* WGL_ARB_create_context */ +#ifdef WGL_ARB_create_context_profile + +static void _glewInfo_WGL_ARB_create_context_profile (void) +{ + glewPrintExt("WGL_ARB_create_context_profile", WGLEW_ARB_create_context_profile, wglewIsSupported("WGL_ARB_create_context_profile"), wglewGetExtension("WGL_ARB_create_context_profile")); +} + +#endif /* WGL_ARB_create_context_profile */ + #ifdef WGL_ARB_extensions_string static void _glewInfo_WGL_ARB_extensions_string (void) @@ -4989,6 +5509,17 @@ static void _glewInfo_WGL_I3D_swap_frame_usage (void) #endif /* WGL_I3D_swap_frame_usage */ +#ifdef WGL_NV_copy_image + +static void _glewInfo_WGL_NV_copy_image (void) +{ + glewPrintExt("WGL_NV_copy_image", WGLEW_NV_copy_image, wglewIsSupported("WGL_NV_copy_image"), wglewGetExtension("WGL_NV_copy_image")); + + glewInfoFunc("wglCopyImageSubDataNV", wglCopyImageSubDataNV == NULL); +} + +#endif /* WGL_NV_copy_image */ + #ifdef WGL_NV_float_buffer static void _glewInfo_WGL_NV_float_buffer (void) @@ -5173,6 +5704,15 @@ static void _glewInfo_GLX_ARB_create_context (void) #endif /* GLX_ARB_create_context */ +#ifdef GLX_ARB_create_context_profile + +static void _glewInfo_GLX_ARB_create_context_profile (void) +{ + glewPrintExt("GLX_ARB_create_context_profile", GLXEW_ARB_create_context_profile, glxewIsSupported("GLX_ARB_create_context_profile"), glxewGetExtension("GLX_ARB_create_context_profile")); +} + +#endif /* GLX_ARB_create_context_profile */ + #ifdef GLX_ARB_fbconfig_float static void _glewInfo_GLX_ARB_fbconfig_float (void) @@ -5272,6 +5812,17 @@ static void _glewInfo_GLX_EXT_scene_marker (void) #endif /* GLX_EXT_scene_marker */ +#ifdef GLX_EXT_swap_control + +static void _glewInfo_GLX_EXT_swap_control (void) +{ + glewPrintExt("GLX_EXT_swap_control", GLXEW_EXT_swap_control, glxewIsSupported("GLX_EXT_swap_control"), glxewGetExtension("GLX_EXT_swap_control")); + + glewInfoFunc("glXSwapIntervalEXT", glXSwapIntervalEXT == NULL); +} + +#endif /* GLX_EXT_swap_control */ + #ifdef GLX_EXT_texture_from_pixmap static void _glewInfo_GLX_EXT_texture_from_pixmap (void) @@ -5357,6 +5908,17 @@ static void _glewInfo_GLX_MESA_set_3dfx_mode (void) #endif /* GLX_MESA_set_3dfx_mode */ +#ifdef GLX_NV_copy_image + +static void _glewInfo_GLX_NV_copy_image (void) +{ + glewPrintExt("GLX_NV_copy_image", GLXEW_NV_copy_image, glxewIsSupported("GLX_NV_copy_image"), glxewGetExtension("GLX_NV_copy_image")); + + glewInfoFunc("glXCopyImageSubDataNV", glXCopyImageSubDataNV == NULL); +} + +#endif /* GLX_NV_copy_image */ + #ifdef GLX_NV_float_buffer static void _glewInfo_GLX_NV_float_buffer (void) @@ -5678,6 +6240,12 @@ static void glewInfo (void) #ifdef GL_VERSION_3_0 _glewInfo_GL_VERSION_3_0(); #endif /* GL_VERSION_3_0 */ +#ifdef GL_VERSION_3_1 + _glewInfo_GL_VERSION_3_1(); +#endif /* GL_VERSION_3_1 */ +#ifdef GL_VERSION_3_2 + _glewInfo_GL_VERSION_3_2(); +#endif /* GL_VERSION_3_2 */ #ifdef GL_3DFX_multisample _glewInfo_GL_3DFX_multisample(); #endif /* GL_3DFX_multisample */ @@ -5687,6 +6255,21 @@ static void glewInfo (void) #ifdef GL_3DFX_texture_compression_FXT1 _glewInfo_GL_3DFX_texture_compression_FXT1(); #endif /* GL_3DFX_texture_compression_FXT1 */ +#ifdef GL_AMD_draw_buffers_blend + _glewInfo_GL_AMD_draw_buffers_blend(); +#endif /* GL_AMD_draw_buffers_blend */ +#ifdef GL_AMD_performance_monitor + _glewInfo_GL_AMD_performance_monitor(); +#endif /* GL_AMD_performance_monitor */ +#ifdef GL_AMD_texture_texture4 + _glewInfo_GL_AMD_texture_texture4(); +#endif /* GL_AMD_texture_texture4 */ +#ifdef GL_AMD_vertex_shader_tessellator + _glewInfo_GL_AMD_vertex_shader_tessellator(); +#endif /* GL_AMD_vertex_shader_tessellator */ +#ifdef GL_APPLE_aux_depth_stencil + _glewInfo_GL_APPLE_aux_depth_stencil(); +#endif /* GL_APPLE_aux_depth_stencil */ #ifdef GL_APPLE_client_storage _glewInfo_GL_APPLE_client_storage(); #endif /* GL_APPLE_client_storage */ @@ -5702,9 +6285,18 @@ static void glewInfo (void) #ifdef GL_APPLE_flush_buffer_range _glewInfo_GL_APPLE_flush_buffer_range(); #endif /* GL_APPLE_flush_buffer_range */ +#ifdef GL_APPLE_object_purgeable + _glewInfo_GL_APPLE_object_purgeable(); +#endif /* GL_APPLE_object_purgeable */ #ifdef GL_APPLE_pixel_buffer _glewInfo_GL_APPLE_pixel_buffer(); #endif /* GL_APPLE_pixel_buffer */ +#ifdef GL_APPLE_rgb_422 + _glewInfo_GL_APPLE_rgb_422(); +#endif /* GL_APPLE_rgb_422 */ +#ifdef GL_APPLE_row_bytes + _glewInfo_GL_APPLE_row_bytes(); +#endif /* GL_APPLE_row_bytes */ #ifdef GL_APPLE_specular_vector _glewInfo_GL_APPLE_specular_vector(); #endif /* GL_APPLE_specular_vector */ @@ -5720,24 +6312,45 @@ static void glewInfo (void) #ifdef GL_APPLE_vertex_array_range _glewInfo_GL_APPLE_vertex_array_range(); #endif /* GL_APPLE_vertex_array_range */ +#ifdef GL_APPLE_vertex_program_evaluators + _glewInfo_GL_APPLE_vertex_program_evaluators(); +#endif /* GL_APPLE_vertex_program_evaluators */ #ifdef GL_APPLE_ycbcr_422 _glewInfo_GL_APPLE_ycbcr_422(); #endif /* GL_APPLE_ycbcr_422 */ #ifdef GL_ARB_color_buffer_float _glewInfo_GL_ARB_color_buffer_float(); #endif /* GL_ARB_color_buffer_float */ +#ifdef GL_ARB_compatibility + _glewInfo_GL_ARB_compatibility(); +#endif /* GL_ARB_compatibility */ +#ifdef GL_ARB_copy_buffer + _glewInfo_GL_ARB_copy_buffer(); +#endif /* GL_ARB_copy_buffer */ #ifdef GL_ARB_depth_buffer_float _glewInfo_GL_ARB_depth_buffer_float(); #endif /* GL_ARB_depth_buffer_float */ +#ifdef GL_ARB_depth_clamp + _glewInfo_GL_ARB_depth_clamp(); +#endif /* GL_ARB_depth_clamp */ #ifdef GL_ARB_depth_texture _glewInfo_GL_ARB_depth_texture(); #endif /* GL_ARB_depth_texture */ #ifdef GL_ARB_draw_buffers _glewInfo_GL_ARB_draw_buffers(); #endif /* GL_ARB_draw_buffers */ +#ifdef GL_ARB_draw_buffers_blend + _glewInfo_GL_ARB_draw_buffers_blend(); +#endif /* GL_ARB_draw_buffers_blend */ +#ifdef GL_ARB_draw_elements_base_vertex + _glewInfo_GL_ARB_draw_elements_base_vertex(); +#endif /* GL_ARB_draw_elements_base_vertex */ #ifdef GL_ARB_draw_instanced _glewInfo_GL_ARB_draw_instanced(); #endif /* GL_ARB_draw_instanced */ +#ifdef GL_ARB_fragment_coord_conventions + _glewInfo_GL_ARB_fragment_coord_conventions(); +#endif /* GL_ARB_fragment_coord_conventions */ #ifdef GL_ARB_fragment_program _glewInfo_GL_ARB_fragment_program(); #endif /* GL_ARB_fragment_program */ @@ -5792,9 +6405,21 @@ static void glewInfo (void) #ifdef GL_ARB_point_sprite _glewInfo_GL_ARB_point_sprite(); #endif /* GL_ARB_point_sprite */ +#ifdef GL_ARB_provoking_vertex + _glewInfo_GL_ARB_provoking_vertex(); +#endif /* GL_ARB_provoking_vertex */ +#ifdef GL_ARB_sample_shading + _glewInfo_GL_ARB_sample_shading(); +#endif /* GL_ARB_sample_shading */ +#ifdef GL_ARB_seamless_cube_map + _glewInfo_GL_ARB_seamless_cube_map(); +#endif /* GL_ARB_seamless_cube_map */ #ifdef GL_ARB_shader_objects _glewInfo_GL_ARB_shader_objects(); #endif /* GL_ARB_shader_objects */ +#ifdef GL_ARB_shader_texture_lod + _glewInfo_GL_ARB_shader_texture_lod(); +#endif /* GL_ARB_shader_texture_lod */ #ifdef GL_ARB_shading_language_100 _glewInfo_GL_ARB_shading_language_100(); #endif /* GL_ARB_shading_language_100 */ @@ -5804,6 +6429,9 @@ static void glewInfo (void) #ifdef GL_ARB_shadow_ambient _glewInfo_GL_ARB_shadow_ambient(); #endif /* GL_ARB_shadow_ambient */ +#ifdef GL_ARB_sync + _glewInfo_GL_ARB_sync(); +#endif /* GL_ARB_sync */ #ifdef GL_ARB_texture_border_clamp _glewInfo_GL_ARB_texture_border_clamp(); #endif /* GL_ARB_texture_border_clamp */ @@ -5819,6 +6447,9 @@ static void glewInfo (void) #ifdef GL_ARB_texture_cube_map _glewInfo_GL_ARB_texture_cube_map(); #endif /* GL_ARB_texture_cube_map */ +#ifdef GL_ARB_texture_cube_map_array + _glewInfo_GL_ARB_texture_cube_map_array(); +#endif /* GL_ARB_texture_cube_map_array */ #ifdef GL_ARB_texture_env_add _glewInfo_GL_ARB_texture_env_add(); #endif /* GL_ARB_texture_env_add */ @@ -5834,12 +6465,21 @@ static void glewInfo (void) #ifdef GL_ARB_texture_float _glewInfo_GL_ARB_texture_float(); #endif /* GL_ARB_texture_float */ +#ifdef GL_ARB_texture_gather + _glewInfo_GL_ARB_texture_gather(); +#endif /* GL_ARB_texture_gather */ #ifdef GL_ARB_texture_mirrored_repeat _glewInfo_GL_ARB_texture_mirrored_repeat(); #endif /* GL_ARB_texture_mirrored_repeat */ +#ifdef GL_ARB_texture_multisample + _glewInfo_GL_ARB_texture_multisample(); +#endif /* GL_ARB_texture_multisample */ #ifdef GL_ARB_texture_non_power_of_two _glewInfo_GL_ARB_texture_non_power_of_two(); #endif /* GL_ARB_texture_non_power_of_two */ +#ifdef GL_ARB_texture_query_lod + _glewInfo_GL_ARB_texture_query_lod(); +#endif /* GL_ARB_texture_query_lod */ #ifdef GL_ARB_texture_rectangle _glewInfo_GL_ARB_texture_rectangle(); #endif /* GL_ARB_texture_rectangle */ @@ -5849,6 +6489,12 @@ static void glewInfo (void) #ifdef GL_ARB_transpose_matrix _glewInfo_GL_ARB_transpose_matrix(); #endif /* GL_ARB_transpose_matrix */ +#ifdef GL_ARB_uniform_buffer_object + _glewInfo_GL_ARB_uniform_buffer_object(); +#endif /* GL_ARB_uniform_buffer_object */ +#ifdef GL_ARB_vertex_array_bgra + _glewInfo_GL_ARB_vertex_array_bgra(); +#endif /* GL_ARB_vertex_array_bgra */ #ifdef GL_ARB_vertex_array_object _glewInfo_GL_ARB_vertex_array_object(); #endif /* GL_ARB_vertex_array_object */ @@ -5894,6 +6540,9 @@ static void glewInfo (void) #ifdef GL_ATI_map_object_buffer _glewInfo_GL_ATI_map_object_buffer(); #endif /* GL_ATI_map_object_buffer */ +#ifdef GL_ATI_meminfo + _glewInfo_GL_ATI_meminfo(); +#endif /* GL_ATI_meminfo */ #ifdef GL_ATI_pn_triangles _glewInfo_GL_ATI_pn_triangles(); #endif /* GL_ATI_pn_triangles */ @@ -6080,6 +6729,9 @@ static void glewInfo (void) #ifdef GL_EXT_polygon_offset _glewInfo_GL_EXT_polygon_offset(); #endif /* GL_EXT_polygon_offset */ +#ifdef GL_EXT_provoking_vertex + _glewInfo_GL_EXT_provoking_vertex(); +#endif /* GL_EXT_provoking_vertex */ #ifdef GL_EXT_rescale_normal _glewInfo_GL_EXT_rescale_normal(); #endif /* GL_EXT_rescale_normal */ @@ -6089,6 +6741,9 @@ static void glewInfo (void) #ifdef GL_EXT_secondary_color _glewInfo_GL_EXT_secondary_color(); #endif /* GL_EXT_secondary_color */ +#ifdef GL_EXT_separate_shader_objects + _glewInfo_GL_EXT_separate_shader_objects(); +#endif /* GL_EXT_separate_shader_objects */ #ifdef GL_EXT_separate_specular_color _glewInfo_GL_EXT_separate_specular_color(); #endif /* GL_EXT_separate_specular_color */ @@ -6179,6 +6834,9 @@ static void glewInfo (void) #ifdef GL_EXT_texture_shared_exponent _glewInfo_GL_EXT_texture_shared_exponent(); #endif /* GL_EXT_texture_shared_exponent */ +#ifdef GL_EXT_texture_snorm + _glewInfo_GL_EXT_texture_snorm(); +#endif /* GL_EXT_texture_snorm */ #ifdef GL_EXT_texture_swizzle _glewInfo_GL_EXT_texture_swizzle(); #endif /* GL_EXT_texture_swizzle */ @@ -6275,6 +6933,9 @@ static void glewInfo (void) #ifdef GL_NV_copy_depth_to_color _glewInfo_GL_NV_copy_depth_to_color(); #endif /* GL_NV_copy_depth_to_color */ +#ifdef GL_NV_copy_image + _glewInfo_GL_NV_copy_image(); +#endif /* GL_NV_copy_image */ #ifdef GL_NV_depth_buffer_float _glewInfo_GL_NV_depth_buffer_float(); #endif /* GL_NV_depth_buffer_float */ @@ -6341,6 +7002,9 @@ static void glewInfo (void) #ifdef GL_NV_parameter_buffer_object _glewInfo_GL_NV_parameter_buffer_object(); #endif /* GL_NV_parameter_buffer_object */ +#ifdef GL_NV_parameter_buffer_object2 + _glewInfo_GL_NV_parameter_buffer_object2(); +#endif /* GL_NV_parameter_buffer_object2 */ #ifdef GL_NV_pixel_data_range _glewInfo_GL_NV_pixel_data_range(); #endif /* GL_NV_pixel_data_range */ @@ -6359,12 +7023,18 @@ static void glewInfo (void) #ifdef GL_NV_register_combiners2 _glewInfo_GL_NV_register_combiners2(); #endif /* GL_NV_register_combiners2 */ +#ifdef GL_NV_shader_buffer_load + _glewInfo_GL_NV_shader_buffer_load(); +#endif /* GL_NV_shader_buffer_load */ #ifdef GL_NV_texgen_emboss _glewInfo_GL_NV_texgen_emboss(); #endif /* GL_NV_texgen_emboss */ #ifdef GL_NV_texgen_reflection _glewInfo_GL_NV_texgen_reflection(); #endif /* GL_NV_texgen_reflection */ +#ifdef GL_NV_texture_barrier + _glewInfo_GL_NV_texture_barrier(); +#endif /* GL_NV_texture_barrier */ #ifdef GL_NV_texture_compression_vtc _glewInfo_GL_NV_texture_compression_vtc(); #endif /* GL_NV_texture_compression_vtc */ @@ -6389,12 +7059,18 @@ static void glewInfo (void) #ifdef GL_NV_transform_feedback _glewInfo_GL_NV_transform_feedback(); #endif /* GL_NV_transform_feedback */ +#ifdef GL_NV_transform_feedback2 + _glewInfo_GL_NV_transform_feedback2(); +#endif /* GL_NV_transform_feedback2 */ #ifdef GL_NV_vertex_array_range _glewInfo_GL_NV_vertex_array_range(); #endif /* GL_NV_vertex_array_range */ #ifdef GL_NV_vertex_array_range2 _glewInfo_GL_NV_vertex_array_range2(); #endif /* GL_NV_vertex_array_range2 */ +#ifdef GL_NV_vertex_buffer_unified_memory + _glewInfo_GL_NV_vertex_buffer_unified_memory(); +#endif /* GL_NV_vertex_buffer_unified_memory */ #ifdef GL_NV_vertex_program _glewInfo_GL_NV_vertex_program(); #endif /* GL_NV_vertex_program */ @@ -6640,12 +7316,18 @@ static void wglewInfo () #ifdef WGL_3DL_stereo_control _glewInfo_WGL_3DL_stereo_control(); #endif /* WGL_3DL_stereo_control */ +#ifdef WGL_AMD_gpu_association + _glewInfo_WGL_AMD_gpu_association(); +#endif /* WGL_AMD_gpu_association */ #ifdef WGL_ARB_buffer_region _glewInfo_WGL_ARB_buffer_region(); #endif /* WGL_ARB_buffer_region */ #ifdef WGL_ARB_create_context _glewInfo_WGL_ARB_create_context(); #endif /* WGL_ARB_create_context */ +#ifdef WGL_ARB_create_context_profile + _glewInfo_WGL_ARB_create_context_profile(); +#endif /* WGL_ARB_create_context_profile */ #ifdef WGL_ARB_extensions_string _glewInfo_WGL_ARB_extensions_string(); #endif /* WGL_ARB_extensions_string */ @@ -6724,6 +7406,9 @@ static void wglewInfo () #ifdef WGL_I3D_swap_frame_usage _glewInfo_WGL_I3D_swap_frame_usage(); #endif /* WGL_I3D_swap_frame_usage */ +#ifdef WGL_NV_copy_image + _glewInfo_WGL_NV_copy_image(); +#endif /* WGL_NV_copy_image */ #ifdef WGL_NV_float_buffer _glewInfo_WGL_NV_float_buffer(); #endif /* WGL_NV_float_buffer */ @@ -6772,6 +7457,9 @@ static void glxewInfo () #ifdef GLX_ARB_create_context _glewInfo_GLX_ARB_create_context(); #endif /* GLX_ARB_create_context */ +#ifdef GLX_ARB_create_context_profile + _glewInfo_GLX_ARB_create_context_profile(); +#endif /* GLX_ARB_create_context_profile */ #ifdef GLX_ARB_fbconfig_float _glewInfo_GLX_ARB_fbconfig_float(); #endif /* GLX_ARB_fbconfig_float */ @@ -6802,6 +7490,9 @@ static void glxewInfo () #ifdef GLX_EXT_scene_marker _glewInfo_GLX_EXT_scene_marker(); #endif /* GLX_EXT_scene_marker */ +#ifdef GLX_EXT_swap_control + _glewInfo_GLX_EXT_swap_control(); +#endif /* GLX_EXT_swap_control */ #ifdef GLX_EXT_texture_from_pixmap _glewInfo_GLX_EXT_texture_from_pixmap(); #endif /* GLX_EXT_texture_from_pixmap */ @@ -6826,6 +7517,9 @@ static void glxewInfo () #ifdef GLX_MESA_set_3dfx_mode _glewInfo_GLX_MESA_set_3dfx_mode(); #endif /* GLX_MESA_set_3dfx_mode */ +#ifdef GLX_NV_copy_image + _glewInfo_GLX_NV_copy_image(); +#endif /* GLX_NV_copy_image */ #ifdef GLX_NV_float_buffer _glewInfo_GLX_NV_float_buffer(); #endif /* GLX_NV_float_buffer */ @@ -7071,7 +7765,7 @@ GLboolean glewCreateContext (int* pixelformat) void glewDestroyContext () { if (NULL != rc) wglMakeCurrent(NULL, NULL); - if (NULL != rc) wglDeleteContext(wglGetCurrentContext()); + if (NULL != rc) wglDeleteContext(rc); if (NULL != wnd && NULL != dc) ReleaseDC(wnd, dc); if (NULL != wnd) DestroyWindow(wnd); UnregisterClass("GLEW", GetModuleHandle(NULL)); @@ -7100,7 +7794,7 @@ GLboolean glewCreateContext () aglDestroyPixelFormat(pf); /*aglSetDrawable(ctx, GetWindowPort(wnd));*/ octx = aglGetCurrentContext(); - if (NULL == aglSetCurrentContext(ctx)) return GL_TRUE; + if (GL_FALSE == aglSetCurrentContext(ctx)) return GL_TRUE; return GL_FALSE; } diff --git a/src/glew/visualinfo.c b/src/glew/visualinfo.c index 384313df22..f3ae91f2b4 100644 --- a/src/glew/visualinfo.c +++ b/src/glew/visualinfo.c @@ -1056,7 +1056,7 @@ GLboolean CreateContext (GLContext* ctx) aglDestroyPixelFormat(pf); /*aglSetDrawable(ctx, GetWindowPort(wnd));*/ ctx->octx = aglGetCurrentContext(); - if (NULL == aglSetCurrentContext(ctx->ctx)) return GL_TRUE; + if (GL_FALSE == aglSetCurrentContext(ctx->ctx)) return GL_TRUE; return GL_FALSE; } diff --git a/src/glu/sgi/libnurbs/internals/displaylist.h b/src/glu/sgi/libnurbs/internals/displaylist.h index 22cbec3787..d009a42513 100644 --- a/src/glu/sgi/libnurbs/internals/displaylist.h +++ b/src/glu/sgi/libnurbs/internals/displaylist.h @@ -59,6 +59,7 @@ Dlnode::Dlnode( PFVS _work, void *_arg, PFVS _cleanup ) work = _work; arg = _arg; cleanup = _cleanup; + next = 0; } class DisplayList { diff --git a/src/glu/sgi/libnurbs/internals/knotvector.cc b/src/glu/sgi/libnurbs/internals/knotvector.cc index 9eb5cbace9..dcbf0067d8 100644 --- a/src/glu/sgi/libnurbs/internals/knotvector.cc +++ b/src/glu/sgi/libnurbs/internals/knotvector.cc @@ -61,6 +61,9 @@ void Knotvector::init( long _knotcount, long _stride, long _order, INREAL *_knot Knotvector::Knotvector( void ) { + knotcount = 0; + stride = 0; + order = 0; knotlist = 0; } diff --git a/src/glu/sgi/libnurbs/internals/reader.h b/src/glu/sgi/libnurbs/internals/reader.h index 3f259c777b..cae6cada46 100644 --- a/src/glu/sgi/libnurbs/internals/reader.h +++ b/src/glu/sgi/libnurbs/internals/reader.h @@ -64,7 +64,7 @@ struct O_curve : public PooledObj { int save; /* 1 if in display list */ long nuid; O_curve() { next = 0; used = 0; owner = 0; - curve.o_pwlcurve = 0; } + curve.o_pwlcurve = 0; curvetype = ct_none; save = 0; nuid = 0; } }; struct O_nurbscurve : public PooledObj { @@ -77,7 +77,7 @@ struct O_nurbscurve : public PooledObj { int save; /* 1 if in display list */ O_curve * owner; /* owning curve */ O_nurbscurve( long _type ) - { type = _type; owner = 0; next = 0; used = 0; } + { bezier_curves = 0; type = _type; tesselation = 0; method = 0; next = 0; used = 0; save = 0; owner = 0; } }; class O_pwlcurve : public PooledObj { @@ -95,7 +95,7 @@ struct O_trim : public PooledObj { O_curve *o_curve; /* closed trim loop */ O_trim * next; /* next loop along trim */ int save; /* 1 if in display list */ - O_trim() { next = 0; o_curve = 0; } + O_trim() { next = 0; o_curve = 0; save = 0; } }; struct O_nurbssurface : public PooledObj { @@ -114,7 +114,7 @@ struct O_surface : public PooledObj { O_trim * o_trim; /* list of trim loops */ int save; /* 1 if in display list */ long nuid; - O_surface() { o_trim = 0; o_nurbssurface = 0; } + O_surface() { o_trim = 0; o_nurbssurface = 0; save = 0; nuid = 0; } }; struct Property : public PooledObj { @@ -123,9 +123,9 @@ struct Property : public PooledObj { REAL value; int save; /* 1 if in display list */ Property( long _type, long _tag, INREAL _value ) - { type = _type; tag = _tag; value = (REAL) _value; } + { type = _type; tag = _tag; value = (REAL) _value; save = 0; } Property( long _tag, INREAL _value ) - { type = 0; tag = _tag; value = (REAL) _value; } + { type = 0; tag = _tag; value = (REAL) _value; save = 0; } }; class NurbsTessellator; diff --git a/src/glut/glx/win32_menu.c b/src/glut/glx/win32_menu.c index 5ce264dcdb..d8e336ceed 100644 --- a/src/glut/glx/win32_menu.c +++ b/src/glut/glx/win32_menu.c @@ -97,7 +97,7 @@ static void mapMenu(GLUTmenu * menu, int x, int y) { TrackPopupMenu((HMENU) menu->win, TPM_LEFTALIGN | - (__glutMenuButton == TPM_RIGHTBUTTON) ? TPM_RIGHTBUTTON : TPM_LEFTBUTTON, + ((__glutMenuButton == TPM_RIGHTBUTTON) ? TPM_RIGHTBUTTON : TPM_LEFTBUTTON), x, y, 0, __glutCurrentWindow->win, NULL); } diff --git a/src/glx/mini/miniglx.c b/src/glx/mini/miniglx.c index 874b88bc49..e9a10b4ac7 100644 --- a/src/glx/mini/miniglx.c +++ b/src/glx/mini/miniglx.c @@ -2278,14 +2278,14 @@ __glXCreateContextWithConfig(__DRInativeDisplay *dpy, int screen, int fbconfigID, void *contextID, drm_context_t *hHWContext) { __DRIscreen *pDRIScreen; - __DRIscreenPrivate *psp; + __DRIscreen *psp; pDRIScreen = __glXFindDRIScreen(dpy, screen); if ( (pDRIScreen == NULL) || (pDRIScreen->private == NULL) ) { return GL_FALSE; } - psp = (__DRIscreenPrivate *) pDRIScreen->private; + psp = (__DRIscreen *) pDRIScreen->private; if (psp->fd) { if (drmCreateContext(psp->fd, hHWContext)) { @@ -2310,9 +2310,9 @@ __glXGetDrawableInfo(__DRInativeDisplay *dpy, int scrn, GLXDrawable drawable = (GLXDrawable) draw; drm_clip_rect_t * cliprect; Display* display = (Display*)dpy; - __DRIscreenPrivate *psp = display->driScreen.private; - __DRIcontextPrivate *pcp = (__DRIcontextPrivate *)CurrentContext->driContext.private; - __DRIdrawablePrivate *pdp = pcp->driDrawablePriv; + __DRIscreen *psp = display->driScreen.private; + __DRIcontext *pcp = (__DRIcontext *)CurrentContext->driContext.private; + __DRIdrawable *pdp = pcp->driDrawablePriv; if (drawable == 0) { return GL_FALSE; } @@ -2357,7 +2357,7 @@ xf86DRI_CreateDrawable(__DRInativeDisplay *dpy, int screen, __DRIid drawable, { Display *display = (Display *)dpy; - __DRIscreenPrivate *psp = display->driScreen.private; + __DRIscreen *psp = display->driScreen.private; int ret; ret = drmCreateDrawable(psp->fd, hHWDrawable); diff --git a/src/glx/x11/dri_glx.c b/src/glx/x11/dri_glx.c index 42cb25304e..e658644eca 100644 --- a/src/glx/x11/dri_glx.c +++ b/src/glx/x11/dri_glx.c @@ -280,8 +280,6 @@ static const __DRIextension *loader_extensions[] = { NULL }; -#ifndef GLX_USE_APPLEGL - /** * Perform the required libGL-side initialization and call the client-side * driver's \c __driCreateNewScreen function. @@ -292,7 +290,7 @@ static const __DRIextension *loader_extensions[] = { * \param driDpy DRI display information. * \param createNewScreen Pointer to the client-side driver's * \c __driCreateNewScreen function. - * \returns A pointer to the \c __DRIscreenPrivate structure returned by + * \returns A pointer to the \c __DRIscreen structure returned by * the client-side driver on success, or \c NULL on failure. */ static void * @@ -475,17 +473,6 @@ CallCreateNewScreen(Display * dpy, int scrn, __GLXscreenConfigs * psc, return NULL; } -#else /* !GLX_USE_APPLEGL */ - -static void * -CallCreateNewScreen(Display * dpy, int scrn, __GLXscreenConfigs * psc, - __GLXDRIdisplayPrivate * driDpy) -{ - return NULL; -} - -#endif /* !GLX_USE_APPLEGL */ - static void driDestroyContext(__GLXDRIcontext * context, __GLXscreenConfigs * psc, Display * dpy) diff --git a/src/glx/x11/glxcmds.c b/src/glx/x11/glxcmds.c index fefdd99f55..c3be974ea9 100644 --- a/src/glx/x11/glxcmds.c +++ b/src/glx/x11/glxcmds.c @@ -2619,7 +2619,7 @@ glXAllocateMemoryMESA(Display * dpy, int scrn, (void) readFreq; (void) writeFreq; (void) priority; -#endif /* GLX_DIRECT_RENDERING */ +#endif /* __DRI_ALLOCATE */ return NULL; } @@ -2638,7 +2638,7 @@ glXFreeMemoryMESA(Display * dpy, int scrn, void *pointer) (void) dpy; (void) scrn; (void) pointer; -#endif /* GLX_DIRECT_RENDERING */ +#endif /* __DRI_ALLOCATE */ } diff --git a/src/glx/x11/glxcurrent.c b/src/glx/x11/glxcurrent.c index f1e3e161be..fae1bd9fa6 100644 --- a/src/glx/x11/glxcurrent.c +++ b/src/glx/x11/glxcurrent.c @@ -475,13 +475,6 @@ MakeContextCurrent(Display * dpy, GLXDrawable draw, IndirectAPI = __glXNewIndirectAPI(); _glapi_set_dispatch(IndirectAPI); -#ifdef GLX_USE_APPLEGL - do { - extern void XAppleDRIUseIndirectDispatch(void); - XAppleDRIUseIndirectDispatch(); - } while (0); -#endif - state = (__GLXattribute *) (gc->client_state_private); gc->currentContextTag = reply.contextTag; diff --git a/src/mesa/Makefile b/src/mesa/Makefile index a815f46b4a..f845d93fbd 100644 --- a/src/mesa/Makefile +++ b/src/mesa/Makefile @@ -42,7 +42,7 @@ libglapi.a: $(GLAPI_OBJECTS) ###################################################################### # Device drivers -driver_subdirs: libmesa.a libglapi.a +driver_subdirs: libmesa.a libglapi.a libmesagallium.a @ (cd drivers && $(MAKE)) diff --git a/src/mesa/SConscript b/src/mesa/SConscript index 7035bdc634..bdcfffed4b 100644 --- a/src/mesa/SConscript +++ b/src/mesa/SConscript @@ -104,6 +104,7 @@ if env['platform'] != 'winddk': 'main/texstate.c', 'main/texstore.c', 'main/varray.c', + 'main/version.c', 'main/viewport.c', 'main/vtxfmt.c', ] @@ -162,6 +163,7 @@ if env['platform'] != 'winddk': 'state_tracker/st_cb_blit.c', 'state_tracker/st_cb_bufferobjects.c', 'state_tracker/st_cb_clear.c', + 'state_tracker/st_cb_condrender.c', 'state_tracker/st_cb_flush.c', 'state_tracker/st_cb_drawpixels.c', 'state_tracker/st_cb_fbo.c', diff --git a/src/mesa/drivers/common/meta.c b/src/mesa/drivers/common/meta.c index c4dbfa6d7d..e500359bb7 100644 --- a/src/mesa/drivers/common/meta.c +++ b/src/mesa/drivers/common/meta.c @@ -510,9 +510,9 @@ _mesa_meta_begin(GLcontext *ctx, GLbitfield state) _mesa_LoadIdentity(); _mesa_MatrixMode(GL_PROJECTION); _mesa_LoadIdentity(); - _mesa_Ortho(0.0F, ctx->DrawBuffer->Width, - 0.0F, ctx->DrawBuffer->Height, - -1.0F, 1.0F); + _mesa_Ortho(0.0, ctx->DrawBuffer->Width, + 0.0, ctx->DrawBuffer->Height, + -1.0, 1.0); save->ClipPlanesEnabled = ctx->Transform.ClipPlanesEnabled; if (ctx->Transform.ClipPlanesEnabled) { GLuint i; @@ -2321,6 +2321,26 @@ _mesa_meta_GenerateMipmap(GLcontext *ctx, GLenum target, _mesa_set_enable(ctx, target, GL_TRUE); + /* setup vertex positions */ + { + verts[0].x = 0.0F; + verts[0].y = 0.0F; + verts[1].x = 1.0F; + verts[1].y = 0.0F; + verts[2].x = 1.0F; + verts[2].y = 1.0F; + verts[3].x = 0.0F; + verts[3].y = 1.0F; + + /* upload new vertex data */ + _mesa_BufferSubDataARB(GL_ARRAY_BUFFER_ARB, 0, sizeof(verts), verts); + } + + /* setup projection matrix */ + _mesa_MatrixMode(GL_PROJECTION); + _mesa_LoadIdentity(); + _mesa_Ortho(0.0, 1.0, 0.0, 1.0, -1.0, 1.0); + /* texture is already locked, unlock now */ _mesa_unlock_texture(ctx, texObj); @@ -2387,21 +2407,6 @@ _mesa_meta_GenerateMipmap(GLcontext *ctx, GLenum target, } } - /* setup vertex positions */ - { - verts[0].x = 0.0F; - verts[0].y = 0.0F; - verts[1].x = (GLfloat) dstWidth; - verts[1].y = 0.0F; - verts[2].x = (GLfloat) dstWidth; - verts[2].y = (GLfloat) dstHeight; - verts[3].x = 0.0F; - verts[3].y = (GLfloat) dstHeight; - - /* upload new vertex data */ - _mesa_BufferSubDataARB(GL_ARRAY_BUFFER_ARB, 0, sizeof(verts), verts); - } - /* limit sampling to src level */ _mesa_TexParameteri(target, GL_TEXTURE_BASE_LEVEL, srcLevel); _mesa_TexParameteri(target, GL_TEXTURE_MAX_LEVEL, srcLevel); @@ -2440,6 +2445,12 @@ _mesa_meta_GenerateMipmap(GLcontext *ctx, GLenum target, break; } + assert(dstWidth == ctx->DrawBuffer->Width); + assert(dstHeight == ctx->DrawBuffer->Height); + + /* setup viewport */ + _mesa_set_viewport(ctx, 0, 0, dstWidth, dstHeight); + _mesa_DrawArrays(GL_TRIANGLE_FAN, 0, 4); } diff --git a/src/mesa/drivers/dri/common/dri_util.c b/src/mesa/drivers/dri/common/dri_util.c index cd271ede09..3649c29666 100644 --- a/src/mesa/drivers/dri/common/dri_util.c +++ b/src/mesa/drivers/dri/common/dri_util.c @@ -97,7 +97,7 @@ driIntersectArea( drm_clip_rect_t rect1, drm_clip_rect_t rect2 ) * * \internal * This function calls __DriverAPIRec::UnbindContext, and then decrements - * __DRIdrawablePrivateRec::refcount which must be non-zero for a successful + * __DRIdrawableRec::refcount which must be non-zero for a successful * return. * * While casting the opaque private pointers associated with the parameters @@ -167,7 +167,7 @@ static int driBindContext(__DRIcontext *pcp, __DRIdrawable *pdp, __DRIdrawable *prp) { - __DRIscreenPrivate *psp = NULL; + __DRIscreen *psp = NULL; /* Bind the drawable to the context */ @@ -220,7 +220,7 @@ static int driBindContext(__DRIcontext *pcp, * * \param pdp pointer to the private drawable information to update. * - * This function basically updates the __DRIdrawablePrivate struct's + * This function basically updates the __DRIdrawable struct's * cliprect information by calling \c __DRIinterfaceMethods::getDrawableInfo. * This is usually called by the DRI_VALIDATE_DRAWABLE_INFO macro which * compares the __DRIdrwablePrivate pStamp and lastStamp values. If @@ -228,10 +228,10 @@ static int driBindContext(__DRIcontext *pcp, * info. */ void -__driUtilUpdateDrawableInfo(__DRIdrawablePrivate *pdp) +__driUtilUpdateDrawableInfo(__DRIdrawable *pdp) { - __DRIscreenPrivate *psp = pdp->driScreenPriv; - __DRIcontextPrivate *pcp = pdp->driContextPriv; + __DRIscreen *psp = pdp->driScreenPriv; + __DRIcontext *pcp = pdp->driContextPriv; if (!pcp || ((pdp != pcp->driDrawablePriv) && (pdp != pcp->driReadablePriv))) { @@ -309,7 +309,7 @@ static void driReportDamage(__DRIdrawable *pdp, * \param drawablePrivate opaque pointer to the per-drawable private info. * * \internal - * This function calls __DRIdrawablePrivate::swapBuffers. + * This function calls __DRIdrawable::swapBuffers. * * Is called directly from glXSwapBuffers(). */ @@ -498,7 +498,7 @@ static void dri_get_drawable(__DRIdrawable *pdp) static void dri_put_drawable(__DRIdrawable *pdp) { - __DRIscreenPrivate *psp; + __DRIscreen *psp; if (pdp) { pdp->refcount--; @@ -561,7 +561,7 @@ driDestroyContext(__DRIcontext *pcp) * success, or \c NULL on failure. * * \internal - * This function allocates and fills a __DRIcontextPrivateRec structure. It + * This function allocates and fills a __DRIcontextRec structure. It * performs some device independent initialization and passes all the * relevent information to __DriverAPIRec::CreateContext to create the * context. @@ -842,7 +842,7 @@ const __DRIlegacyExtension driLegacyExtension = { driCreateNewContext, }; -/** Legacy DRI interface */ +/** DRI2 interface */ const __DRIdri2Extension driDRI2Extension = { { __DRI_DRI2, __DRI_DRI2_VERSION }, dri2CreateNewScreen, @@ -850,14 +850,6 @@ const __DRIdri2Extension driDRI2Extension = { dri2CreateNewContext, }; -/* This is the table of extensions that the loader will dlsym() for. */ -PUBLIC const __DRIextension *__driDriverExtensions[] = { - &driCoreExtension.base, - &driLegacyExtension.base, - &driDRI2Extension.base, - NULL -}; - static int driFrameTracking(__DRIdrawable *drawable, GLboolean enable) { @@ -872,7 +864,7 @@ driQueryFrameTracking(__DRIdrawable *dpriv, __DRIswapInfo sInfo; int status; int64_t ust; - __DRIscreenPrivate *psp = dpriv->driScreenPriv; + __DRIscreen *psp = dpriv->driScreenPriv; status = dpriv->driScreenPriv->DriverAPI.GetSwapInfo( dpriv, & sInfo ); if ( status == 0 ) { @@ -922,14 +914,14 @@ const __DRIframeTrackingExtension driFrameTrackingExtension = { * be possible to cache the sync rate? */ float -driCalculateSwapUsage( __DRIdrawablePrivate *dPriv, int64_t last_swap_ust, +driCalculateSwapUsage( __DRIdrawable *dPriv, int64_t last_swap_ust, int64_t current_ust ) { int32_t n; int32_t d; int interval; float usage = 1.0; - __DRIscreenPrivate *psp = dPriv->driScreenPriv; + __DRIscreen *psp = dPriv->driScreenPriv; if ( (*psp->systemTime->getMSCRate)(dPriv, &n, &d, dPriv->loaderPrivate) ) { interval = (dPriv->swap_interval != 0) ? dPriv->swap_interval : 1; diff --git a/src/mesa/drivers/dri/common/dri_util.h b/src/mesa/drivers/dri/common/dri_util.h index c3046d6b18..95df702f1a 100644 --- a/src/mesa/drivers/dri/common/dri_util.h +++ b/src/mesa/drivers/dri/common/dri_util.h @@ -59,16 +59,12 @@ typedef struct __DRIswapInfoRec __DRIswapInfo; -/* Typedefs to avoid rewriting the world. */ -typedef struct __DRIscreenRec __DRIscreenPrivate; -typedef struct __DRIdrawableRec __DRIdrawablePrivate; -typedef struct __DRIcontextRec __DRIcontextPrivate; - /** * Extensions. */ extern const __DRIlegacyExtension driLegacyExtension; extern const __DRIcoreExtension driCoreExtension; +extern const __DRIdri2Extension driDRI2Extension; extern const __DRIextension driReadDrawableExtension; extern const __DRIcopySubBufferExtension driCopySubBufferExtension; extern const __DRIswapControlExtension driSwapControlExtension; diff --git a/src/mesa/drivers/dri/common/drirenderbuffer.c b/src/mesa/drivers/dri/common/drirenderbuffer.c index 4e7e92c82b..3126ea8476 100644 --- a/src/mesa/drivers/dri/common/drirenderbuffer.c +++ b/src/mesa/drivers/dri/common/drirenderbuffer.c @@ -56,7 +56,7 @@ driDeleteRenderbuffer(struct gl_renderbuffer *rb) driRenderbuffer * driNewRenderbuffer(gl_format format, GLvoid *addr, GLint cpp, GLint offset, GLint pitch, - __DRIdrawablePrivate *dPriv) + __DRIdrawable *dPriv) { driRenderbuffer *drb; @@ -196,7 +196,7 @@ driFlipRenderbuffers(struct gl_framebuffer *fb, GLboolean flipped) * gl_framebuffer object. */ void -driUpdateFramebufferSize(GLcontext *ctx, const __DRIdrawablePrivate *dPriv) +driUpdateFramebufferSize(GLcontext *ctx, const __DRIdrawable *dPriv) { struct gl_framebuffer *fb = (struct gl_framebuffer *) dPriv->driverPrivate; if (fb && (dPriv->w != fb->Width || dPriv->h != fb->Height)) { diff --git a/src/mesa/drivers/dri/common/drirenderbuffer.h b/src/mesa/drivers/dri/common/drirenderbuffer.h index 3a5cbcdaac..677511334d 100644 --- a/src/mesa/drivers/dri/common/drirenderbuffer.h +++ b/src/mesa/drivers/dri/common/drirenderbuffer.h @@ -43,10 +43,10 @@ typedef struct { GLint flippedPitch; GLvoid *flippedData; /* mmap'd address of buffer memory, if used */ - /* Pointer to corresponding __DRIdrawablePrivate. This is used to compute + /* Pointer to corresponding __DRIdrawable. This is used to compute * the window's position within the framebuffer. */ - __DRIdrawablePrivate *dPriv; + __DRIdrawable *dPriv; /* XXX this is for radeon/r200 only. We should really create a new * r200Renderbuffer class, derived from this class... not a huge deal. @@ -66,14 +66,14 @@ typedef struct { extern driRenderbuffer * driNewRenderbuffer(gl_format format, GLvoid *addr, GLint cpp, GLint offset, GLint pitch, - __DRIdrawablePrivate *dPriv); + __DRIdrawable *dPriv); extern void driFlipRenderbuffers(struct gl_framebuffer *fb, GLboolean flipped); extern void -driUpdateFramebufferSize(GLcontext *ctx, const __DRIdrawablePrivate *dPriv); +driUpdateFramebufferSize(GLcontext *ctx, const __DRIdrawable *dPriv); #endif /* DRIRENDERBUFFER_H */ diff --git a/src/mesa/drivers/dri/common/vblank.c b/src/mesa/drivers/dri/common/vblank.c index 12aeaa108f..49b22a2dc7 100644 --- a/src/mesa/drivers/dri/common/vblank.c +++ b/src/mesa/drivers/dri/common/vblank.c @@ -34,12 +34,12 @@ #include "vblank.h" #include "xmlpool.h" -static unsigned int msc_to_vblank(__DRIdrawablePrivate * dPriv, int64_t msc) +static unsigned int msc_to_vblank(__DRIdrawable * dPriv, int64_t msc) { return (unsigned int)(msc - dPriv->msc_base + dPriv->vblank_base); } -static int64_t vblank_to_msc(__DRIdrawablePrivate * dPriv, unsigned int vblank) +static int64_t vblank_to_msc(__DRIdrawable * dPriv, unsigned int vblank) { return (int64_t)(vblank - dPriv->vblank_base + dPriv->msc_base); } @@ -64,8 +64,8 @@ static int64_t vblank_to_msc(__DRIdrawablePrivate * dPriv, unsigned int vblank) * \return Zero is returned on success. A negative errno value * is returned on failure. */ -int driDrawableGetMSC32( __DRIscreenPrivate * priv, - __DRIdrawablePrivate * dPriv, +int driDrawableGetMSC32( __DRIscreen * priv, + __DRIdrawable * dPriv, int64_t * count) { drmVBlank vbl; @@ -122,7 +122,7 @@ int driDrawableGetMSC32( __DRIscreenPrivate * priv, * \return Zero on success or \c GLX_BAD_CONTEXT on failure. */ -int driWaitForMSC32( __DRIdrawablePrivate *priv, +int driWaitForMSC32( __DRIdrawable *priv, int64_t target_msc, int64_t divisor, int64_t remainder, int64_t * msc ) { @@ -278,7 +278,7 @@ static int do_wait( drmVBlank * vbl, GLuint * vbl_seq, int fd ) */ static unsigned -driGetDefaultVBlankInterval( const __DRIdrawablePrivate *priv ) +driGetDefaultVBlankInterval( const __DRIdrawable *priv ) { if ( (priv->vblFlags & (VBLANK_FLAG_THROTTLE | VBLANK_FLAG_SYNC)) != 0 ) { return 1; @@ -295,7 +295,7 @@ driGetDefaultVBlankInterval( const __DRIdrawablePrivate *priv ) * direct rendering context. */ -void driDrawableInitVBlank( __DRIdrawablePrivate *priv ) +void driDrawableInitVBlank( __DRIdrawable *priv ) { if ( priv->swap_interval == (unsigned)-1 && !( priv->vblFlags & VBLANK_FLAG_NO_IRQ ) ) { @@ -320,7 +320,7 @@ void driDrawableInitVBlank( __DRIdrawablePrivate *priv ) */ unsigned -driGetVBlankInterval( const __DRIdrawablePrivate *priv ) +driGetVBlankInterval( const __DRIdrawable *priv ) { if ( (priv->vblFlags & VBLANK_FLAG_INTERVAL) != 0 ) { /* this must have been initialized when the drawable was first bound @@ -340,7 +340,7 @@ driGetVBlankInterval( const __DRIdrawablePrivate *priv ) */ void -driGetCurrentVBlank( __DRIdrawablePrivate *priv ) +driGetCurrentVBlank( __DRIdrawable *priv ) { drmVBlank vbl; @@ -366,7 +366,7 @@ driGetCurrentVBlank( __DRIdrawablePrivate *priv ) */ int -driWaitForVBlank( __DRIdrawablePrivate *priv, GLboolean * missed_deadline ) +driWaitForVBlank( __DRIdrawable *priv, GLboolean * missed_deadline ) { drmVBlank vbl; unsigned original_seq; diff --git a/src/mesa/drivers/dri/common/vblank.h b/src/mesa/drivers/dri/common/vblank.h index 8b2c761a11..29d1ad8003 100644 --- a/src/mesa/drivers/dri/common/vblank.h +++ b/src/mesa/drivers/dri/common/vblank.h @@ -44,17 +44,17 @@ #define VBLANK_FLAG_SECONDARY (1U << 8) /* Wait for secondary vblank. */ -extern int driGetMSC32( __DRIscreenPrivate * priv, int64_t * count ); -extern int driDrawableGetMSC32( __DRIscreenPrivate * priv, - __DRIdrawablePrivate * drawablePrivate, +extern int driGetMSC32( __DRIscreen * priv, int64_t * count ); +extern int driDrawableGetMSC32( __DRIscreen * priv, + __DRIdrawable * drawablePrivate, int64_t * count); -extern int driWaitForMSC32( __DRIdrawablePrivate *priv, +extern int driWaitForMSC32( __DRIdrawable *priv, int64_t target_msc, int64_t divisor, int64_t remainder, int64_t * msc ); extern GLuint driGetDefaultVBlankFlags( const driOptionCache *optionCache ); -extern void driDrawableInitVBlank ( __DRIdrawablePrivate *priv ); -extern unsigned driGetVBlankInterval( const __DRIdrawablePrivate *priv ); -extern void driGetCurrentVBlank( __DRIdrawablePrivate *priv ); -extern int driWaitForVBlank( __DRIdrawablePrivate *priv, +extern void driDrawableInitVBlank ( __DRIdrawable *priv ); +extern unsigned driGetVBlankInterval( const __DRIdrawable *priv ); +extern void driGetCurrentVBlank( __DRIdrawable *priv ); +extern int driWaitForVBlank( __DRIdrawable *priv, GLboolean * missed_deadline ); #undef usleep diff --git a/src/mesa/drivers/dri/fb/fb_dri.c b/src/mesa/drivers/dri/fb/fb_dri.c index fd869b2fe7..f37241dd69 100644 --- a/src/mesa/drivers/dri/fb/fb_dri.c +++ b/src/mesa/drivers/dri/fb/fb_dri.c @@ -64,9 +64,9 @@ typedef struct { GLcontext *glCtx; /* Mesa context */ struct { - __DRIcontextPrivate *context; - __DRIscreenPrivate *screen; - __DRIdrawablePrivate *drawable; /* drawable bound to this ctx */ + __DRIcontext *context; + __DRIscreen *screen; + __DRIdrawable *drawable; /* drawable bound to this ctx */ } dri; } fbContext, *fbContextPtr; @@ -313,14 +313,14 @@ fbSetSpanFunctions(driRenderbuffer *drb, const GLvisual *vis) /* Initialize the driver specific screen private data. */ static GLboolean -fbInitDriver( __DRIscreenPrivate *sPriv ) +fbInitDriver( __DRIscreen *sPriv ) { sPriv->private = NULL; return GL_TRUE; } static void -fbDestroyScreen( __DRIscreenPrivate *sPriv ) +fbDestroyScreen( __DRIscreen *sPriv ) { } @@ -329,7 +329,7 @@ fbDestroyScreen( __DRIscreenPrivate *sPriv ) */ static GLboolean fbCreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { fbContextPtr fbmesa; @@ -384,7 +384,7 @@ fbCreateContext( const __GLcontextModes *glVisual, static void -fbDestroyContext( __DRIcontextPrivate *driContextPriv ) +fbDestroyContext( __DRIcontext *driContextPriv ) { GET_CURRENT_CONTEXT(ctx); fbContextPtr fbmesa = (fbContextPtr) driContextPriv->driverPrivate; @@ -415,8 +415,8 @@ fbDestroyContext( __DRIcontextPrivate *driContextPriv ) * data. */ static GLboolean -fbCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +fbCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -478,7 +478,7 @@ fbCreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -fbDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +fbDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } @@ -488,7 +488,7 @@ fbDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) /* If the backbuffer is on a videocard, this is extraordinarily slow! */ static void -fbSwapBuffers( __DRIdrawablePrivate *dPriv ) +fbSwapBuffers( __DRIdrawable *dPriv ) { struct gl_framebuffer *mesa_framebuffer = (struct gl_framebuffer *)dPriv->driverPrivate; struct gl_renderbuffer * front_renderbuffer = mesa_framebuffer->Attachment[BUFFER_FRONT_LEFT].Renderbuffer; @@ -532,9 +532,9 @@ fbSwapBuffers( __DRIdrawablePrivate *dPriv ) * buffer `b'. */ static GLboolean -fbMakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ) +fbMakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ) { if ( driContextPriv ) { fbContextPtr newFbCtx = @@ -556,7 +556,7 @@ fbMakeCurrent( __DRIcontextPrivate *driContextPriv, /* Force the context `c' to be unbound from its buffer. */ static GLboolean -fbUnbindContext( __DRIcontextPrivate *driContextPriv ) +fbUnbindContext( __DRIcontext *driContextPriv ) { return GL_TRUE; } @@ -657,7 +657,7 @@ struct DRIDriverRec __driDriver = { }; static __GLcontextModes * -fbFillInModes( __DRIscreenPrivate *psp, +fbFillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -745,7 +745,7 @@ fbFillInModes( __DRIscreenPrivate *psp, * with the \c __GLcontextModes that the driver can support for windows or * pbuffers. * - * \return A pointer to a \c __DRIscreenPrivate on success, or \c NULL on + * \return A pointer to a \c __DRIscreen on success, or \c NULL on * failure. */ PUBLIC @@ -759,7 +759,7 @@ void * __driCreateNewScreen( __DRInativeDisplay *dpy, int scrn, __DRIscreen *psc int internal_api_version, __GLcontextModes ** driver_modes ) { - __DRIscreenPrivate *psp; + __DRIscreen *psp; static const __DRIversion ddx_expected = { 4, 0, 0 }; static const __DRIversion dri_expected = { 4, 0, 0 }; static const __DRIversion drm_expected = { 1, 5, 0 }; @@ -785,3 +785,10 @@ void * __driCreateNewScreen( __DRInativeDisplay *dpy, int scrn, __DRIscreen *psc return (void *) psp; } + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/fb/fb_egl.c b/src/mesa/drivers/dri/fb/fb_egl.c index eb7adf8224..02e44bb8ee 100644 --- a/src/mesa/drivers/dri/fb/fb_egl.c +++ b/src/mesa/drivers/dri/fb/fb_egl.c @@ -84,9 +84,9 @@ typedef struct fb_context _EGLContext Base; /* base class/object */ GLcontext *glCtx; struct { - __DRIcontextPrivate *context; - __DRIscreenPrivate *screen; - __DRIdrawablePrivate *drawable; /* drawable bound to this ctx */ + __DRIcontext *context; + __DRIscreen *screen; + __DRIdrawable *drawable; /* drawable bound to this ctx */ } dri; } fbContext, *fbContextPtr; diff --git a/src/mesa/drivers/dri/ffb/ffb_bitmap.c b/src/mesa/drivers/dri/ffb/ffb_bitmap.c index f89c0412df..611afddfaf 100644 --- a/src/mesa/drivers/dri/ffb/ffb_bitmap.c +++ b/src/mesa/drivers/dri/ffb/ffb_bitmap.c @@ -46,7 +46,7 @@ ffb_bitmap(GLcontext *ctx, GLint px, GLint py, { ffbContextPtr fmesa = FFB_CONTEXT(ctx); ffb_fbcPtr ffb = fmesa->regs; - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; unsigned int ppc, pixel; GLint row, col, row_stride; const GLubyte *src; diff --git a/src/mesa/drivers/dri/ffb/ffb_clear.c b/src/mesa/drivers/dri/ffb/ffb_clear.c index 776fb487f8..dfe60f36f2 100644 --- a/src/mesa/drivers/dri/ffb/ffb_clear.c +++ b/src/mesa/drivers/dri/ffb/ffb_clear.c @@ -123,7 +123,7 @@ CreatorComputePageFillFixups(struct ff_fixups *fixups, } static void -ffb_do_clear(GLcontext *ctx, __DRIdrawablePrivate *dPriv) +ffb_do_clear(GLcontext *ctx, __DRIdrawable *dPriv) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); FFBDRIPtr gDRIPriv = (FFBDRIPtr) fmesa->driScreen->pDevPriv; @@ -252,7 +252,7 @@ ffb_do_clear(GLcontext *ctx, __DRIdrawablePrivate *dPriv) void ffbDDClear(GLcontext *ctx, GLbitfield mask) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; unsigned int stcmask = BUFFER_BIT_STENCIL; #ifdef CLEAR_TRACE diff --git a/src/mesa/drivers/dri/ffb/ffb_context.h b/src/mesa/drivers/dri/ffb/ffb_context.h index 77f87d41c3..4d1d53ff59 100644 --- a/src/mesa/drivers/dri/ffb/ffb_context.h +++ b/src/mesa/drivers/dri/ffb/ffb_context.h @@ -273,8 +273,8 @@ do { if ((STATE_MASK) & ~((FMESA)->state_dirty)) { \ unsigned int setupnewinputs; unsigned int new_gl_state; - __DRIdrawablePrivate *driDrawable; - __DRIscreenPrivate *driScreen; + __DRIdrawable *driDrawable; + __DRIscreen *driScreen; ffbScreenPrivate *ffbScreen; ffb_dri_state_t *ffb_sarea; } ffbContextRec, *ffbContextPtr; diff --git a/src/mesa/drivers/dri/ffb/ffb_depth.c b/src/mesa/drivers/dri/ffb/ffb_depth.c index 71f204d21e..5d509ff696 100644 --- a/src/mesa/drivers/dri/ffb/ffb_depth.c +++ b/src/mesa/drivers/dri/ffb/ffb_depth.c @@ -49,7 +49,7 @@ static void FFBWriteDepthSpan( GLcontext *ctx, #endif if (ctx->Depth.Mask) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; GLuint *zptr; GLuint i; @@ -110,7 +110,7 @@ static void FFBWriteDepthPixels( GLcontext *ctx, #endif if (ctx->Depth.Mask) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; char *zbase; GLuint i; @@ -153,7 +153,7 @@ static void FFBReadDepthSpan( GLcontext *ctx, { GLuint *depth = (GLuint *) values; ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; GLuint *zptr; GLuint i; @@ -194,7 +194,7 @@ static void FFBReadDepthPixels( GLcontext *ctx, { GLuint *depth = (GLuint *) values; ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; char *zbase; GLuint i; diff --git a/src/mesa/drivers/dri/ffb/ffb_span.c b/src/mesa/drivers/dri/ffb/ffb_span.c index 0d3d604095..8ec33a11bc 100644 --- a/src/mesa/drivers/dri/ffb/ffb_span.c +++ b/src/mesa/drivers/dri/ffb/ffb_span.c @@ -45,7 +45,7 @@ UNLOCK_HARDWARE(fmesa); \ #define LOCAL_VARS \ - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; \ + __DRIdrawable *dPriv = fmesa->driDrawable; \ GLuint height = dPriv->h; \ GLuint p; \ char *buf; \ diff --git a/src/mesa/drivers/dri/ffb/ffb_state.c b/src/mesa/drivers/dri/ffb/ffb_state.c index 5eb8f417ff..6f8a46d1fc 100644 --- a/src/mesa/drivers/dri/ffb/ffb_state.c +++ b/src/mesa/drivers/dri/ffb/ffb_state.c @@ -384,7 +384,7 @@ ffbDDStencilOpSeparate(GLcontext *ctx, GLenum face, GLenum fail, static void ffbCalcViewportRegs(GLcontext *ctx) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; GLuint xmin, xmax, ymin, ymax, zmin, zmax; unsigned int vcmin, vcmax; @@ -430,7 +430,7 @@ void ffbCalcViewport(GLcontext *ctx) ffbContextPtr fmesa = FFB_CONTEXT(ctx); const GLfloat *v = ctx->Viewport._WindowMap.m; GLfloat *m = fmesa->hw_viewport; - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; m[MAT_SX] = v[MAT_SX]; m[MAT_TX] = v[MAT_TX] + dPriv->x + SUBPIXEL_X; @@ -762,7 +762,7 @@ static void ffbDDLineStipple(GLcontext *ctx, GLint factor, GLushort pattern) void ffbXformAreaPattern(ffbContextPtr fmesa, const GLubyte *mask) { - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; int i, lines, xoff; lines = 0; diff --git a/src/mesa/drivers/dri/ffb/ffb_stencil.c b/src/mesa/drivers/dri/ffb/ffb_stencil.c index 921a83d274..ce8ef43c91 100644 --- a/src/mesa/drivers/dri/ffb/ffb_stencil.c +++ b/src/mesa/drivers/dri/ffb/ffb_stencil.c @@ -48,7 +48,7 @@ static void FFBWriteStencilSpan( GLcontext *ctx, #endif if (ctx->Depth.Mask) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; GLuint *zptr; GLuint i; @@ -93,7 +93,7 @@ static void FFBWriteStencilPixels( GLcontext *ctx, #endif if (ctx->Depth.Mask) { ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; char *zbase; GLuint i; @@ -136,7 +136,7 @@ static void FFBReadStencilSpan( GLcontext *ctx, { GLubyte *stencil = (GLubyte *) values; ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; GLuint *zptr; GLuint i; @@ -176,7 +176,7 @@ static void FFBReadStencilPixels( GLcontext *ctx, { GLubyte *stencil = (GLubyte *) values; ffbContextPtr fmesa = FFB_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; + __DRIdrawable *dPriv = fmesa->driDrawable; char *zbase; GLuint i; diff --git a/src/mesa/drivers/dri/ffb/ffb_tris.c b/src/mesa/drivers/dri/ffb/ffb_tris.c index e7dd960ba1..8bf5ae498f 100644 --- a/src/mesa/drivers/dri/ffb/ffb_tris.c +++ b/src/mesa/drivers/dri/ffb/ffb_tris.c @@ -351,7 +351,7 @@ static struct { #define LOCAL_VARS(n) \ ffbContextPtr fmesa = FFB_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; \ + __DRIdrawable *dPriv = fmesa->driDrawable; \ ffb_color color[n] = { { 0 } }; \ (void) color; (void) dPriv; diff --git a/src/mesa/drivers/dri/ffb/ffb_xmesa.c b/src/mesa/drivers/dri/ffb/ffb_xmesa.c index 09cc26d09e..88285f454e 100644 --- a/src/mesa/drivers/dri/ffb/ffb_xmesa.c +++ b/src/mesa/drivers/dri/ffb/ffb_xmesa.c @@ -62,7 +62,7 @@ #include "drirenderbuffer.h" static GLboolean -ffbInitDriver(__DRIscreenPrivate *sPriv) +ffbInitDriver(__DRIscreen *sPriv) { ffbScreenPrivate *ffbScreen; FFBDRIPtr gDRIPriv = (FFBDRIPtr) sPriv->pDevPriv; @@ -154,7 +154,7 @@ ffbInitDriver(__DRIscreenPrivate *sPriv) static void -ffbDestroyScreen(__DRIscreenPrivate *sPriv) +ffbDestroyScreen(__DRIscreen *sPriv) { ffbScreenPrivate *ffbScreen = sPriv->private; FFBDRIPtr gDRIPriv = (FFBDRIPtr) sPriv->pDevPriv; @@ -183,12 +183,12 @@ static const struct tnl_pipeline_stage *ffb_pipeline[] = { /* Create and initialize the Mesa and driver specific context data */ static GLboolean ffbCreateContext(const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { ffbContextPtr fmesa; GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *sPriv; + __DRIscreen *sPriv; ffbScreenPrivate *ffbScreen; char *debug; struct dd_function_table functions; @@ -306,7 +306,7 @@ ffbCreateContext(const __GLcontextModes *mesaVis, } static void -ffbDestroyContext(__DRIcontextPrivate *driContextPriv) +ffbDestroyContext(__DRIcontext *driContextPriv) { ffbContextPtr fmesa = (ffbContextPtr) driContextPriv->driverPrivate; @@ -328,8 +328,8 @@ ffbDestroyContext(__DRIcontextPrivate *driContextPriv) /* Create and initialize the Mesa and driver specific pixmap buffer data */ static GLboolean -ffbCreateBuffer(__DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +ffbCreateBuffer(__DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -392,7 +392,7 @@ ffbCreateBuffer(__DRIscreenPrivate *driScrnPriv, static void -ffbDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +ffbDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } @@ -401,7 +401,7 @@ ffbDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) #define USE_FAST_SWAP static void -ffbSwapBuffers( __DRIdrawablePrivate *dPriv ) +ffbSwapBuffers( __DRIdrawable *dPriv ) { ffbContextPtr fmesa = (ffbContextPtr) dPriv->driContextPriv->driverPrivate; unsigned int fbc, wid, wid_reg_val, dac_db_bit; @@ -532,9 +532,9 @@ static void ffb_init_wid(ffbContextPtr fmesa, unsigned int wid) /* Force the context `c' to be the current context and associate with it buffer `b' */ static GLboolean -ffbMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +ffbMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (driContextPriv) { ffbContextPtr fmesa = (ffbContextPtr) driContextPriv->driverPrivate; @@ -581,15 +581,15 @@ ffbMakeCurrent(__DRIcontextPrivate *driContextPriv, /* Force the context `c' to be unbound from its buffer */ static GLboolean -ffbUnbindContext(__DRIcontextPrivate *driContextPriv) +ffbUnbindContext(__DRIcontext *driContextPriv) { return GL_TRUE; } void ffbXMesaUpdateState(ffbContextPtr fmesa) { - __DRIdrawablePrivate *dPriv = fmesa->driDrawable; - __DRIscreenPrivate *sPriv = fmesa->driScreen; + __DRIdrawable *dPriv = fmesa->driDrawable; + __DRIscreen *sPriv = fmesa->driScreen; int stamp = dPriv->lastStamp; DRI_VALIDATE_DRAWABLE_INFO(sPriv, dPriv); @@ -607,7 +607,7 @@ void ffbXMesaUpdateState(ffbContextPtr fmesa) } static const __DRIconfig ** -ffbFillInModes( __DRIscreenPrivate *psp, +ffbFillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -722,3 +722,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/ffb/ffb_xmesa.h b/src/mesa/drivers/dri/ffb/ffb_xmesa.h index 255da4c5f8..2b1740d221 100644 --- a/src/mesa/drivers/dri/ffb/ffb_xmesa.h +++ b/src/mesa/drivers/dri/ffb/ffb_xmesa.h @@ -11,7 +11,7 @@ #include "ffb_fifo.h" typedef struct { - __DRIscreenPrivate *sPriv; + __DRIscreen *sPriv; ffb_fbcPtr regs; ffb_dacPtr dac; volatile char *sfb8r; diff --git a/src/mesa/drivers/dri/gamma/gamma_context.c b/src/mesa/drivers/dri/gamma/gamma_context.c index b0ac299daa..bab5b69a8e 100644 --- a/src/mesa/drivers/dri/gamma/gamma_context.c +++ b/src/mesa/drivers/dri/gamma/gamma_context.c @@ -68,11 +68,11 @@ static const struct tnl_pipeline_stage *gamma_pipeline[] = { }; GLboolean gammaCreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; gammaContextPtr gmesa; gammaScreenPtr gammascrn; GLINTSAREADRIPtr saPriv=(GLINTSAREADRIPtr)(((char*)sPriv->pSAREA)+ diff --git a/src/mesa/drivers/dri/gamma/gamma_context.h b/src/mesa/drivers/dri/gamma/gamma_context.h index a32ccb6007..c386aa3007 100644 --- a/src/mesa/drivers/dri/gamma/gamma_context.h +++ b/src/mesa/drivers/dri/gamma/gamma_context.h @@ -58,10 +58,10 @@ typedef union { #define MAX_TEXTURE_STACK 2 extern void gammaDDUpdateHWState(GLcontext *ctx); -extern gammaScreenPtr gammaCreateScreen(__DRIscreenPrivate *sPriv); -extern void gammaDestroyScreen(__DRIscreenPrivate *sPriv); +extern gammaScreenPtr gammaCreateScreen(__DRIscreen *sPriv); +extern void gammaDestroyScreen(__DRIscreen *sPriv); extern GLboolean gammaCreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate); #define GAMMA_UPLOAD_ALL 0xffffffff @@ -230,9 +230,9 @@ typedef void (*gamma_point_func)( gammaContextPtr, struct gamma_context { GLcontext *glCtx; /* Mesa context */ - __DRIcontextPrivate *driContext; - __DRIscreenPrivate *driScreen; - __DRIdrawablePrivate *driDrawable; + __DRIcontext *driContext; + __DRIscreen *driScreen; + __DRIdrawable *driDrawable; GLuint new_gl_state; GLuint new_state; diff --git a/src/mesa/drivers/dri/gamma/gamma_lock.c b/src/mesa/drivers/dri/gamma/gamma_lock.c index 8f2d01688c..cd4acef24d 100644 --- a/src/mesa/drivers/dri/gamma/gamma_lock.c +++ b/src/mesa/drivers/dri/gamma/gamma_lock.c @@ -19,8 +19,8 @@ int prevLockLine = 0; */ void gammaGetLock( gammaContextPtr gmesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = gmesa->driDrawable; - __DRIscreenPrivate *sPriv = gmesa->driScreen; + __DRIdrawable *dPriv = gmesa->driDrawable; + __DRIscreen *sPriv = gmesa->driScreen; drmGetLock( gmesa->driFd, gmesa->hHWContext, flags ); diff --git a/src/mesa/drivers/dri/gamma/gamma_macros.h b/src/mesa/drivers/dri/gamma/gamma_macros.h index c15483b770..d962dcdb56 100644 --- a/src/mesa/drivers/dri/gamma/gamma_macros.h +++ b/src/mesa/drivers/dri/gamma/gamma_macros.h @@ -245,8 +245,8 @@ do { \ #ifdef DO_VALIDATE #define VALIDATE_DRAWABLE_INFO_NO_LOCK(gcp) \ do { \ - /*__DRIscreenPrivate *psp = gcp->driScreen;*/ \ - __DRIdrawablePrivate *pdp = gcp->driDrawable; \ + /*__DRIscreen *psp = gcp->driScreen;*/ \ + __DRIdrawable *pdp = gcp->driDrawable; \ \ if (*(pdp->pStamp) != pdp->lastStamp) { \ int old_index = pdp->index; \ @@ -301,7 +301,7 @@ do { \ #define VALIDATE_DRAWABLE_INFO(gcp) \ do { \ - __DRIscreenPrivate *psp = gcp->driScreen; \ + __DRIscreen *psp = gcp->driScreen; \ if (gcp->driDrawable) { \ DRM_SPINLOCK(&psp->pSAREA->drawable_lock, psp->drawLockID); \ VALIDATE_DRAWABLE_INFO_NO_LOCK(gcp); \ diff --git a/src/mesa/drivers/dri/gamma/gamma_screen.c b/src/mesa/drivers/dri/gamma/gamma_screen.c index f899ebec96..f72a4a5696 100644 --- a/src/mesa/drivers/dri/gamma/gamma_screen.c +++ b/src/mesa/drivers/dri/gamma/gamma_screen.c @@ -29,7 +29,7 @@ #include "main/imports.h" -gammaScreenPtr gammaCreateScreen( __DRIscreenPrivate *sPriv ) +gammaScreenPtr gammaCreateScreen( __DRIscreen *sPriv ) { gammaScreenPtr gammaScreen; GLINTDRIPtr gDRIPriv = (GLINTDRIPtr)sPriv->pDevPriv; @@ -129,7 +129,7 @@ gammaScreenPtr gammaCreateScreen( __DRIscreenPrivate *sPriv ) /* Destroy the device specific screen private data struct. */ -void gammaDestroyScreen( __DRIscreenPrivate *sPriv ) +void gammaDestroyScreen( __DRIscreen *sPriv ) { gammaScreenPtr gammaScreen = (gammaScreenPtr)sPriv->private; diff --git a/src/mesa/drivers/dri/gamma/gamma_screen.h b/src/mesa/drivers/dri/gamma/gamma_screen.h index 7f0ed6f80e..c716ea89c2 100644 --- a/src/mesa/drivers/dri/gamma/gamma_screen.h +++ b/src/mesa/drivers/dri/gamma/gamma_screen.h @@ -11,7 +11,7 @@ typedef struct { drmBufMapPtr bufs; /* Map of DMA buffers */ - __DRIscreenPrivate *driScreen; /* Back pointer to DRI screen */ + __DRIscreen *driScreen; /* Back pointer to DRI screen */ int cpp; int frontPitch; diff --git a/src/mesa/drivers/dri/gamma/gamma_span.c b/src/mesa/drivers/dri/gamma/gamma_span.c index cdaaac3f3a..3f0b81800c 100644 --- a/src/mesa/drivers/dri/gamma/gamma_span.c +++ b/src/mesa/drivers/dri/gamma/gamma_span.c @@ -10,8 +10,8 @@ #define LOCAL_VARS \ gammaContextPtr gmesa = GAMMA_CONTEXT(ctx); \ gammaScreenPtr gammascrn = gmesa->gammaScreen; \ - __DRIscreenPrivate *sPriv = gmesa->driScreen; \ - __DRIdrawablePrivate *dPriv = gmesa->driDrawable; \ + __DRIscreen *sPriv = gmesa->driScreen; \ + __DRIdrawable *dPriv = gmesa->driDrawable; \ GLuint pitch = sPriv->fbWidth * gammascrn->cpp; \ GLuint height = dPriv->h; \ char *buf = (char *)(sPriv->pFB + \ @@ -24,8 +24,8 @@ /* FIXME! Depth/Stencil read/writes don't work ! */ #define LOCAL_DEPTH_VARS \ gammaScreenPtr gammascrn = gmesa->gammaScreen; \ - __DRIdrawablePrivate *dPriv = gmesa->driDrawable; \ - __DRIscreenPrivate *sPriv = gmesa->driScreen; \ + __DRIdrawable *dPriv = gmesa->driDrawable; \ + __DRIscreen *sPriv = gmesa->driScreen; \ GLuint pitch = gammascrn->depthPitch; \ GLuint height = dPriv->h; \ char *buf = (char *)(sPriv->pFB + \ diff --git a/src/mesa/drivers/dri/gamma/gamma_state.c b/src/mesa/drivers/dri/gamma/gamma_state.c index bdd1c86ab7..47df37466d 100644 --- a/src/mesa/drivers/dri/gamma/gamma_state.c +++ b/src/mesa/drivers/dri/gamma/gamma_state.c @@ -1070,7 +1070,7 @@ static void gammaDDReadBuffer( GLcontext *ctx, GLenum mode ) void gammaUpdateWindow( GLcontext *ctx ) { gammaContextPtr gmesa = GAMMA_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = gmesa->driDrawable; + __DRIdrawable *dPriv = gmesa->driDrawable; GLfloat xoffset = (GLfloat)dPriv->x; GLfloat yoffset = gmesa->driScreen->fbHeight - (GLfloat)dPriv->y - dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -1109,7 +1109,7 @@ static void gammaDDDepthRange( GLcontext *ctx, GLclampd nearval, void gammaUpdateViewportOffset( GLcontext *ctx ) { gammaContextPtr gmesa = GAMMA_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = gmesa->driDrawable; + __DRIdrawable *dPriv = gmesa->driDrawable; GLfloat xoffset = (GLfloat)dPriv->x; GLfloat yoffset = gmesa->driScreen->fbHeight - (GLfloat)dPriv->y - dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; diff --git a/src/mesa/drivers/dri/gamma/gamma_tex.c b/src/mesa/drivers/dri/gamma/gamma_tex.c index 0dad250e4d..694e5eba5b 100644 --- a/src/mesa/drivers/dri/gamma/gamma_tex.c +++ b/src/mesa/drivers/dri/gamma/gamma_tex.c @@ -145,7 +145,7 @@ static void gammaTexParameter( GLcontext *ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - gammaSetTexBorderColor( gmesa, t, tObj->BorderColor ); + gammaSetTexBorderColor( gmesa, t, tObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: @@ -349,7 +349,7 @@ static void gammaBindTexture( GLcontext *ctx, GLenum target, gammaSetTexWrapping( t, tObj->WrapS, tObj->WrapT ); gammaSetTexFilter( gmesa, t, tObj->MinFilter, tObj->MagFilter, bias ); - gammaSetTexBorderColor( gmesa, t, tObj->BorderColor ); + gammaSetTexBorderColor( gmesa, t, tObj->BorderColor.f ); } } diff --git a/src/mesa/drivers/dri/gamma/gamma_xmesa.c b/src/mesa/drivers/dri/gamma/gamma_xmesa.c index 7b5b53589c..e49ab5bae3 100644 --- a/src/mesa/drivers/dri/gamma/gamma_xmesa.c +++ b/src/mesa/drivers/dri/gamma/gamma_xmesa.c @@ -36,7 +36,7 @@ #include "vbo/vbo.h" static GLboolean -gammaInitDriver(__DRIscreenPrivate *sPriv) +gammaInitDriver(__DRIscreen *sPriv) { sPriv->private = (void *) gammaCreateScreen( sPriv ); @@ -49,7 +49,7 @@ gammaInitDriver(__DRIscreenPrivate *sPriv) } static void -gammaDestroyContext(__DRIcontextPrivate *driContextPriv) +gammaDestroyContext(__DRIcontext *driContextPriv) { gammaContextPtr gmesa = (gammaContextPtr)driContextPriv->driverPrivate; @@ -72,8 +72,8 @@ gammaDestroyContext(__DRIcontextPrivate *driContextPriv) static GLboolean -gammaCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +gammaCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -94,17 +94,17 @@ gammaCreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -gammaDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +gammaDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } static void -gammaSwapBuffers( __DRIdrawablePrivate *dPriv ) +gammaSwapBuffers( __DRIdrawable *dPriv ) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { gammaContextPtr gmesa; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; GLcontext *ctx; gmesa = (gammaContextPtr) dPriv->driContextPriv->driverPrivate; @@ -127,7 +127,7 @@ gammaSwapBuffers( __DRIdrawablePrivate *dPriv ) int i; int nRect = dPriv->numClipRects; drm_clip_rect_t *pRect = dPriv->pClipRects; - __DRIscreenPrivate *driScrnPriv = gmesa->driScreen; + __DRIscreen *driScrnPriv = gmesa->driScreen; GLINTDRIPtr gDRIPriv = (GLINTDRIPtr)driScrnPriv->pDevPriv; CHECK_DMA_BUFFER(gmesa, 2); @@ -193,9 +193,9 @@ gammaSwapBuffers( __DRIdrawablePrivate *dPriv ) } static GLboolean -gammaMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +gammaMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (driContextPriv) { GET_CURRENT_CONTEXT(ctx); @@ -232,7 +232,7 @@ newGammaCtx->new_state |= GAMMA_NEW_WINDOW; /* FIXME */ static GLboolean -gammaUnbindContext( __DRIcontextPrivate *driContextPriv ) +gammaUnbindContext( __DRIcontext *driContextPriv ) { return GL_TRUE; } @@ -254,12 +254,19 @@ const struct __DriverAPIRec driDriverAPI = { /* * This is the bootstrap function for the driver. * The __driCreateScreen name is the symbol that libGL.so fetches. - * Return: pointer to a __DRIscreenPrivate. + * Return: pointer to a __DRIscreen. */ void *__driCreateScreen(Display *dpy, int scrn, __DRIscreen *psc, int numConfigs, __GLXvisualConfig *config) { - __DRIscreenPrivate *psp; + __DRIscreen *psp; psp = __driUtilCreateScreen(dpy, scrn, psc, numConfigs, config, &gammaAPI); return (void *) psp; } + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/i810/i810context.c b/src/mesa/drivers/dri/i810/i810context.c index 7311b2e765..bd9cfe5c0f 100644 --- a/src/mesa/drivers/dri/i810/i810context.c +++ b/src/mesa/drivers/dri/i810/i810context.c @@ -170,12 +170,12 @@ static const struct dri_debug_control debug_control[] = GLboolean i810CreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { GLcontext *ctx, *shareCtx; i810ContextPtr imesa; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; i810ScreenPrivate *i810Screen = (i810ScreenPrivate *)sPriv->private; I810SAREAPtr saPriv = (I810SAREAPtr) (((GLubyte *)sPriv->pSAREA) + i810Screen->sarea_priv_offset); @@ -337,7 +337,7 @@ i810CreateContext( const __GLcontextModes *mesaVis, } void -i810DestroyContext(__DRIcontextPrivate *driContextPriv) +i810DestroyContext(__DRIcontext *driContextPriv) { i810ContextPtr imesa = (i810ContextPtr) driContextPriv->driverPrivate; @@ -378,7 +378,7 @@ i810DestroyContext(__DRIcontextPrivate *driContextPriv) void i810XMesaSetFrontClipRects( i810ContextPtr imesa ) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; + __DRIdrawable *dPriv = imesa->driDrawable; imesa->numClipRects = dPriv->numClipRects; imesa->pClipRects = dPriv->pClipRects; @@ -392,7 +392,7 @@ void i810XMesaSetFrontClipRects( i810ContextPtr imesa ) void i810XMesaSetBackClipRects( i810ContextPtr imesa ) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; + __DRIdrawable *dPriv = imesa->driDrawable; if (imesa->sarea->pf_enabled == 0 && dPriv->numBackClipRects == 0) { @@ -430,7 +430,7 @@ static void i810XMesaWindowMoved( i810ContextPtr imesa ) GLboolean -i810UnbindContext(__DRIcontextPrivate *driContextPriv) +i810UnbindContext(__DRIcontext *driContextPriv) { i810ContextPtr imesa = (i810ContextPtr) driContextPriv->driverPrivate; if (imesa) { @@ -444,9 +444,9 @@ i810UnbindContext(__DRIcontextPrivate *driContextPriv) GLboolean -i810MakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +i810MakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (driContextPriv) { i810ContextPtr imesa = (i810ContextPtr) driContextPriv->driverPrivate; @@ -504,8 +504,8 @@ i810UpdatePageFlipping( i810ContextPtr imesa ) void i810GetLock( i810ContextPtr imesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; - __DRIscreenPrivate *sPriv = imesa->driScreen; + __DRIdrawable *dPriv = imesa->driDrawable; + __DRIscreen *sPriv = imesa->driScreen; I810SAREAPtr sarea = imesa->sarea; int me = imesa->hHWContext; unsigned i; @@ -551,7 +551,7 @@ void i810GetLock( i810ContextPtr imesa, GLuint flags ) void -i810SwapBuffers( __DRIdrawablePrivate *dPriv ) +i810SwapBuffers( __DRIdrawable *dPriv ) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { i810ContextPtr imesa; diff --git a/src/mesa/drivers/dri/i810/i810context.h b/src/mesa/drivers/dri/i810/i810context.h index 4b8c71d7c6..19529db020 100644 --- a/src/mesa/drivers/dri/i810/i810context.h +++ b/src/mesa/drivers/dri/i810/i810context.h @@ -170,8 +170,8 @@ struct i810_context_t { drm_hw_lock_t *driHwLock; int driFd; - __DRIdrawablePrivate *driDrawable; - __DRIscreenPrivate *driScreen; + __DRIdrawable *driDrawable; + __DRIscreen *driScreen; i810ScreenPrivate *i810Screen; I810SAREAPtr sarea; }; diff --git a/src/mesa/drivers/dri/i810/i810ioctl.c b/src/mesa/drivers/dri/i810/i810ioctl.c index 3df9c2ac47..c631543d93 100644 --- a/src/mesa/drivers/dri/i810/i810ioctl.c +++ b/src/mesa/drivers/dri/i810/i810ioctl.c @@ -50,8 +50,8 @@ static drmBufPtr i810_get_buffer_ioctl( i810ContextPtr imesa ) static void i810Clear( GLcontext *ctx, GLbitfield mask ) { i810ContextPtr imesa = I810_CONTEXT( ctx ); - __DRIdrawablePrivate *dPriv = imesa->driDrawable; - const GLuint colorMask = *((GLuint *) &ctx->Color.ColorMask); + __DRIdrawable *dPriv = imesa->driDrawable; + const GLuint colorMask = *((GLuint *) &ctx->Color.ColorMask[0]); drmI810Clear clear; unsigned int i; @@ -149,7 +149,7 @@ static void i810Clear( GLcontext *ctx, GLbitfield mask ) /* * Copy the back buffer to the front buffer. */ -void i810CopyBuffer( const __DRIdrawablePrivate *dPriv ) +void i810CopyBuffer( const __DRIdrawable *dPriv ) { i810ContextPtr imesa; drm_clip_rect_t *pbox; @@ -197,7 +197,7 @@ void i810CopyBuffer( const __DRIdrawablePrivate *dPriv ) /* * XXX implement when full-screen extension is done. */ -void i810PageFlip( const __DRIdrawablePrivate *dPriv ) +void i810PageFlip( const __DRIdrawable *dPriv ) { i810ContextPtr imesa; int tmp, ret; diff --git a/src/mesa/drivers/dri/i810/i810ioctl.h b/src/mesa/drivers/dri/i810/i810ioctl.h index dfd6e21088..926e38ce51 100644 --- a/src/mesa/drivers/dri/i810/i810ioctl.h +++ b/src/mesa/drivers/dri/i810/i810ioctl.h @@ -14,8 +14,8 @@ void i810WaitAge( i810ContextPtr imesa, int age ); void i810DmaFinish( i810ContextPtr imesa ); void i810RegetLockQuiescent( i810ContextPtr imesa ); void i810InitIoctlFuncs( struct dd_function_table *functions ); -void i810CopyBuffer( const __DRIdrawablePrivate *dpriv ); -void i810PageFlip( const __DRIdrawablePrivate *dpriv ); +void i810CopyBuffer( const __DRIdrawable *dpriv ); +void i810PageFlip( const __DRIdrawable *dpriv ); int i810_check_copy(int fd); #define I810_STATECHANGE(imesa, flag) \ diff --git a/src/mesa/drivers/dri/i810/i810screen.c b/src/mesa/drivers/dri/i810/i810screen.c index 2f6b8631ff..2a30782afd 100644 --- a/src/mesa/drivers/dri/i810/i810screen.c +++ b/src/mesa/drivers/dri/i810/i810screen.c @@ -54,7 +54,7 @@ SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. #include "GL/internal/dri_interface.h" static const __DRIconfig ** -i810FillInModes( __DRIscreenPrivate *psp, +i810FillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -255,7 +255,7 @@ i810InitScreen(__DRIscreen *sPriv) } static void -i810DestroyScreen(__DRIscreenPrivate *sPriv) +i810DestroyScreen(__DRIscreen *sPriv) { i810ScreenPrivate *i810Screen = (i810ScreenPrivate *)sPriv->private; @@ -274,8 +274,8 @@ i810DestroyScreen(__DRIscreenPrivate *sPriv) * Create a buffer which corresponds to the window. */ static GLboolean -i810CreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +i810CreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -335,7 +335,7 @@ i810CreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -i810DestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +i810DestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } @@ -356,3 +356,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/i810/i810screen.h b/src/mesa/drivers/dri/i810/i810screen.h index b29937665a..734e2fb002 100644 --- a/src/mesa/drivers/dri/i810/i810screen.h +++ b/src/mesa/drivers/dri/i810/i810screen.h @@ -71,7 +71,7 @@ typedef struct { int textureSize; int logTextureGranularity; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; drmBufMapPtr bufs; unsigned int sarea_priv_offset; } i810ScreenPrivate; @@ -79,21 +79,21 @@ typedef struct { extern GLboolean i810CreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ); extern void -i810DestroyContext(__DRIcontextPrivate *driContextPriv); +i810DestroyContext(__DRIcontext *driContextPriv); extern GLboolean -i810UnbindContext(__DRIcontextPrivate *driContextPriv); +i810UnbindContext(__DRIcontext *driContextPriv); extern GLboolean -i810MakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv); +i810MakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv); extern void -i810SwapBuffers(__DRIdrawablePrivate *driDrawPriv); +i810SwapBuffers(__DRIdrawable *driDrawPriv); #endif diff --git a/src/mesa/drivers/dri/i810/i810span.c b/src/mesa/drivers/dri/i810/i810span.c index 510723f445..6576f6745e 100644 --- a/src/mesa/drivers/dri/i810/i810span.c +++ b/src/mesa/drivers/dri/i810/i810span.c @@ -15,7 +15,7 @@ #define LOCAL_VARS \ i810ContextPtr imesa = I810_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = imesa->driDrawable; \ + __DRIdrawable *dPriv = imesa->driDrawable; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ @@ -27,7 +27,7 @@ #define LOCAL_DEPTH_VARS \ i810ContextPtr imesa = I810_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = imesa->driDrawable; \ + __DRIdrawable *dPriv = imesa->driDrawable; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ diff --git a/src/mesa/drivers/dri/i810/i810state.c b/src/mesa/drivers/dri/i810/i810state.c index 1e7a6cfe47..642245c61c 100644 --- a/src/mesa/drivers/dri/i810/i810state.c +++ b/src/mesa/drivers/dri/i810/i810state.c @@ -641,7 +641,7 @@ static void i810Enable(GLcontext *ctx, GLenum cap, GLboolean state) void i810EmitDrawingRectangle( i810ContextPtr imesa ) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; + __DRIdrawable *dPriv = imesa->driDrawable; i810ScreenPrivate *i810Screen = imesa->i810Screen; int x0 = imesa->drawX; int y0 = imesa->drawY; diff --git a/src/mesa/drivers/dri/i810/i810tex.c b/src/mesa/drivers/dri/i810/i810tex.c index 2f6978f5aa..e764644a6c 100644 --- a/src/mesa/drivers/dri/i810/i810tex.c +++ b/src/mesa/drivers/dri/i810/i810tex.c @@ -210,7 +210,7 @@ i810AllocTexObj( GLcontext *ctx, struct gl_texture_object *texObj ) i810SetTexWrapping( t, texObj->WrapS, texObj->WrapT ); /*i830SetTexMaxAnisotropy( t, texObj->MaxAnisotropy );*/ i810SetTexFilter( imesa, t, texObj->MinFilter, texObj->MagFilter, bias ); - i810SetTexBorderColor( t, texObj->BorderColor ); + i810SetTexBorderColor( t, texObj->BorderColor.f ); } return t; @@ -251,7 +251,7 @@ static void i810TexParameter( GLcontext *ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - i810SetTexBorderColor( t, tObj->BorderColor ); + i810SetTexBorderColor( t, tObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: diff --git a/src/mesa/drivers/dri/i810/i810tex.h b/src/mesa/drivers/dri/i810/i810tex.h index d980927030..28958dcb4b 100644 --- a/src/mesa/drivers/dri/i810/i810tex.h +++ b/src/mesa/drivers/dri/i810/i810tex.h @@ -29,7 +29,6 @@ #include "main/mtypes.h" #include "main/mm.h" -#include "i810context.h" #include "i810_3d_reg.h" #include "texmem.h" diff --git a/src/mesa/drivers/dri/i915/Makefile b/src/mesa/drivers/dri/i915/Makefile index 37f15aa767..cf32476f40 100644 --- a/src/mesa/drivers/dri/i915/Makefile +++ b/src/mesa/drivers/dri/i915/Makefile @@ -34,7 +34,6 @@ DRIVER_SOURCES = \ intel_pixel_read.c \ intel_buffers.c \ intel_blit.c \ - intel_swapbuffers.c \ i915_tex_layout.c \ i915_texstate.c \ i915_context.c \ @@ -64,7 +63,8 @@ DRIVER_DEFINES = -I../intel -I../intel/server -DI915 \ $(shell pkg-config libdrm --atleast-version=2.3.1 \ && echo "-DDRM_VBLANK_FLIP=DRM_VBLANK_FLIP") -DRI_LIB_DEPS += -ldrm_intel +INCLUDES += $(INTEL_CFLAGS) +DRI_LIB_DEPS += $(INTEL_LIBS) include ../Makefile.template diff --git a/src/mesa/drivers/dri/i915/i830_context.c b/src/mesa/drivers/dri/i915/i830_context.c index 840946f908..4cb6305988 100644 --- a/src/mesa/drivers/dri/i915/i830_context.c +++ b/src/mesa/drivers/dri/i915/i830_context.c @@ -53,7 +53,7 @@ extern const struct tnl_pipeline_stage *intel_pipeline[]; GLboolean i830CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { struct dd_function_table functions; diff --git a/src/mesa/drivers/dri/i915/i830_context.h b/src/mesa/drivers/dri/i915/i830_context.h index f73cbbf88b..592ae53976 100644 --- a/src/mesa/drivers/dri/i915/i830_context.h +++ b/src/mesa/drivers/dri/i915/i830_context.h @@ -178,7 +178,7 @@ i830_state_draw_region(struct intel_context *intel, */ extern GLboolean i830CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); /* i830_tex.c, i830_texstate.c diff --git a/src/mesa/drivers/dri/i915/i830_texstate.c b/src/mesa/drivers/dri/i915/i830_texstate.c index 27c5aa1e08..7525f9f2e0 100644 --- a/src/mesa/drivers/dri/i915/i830_texstate.c +++ b/src/mesa/drivers/dri/i915/i830_texstate.c @@ -304,10 +304,10 @@ i830_update_tex_unit(struct intel_context *intel, GLuint unit, GLuint ss3) } /* convert border color from float to ubyte */ - CLAMPED_FLOAT_TO_UBYTE(border[0], tObj->BorderColor[0]); - CLAMPED_FLOAT_TO_UBYTE(border[1], tObj->BorderColor[1]); - CLAMPED_FLOAT_TO_UBYTE(border[2], tObj->BorderColor[2]); - CLAMPED_FLOAT_TO_UBYTE(border[3], tObj->BorderColor[3]); + CLAMPED_FLOAT_TO_UBYTE(border[0], tObj->BorderColor.f[0]); + CLAMPED_FLOAT_TO_UBYTE(border[1], tObj->BorderColor.f[1]); + CLAMPED_FLOAT_TO_UBYTE(border[2], tObj->BorderColor.f[2]); + CLAMPED_FLOAT_TO_UBYTE(border[3], tObj->BorderColor.f[3]); state[I830_TEXREG_TM0S4] = PACK_COLOR_8888(border[3], border[0], diff --git a/src/mesa/drivers/dri/i915/i830_vtbl.c b/src/mesa/drivers/dri/i915/i830_vtbl.c index 1e3c8301d8..4471ca2bbb 100644 --- a/src/mesa/drivers/dri/i915/i830_vtbl.c +++ b/src/mesa/drivers/dri/i915/i830_vtbl.c @@ -298,7 +298,7 @@ i830_emit_invarient_state(struct intel_context *intel) { BATCH_LOCALS; - BEGIN_BATCH(29, IGNORE_CLIPRECTS); + BEGIN_BATCH(29); OUT_BATCH(_3DSTATE_DFLT_DIFFUSE_CMD); OUT_BATCH(0); @@ -366,7 +366,7 @@ i830_emit_invarient_state(struct intel_context *intel) #define emit( intel, state, size ) \ - intel_batchbuffer_data(intel->batch, state, size, IGNORE_CLIPRECTS ) + intel_batchbuffer_data(intel->batch, state, size ) static GLuint get_dirty(struct i830_hw_state *state) @@ -429,13 +429,9 @@ i830_emit_state(struct intel_context *intel) * It might be better to talk about explicit places where * scheduling is allowed, rather than assume that it is whenever a * batchbuffer fills up. - * - * Set the space as LOOP_CLIPRECTS now, since that's what our primitives - * will be emitted under. */ intel_batchbuffer_require_space(intel->batch, - get_state_size(state) + INTEL_PRIM_EMIT_SIZE, - LOOP_CLIPRECTS); + get_state_size(state) + INTEL_PRIM_EMIT_SIZE); count = 0; again: aper_count = 0; @@ -491,17 +487,14 @@ i830_emit_state(struct intel_context *intel) } if (dirty & I830_UPLOAD_BUFFERS) { - GLuint count = 9; + GLuint count = 15; DBG("I830_UPLOAD_BUFFERS:\n"); if (state->depth_region) count += 3; - if (intel->constant_cliprect) - count += 6; - - BEGIN_BATCH(count, IGNORE_CLIPRECTS); + BEGIN_BATCH(count); OUT_BATCH(state->Buffer[I830_DESTREG_CBUFADDR0]); OUT_BATCH(state->Buffer[I830_DESTREG_CBUFADDR1]); OUT_RELOC(state->draw_region->buffer, @@ -523,15 +516,13 @@ i830_emit_state(struct intel_context *intel) OUT_BATCH(state->Buffer[I830_DESTREG_SR1]); OUT_BATCH(state->Buffer[I830_DESTREG_SR2]); - if (intel->constant_cliprect) { - assert(state->Buffer[I830_DESTREG_DRAWRECT0] != MI_NOOP); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT0]); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT1]); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT2]); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT3]); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT4]); - OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT5]); - } + assert(state->Buffer[I830_DESTREG_DRAWRECT0] != MI_NOOP); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT0]); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT1]); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT2]); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT3]); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT4]); + OUT_BATCH(state->Buffer[I830_DESTREG_DRAWRECT5]); ADVANCE_BATCH(); } @@ -544,7 +535,7 @@ i830_emit_state(struct intel_context *intel) if ((dirty & I830_UPLOAD_TEX(i))) { DBG("I830_UPLOAD_TEX(%d):\n", i); - BEGIN_BATCH(I830_TEX_SETUP_SIZE + 1, IGNORE_CLIPRECTS); + BEGIN_BATCH(I830_TEX_SETUP_SIZE + 1); OUT_BATCH(state->Tex[i][I830_TEXREG_TM0LI]); if (state->tex_buffer[i]) { @@ -673,23 +664,14 @@ i830_state_draw_region(struct intel_context *intel, } state->Buffer[I830_DESTREG_DV1] = value; - if (intel->constant_cliprect) { - state->Buffer[I830_DESTREG_DRAWRECT0] = _3DSTATE_DRAWRECT_INFO; - state->Buffer[I830_DESTREG_DRAWRECT1] = 0; - state->Buffer[I830_DESTREG_DRAWRECT2] = 0; /* xmin, ymin */ - state->Buffer[I830_DESTREG_DRAWRECT3] = - (ctx->DrawBuffer->Width & 0xffff) | - (ctx->DrawBuffer->Height << 16); - state->Buffer[I830_DESTREG_DRAWRECT4] = 0; /* xoff, yoff */ - state->Buffer[I830_DESTREG_DRAWRECT5] = 0; - } else { - state->Buffer[I830_DESTREG_DRAWRECT0] = MI_NOOP; - state->Buffer[I830_DESTREG_DRAWRECT1] = MI_NOOP; - state->Buffer[I830_DESTREG_DRAWRECT2] = MI_NOOP; - state->Buffer[I830_DESTREG_DRAWRECT3] = MI_NOOP; - state->Buffer[I830_DESTREG_DRAWRECT4] = MI_NOOP; - state->Buffer[I830_DESTREG_DRAWRECT5] = MI_NOOP; - } + state->Buffer[I830_DESTREG_DRAWRECT0] = _3DSTATE_DRAWRECT_INFO; + state->Buffer[I830_DESTREG_DRAWRECT1] = 0; + state->Buffer[I830_DESTREG_DRAWRECT2] = 0; /* xmin, ymin */ + state->Buffer[I830_DESTREG_DRAWRECT3] = + (ctx->DrawBuffer->Width & 0xffff) | + (ctx->DrawBuffer->Height << 16); + state->Buffer[I830_DESTREG_DRAWRECT4] = 0; /* xoff, yoff */ + state->Buffer[I830_DESTREG_DRAWRECT5] = 0; I830_STATECHANGE(i830, I830_UPLOAD_BUFFERS); diff --git a/src/mesa/drivers/dri/i915/i915_context.c b/src/mesa/drivers/dri/i915/i915_context.c index 0485be2cc1..7c7711da09 100644 --- a/src/mesa/drivers/dri/i915/i915_context.c +++ b/src/mesa/drivers/dri/i915/i915_context.c @@ -100,7 +100,7 @@ extern const struct tnl_pipeline_stage *intel_pipeline[]; GLboolean i915CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { struct dd_function_table functions; diff --git a/src/mesa/drivers/dri/i915/i915_context.h b/src/mesa/drivers/dri/i915/i915_context.h index 25418d5f7a..f55b551139 100644 --- a/src/mesa/drivers/dri/i915/i915_context.h +++ b/src/mesa/drivers/dri/i915/i915_context.h @@ -318,7 +318,7 @@ do { \ * i915_context.c */ extern GLboolean i915CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); diff --git a/src/mesa/drivers/dri/i915/i915_texstate.c b/src/mesa/drivers/dri/i915/i915_texstate.c index 221bf03332..3ee4c8653a 100644 --- a/src/mesa/drivers/dri/i915/i915_texstate.c +++ b/src/mesa/drivers/dri/i915/i915_texstate.c @@ -197,10 +197,11 @@ i915_update_tex_unit(struct intel_context *intel, GLuint unit, GLuint ss3) state[I915_TEXREG_MS3] |= MS3_TILE_WALK; } - /* We get one field with fraction bits to cover the maximum addressable (smallest - * resolution) LOD. Use it to cover both MAX_LEVEL and MAX_LOD. + /* We get one field with fraction bits for the maximum addressable + * (lowest resolution) LOD. Use it to cover both MAX_LEVEL and + * MAX_LOD. */ - maxlod = MIN2(tObj->MaxLod, tObj->MaxLevel - tObj->BaseLevel); + maxlod = MIN2(tObj->MaxLod, tObj->_MaxLevel - tObj->BaseLevel); state[I915_TEXREG_MS4] = ((((pitch / 4) - 1) << MS4_PITCH_SHIFT) | MS4_CUBE_FACE_ENA_MASK | @@ -347,10 +348,10 @@ i915_update_tex_unit(struct intel_context *intel, GLuint unit, GLuint ss3) } /* convert border color from float to ubyte */ - CLAMPED_FLOAT_TO_UBYTE(border[0], tObj->BorderColor[0]); - CLAMPED_FLOAT_TO_UBYTE(border[1], tObj->BorderColor[1]); - CLAMPED_FLOAT_TO_UBYTE(border[2], tObj->BorderColor[2]); - CLAMPED_FLOAT_TO_UBYTE(border[3], tObj->BorderColor[3]); + CLAMPED_FLOAT_TO_UBYTE(border[0], tObj->BorderColor.f[0]); + CLAMPED_FLOAT_TO_UBYTE(border[1], tObj->BorderColor.f[1]); + CLAMPED_FLOAT_TO_UBYTE(border[2], tObj->BorderColor.f[2]); + CLAMPED_FLOAT_TO_UBYTE(border[3], tObj->BorderColor.f[3]); if (firstImage->_BaseFormat == GL_DEPTH_COMPONENT) { /* GL specs that border color for depth textures is taken from the diff --git a/src/mesa/drivers/dri/i915/i915_vtbl.c b/src/mesa/drivers/dri/i915/i915_vtbl.c index 9f7635a953..266e6848c3 100644 --- a/src/mesa/drivers/dri/i915/i915_vtbl.c +++ b/src/mesa/drivers/dri/i915/i915_vtbl.c @@ -174,7 +174,7 @@ i915_emit_invarient_state(struct intel_context *intel) { BATCH_LOCALS; - BEGIN_BATCH(17, IGNORE_CLIPRECTS); + BEGIN_BATCH(17); OUT_BATCH(_3DSTATE_AA_CMD | AA_LINE_ECAAR_WIDTH_ENABLE | @@ -220,7 +220,7 @@ i915_emit_invarient_state(struct intel_context *intel) #define emit(intel, state, size ) \ - intel_batchbuffer_data(intel->batch, state, size, IGNORE_CLIPRECTS ) + intel_batchbuffer_data(intel->batch, state, size) static GLuint get_dirty(struct i915_hw_state *state) @@ -301,13 +301,9 @@ i915_emit_state(struct intel_context *intel) * It might be better to talk about explicit places where * scheduling is allowed, rather than assume that it is whenever a * batchbuffer fills up. - * - * Set the space as LOOP_CLIPRECTS now, since that's what our primitives - * will be emitted under. */ intel_batchbuffer_require_space(intel->batch, - get_state_size(state) + INTEL_PRIM_EMIT_SIZE, - LOOP_CLIPRECTS); + get_state_size(state) + INTEL_PRIM_EMIT_SIZE); count = 0; again: aper_count = 0; @@ -373,7 +369,7 @@ i915_emit_state(struct intel_context *intel) } if (dirty & I915_UPLOAD_BUFFERS) { - GLuint count = 9; + GLuint count = 15; if (INTEL_DEBUG & DEBUG_STATE) fprintf(stderr, "I915_UPLOAD_BUFFERS:\n"); @@ -381,10 +377,7 @@ i915_emit_state(struct intel_context *intel) if (state->depth_region) count += 3; - if (intel->constant_cliprect) - count += 6; - - BEGIN_BATCH(count, IGNORE_CLIPRECTS); + BEGIN_BATCH(count); OUT_BATCH(state->Buffer[I915_DESTREG_CBUFADDR0]); OUT_BATCH(state->Buffer[I915_DESTREG_CBUFADDR1]); OUT_RELOC(state->draw_region->buffer, @@ -406,15 +399,13 @@ i915_emit_state(struct intel_context *intel) OUT_BATCH(state->Buffer[I915_DESTREG_SR1]); OUT_BATCH(state->Buffer[I915_DESTREG_SR2]); - if (intel->constant_cliprect) { - assert(state->Buffer[I915_DESTREG_DRAWRECT0] != MI_NOOP); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT0]); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT1]); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT2]); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT3]); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT4]); - OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT5]); - } + assert(state->Buffer[I915_DESTREG_DRAWRECT0] != MI_NOOP); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT0]); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT1]); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT2]); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT3]); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT4]); + OUT_BATCH(state->Buffer[I915_DESTREG_DRAWRECT5]); ADVANCE_BATCH(); } @@ -441,7 +432,7 @@ i915_emit_state(struct intel_context *intel) if (dirty & I915_UPLOAD_TEX(i)) nr++; - BEGIN_BATCH(2 + nr * 3, IGNORE_CLIPRECTS); + BEGIN_BATCH(2 + nr * 3); OUT_BATCH(_3DSTATE_MAP_STATE | (3 * nr)); OUT_BATCH((dirty & I915_UPLOAD_TEX_ALL) >> I915_UPLOAD_TEX_0_SHIFT); for (i = 0; i < I915_TEX_UNITS; i++) @@ -465,7 +456,7 @@ i915_emit_state(struct intel_context *intel) } ADVANCE_BATCH(); - BEGIN_BATCH(2 + nr * 3, IGNORE_CLIPRECTS); + BEGIN_BATCH(2 + nr * 3); OUT_BATCH(_3DSTATE_SAMPLER_STATE | (3 * nr)); OUT_BATCH((dirty & I915_UPLOAD_TEX_ALL) >> I915_UPLOAD_TEX_0_SHIFT); for (i = 0; i < I915_TEX_UNITS; i++) @@ -623,23 +614,14 @@ i915_state_draw_region(struct intel_context *intel, } state->Buffer[I915_DESTREG_DV1] = value; - if (intel->constant_cliprect) { - state->Buffer[I915_DESTREG_DRAWRECT0] = _3DSTATE_DRAWRECT_INFO; - state->Buffer[I915_DESTREG_DRAWRECT1] = 0; - state->Buffer[I915_DESTREG_DRAWRECT2] = 0; /* xmin, ymin */ - state->Buffer[I915_DESTREG_DRAWRECT3] = - (ctx->DrawBuffer->Width & 0xffff) | - (ctx->DrawBuffer->Height << 16); - state->Buffer[I915_DESTREG_DRAWRECT4] = 0; /* xoff, yoff */ - state->Buffer[I915_DESTREG_DRAWRECT5] = 0; - } else { - state->Buffer[I915_DESTREG_DRAWRECT0] = MI_NOOP; - state->Buffer[I915_DESTREG_DRAWRECT1] = MI_NOOP; - state->Buffer[I915_DESTREG_DRAWRECT2] = MI_NOOP; - state->Buffer[I915_DESTREG_DRAWRECT3] = MI_NOOP; - state->Buffer[I915_DESTREG_DRAWRECT4] = MI_NOOP; - state->Buffer[I915_DESTREG_DRAWRECT5] = MI_NOOP; - } + state->Buffer[I915_DESTREG_DRAWRECT0] = _3DSTATE_DRAWRECT_INFO; + state->Buffer[I915_DESTREG_DRAWRECT1] = 0; + state->Buffer[I915_DESTREG_DRAWRECT2] = 0; /* xmin, ymin */ + state->Buffer[I915_DESTREG_DRAWRECT3] = + (ctx->DrawBuffer->Width & 0xffff) | + (ctx->DrawBuffer->Height << 16); + state->Buffer[I915_DESTREG_DRAWRECT4] = 0; /* xoff, yoff */ + state->Buffer[I915_DESTREG_DRAWRECT5] = 0; I915_STATECHANGE(i915, I915_UPLOAD_BUFFERS); } diff --git a/src/mesa/drivers/dri/i915/intel_swapbuffers.c b/src/mesa/drivers/dri/i915/intel_swapbuffers.c deleted file mode 120000 index 148d5215aa..0000000000 --- a/src/mesa/drivers/dri/i915/intel_swapbuffers.c +++ /dev/null @@ -1 +0,0 @@ -../intel/intel_swapbuffers.c
\ No newline at end of file diff --git a/src/mesa/drivers/dri/i915/intel_tris.c b/src/mesa/drivers/dri/i915/intel_tris.c index 63c5ae96dc..e99baf8e0e 100644 --- a/src/mesa/drivers/dri/i915/intel_tris.c +++ b/src/mesa/drivers/dri/i915/intel_tris.c @@ -89,7 +89,6 @@ intel_flush_inline_primitive(struct intel_context *intel) static void intel_start_inline(struct intel_context *intel, uint32_t prim) { - uint32_t batch_flags = LOOP_CLIPRECTS; BATCH_LOCALS; intel->vtbl.emit_state(intel); @@ -101,7 +100,7 @@ static void intel_start_inline(struct intel_context *intel, uint32_t prim) /* Emit a slot which will be filled with the inline primitive * command later. */ - BEGIN_BATCH(2, batch_flags); + BEGIN_BATCH(2); OUT_BATCH(0); assert((intel->batch->dirty_state & (1<<1)) == 0); @@ -252,7 +251,7 @@ void intel_flush_prim(struct intel_context *intel) #endif if (intel->gen >= 3) { - BEGIN_BATCH(5, LOOP_CLIPRECTS); + BEGIN_BATCH(5); OUT_BATCH(_3DSTATE_LOAD_STATE_IMMEDIATE_1 | I1_LOAD_S(0) | I1_LOAD_S(1) | 1); assert((offset & !S0_VB_OFFSET_MASK) == 0); @@ -270,7 +269,7 @@ void intel_flush_prim(struct intel_context *intel) } else { struct i830_context *i830 = i830_context(&intel->ctx); - BEGIN_BATCH(5, LOOP_CLIPRECTS); + BEGIN_BATCH(5); OUT_BATCH(_3DSTATE_LOAD_STATE_IMMEDIATE_1 | I1_LOAD_S(0) | I1_LOAD_S(2) | 1); /* S0 */ diff --git a/src/mesa/drivers/dri/i965/Makefile b/src/mesa/drivers/dri/i965/Makefile index 7a55333e89..7758a792fd 100644 --- a/src/mesa/drivers/dri/i965/Makefile +++ b/src/mesa/drivers/dri/i965/Makefile @@ -24,7 +24,6 @@ DRIVER_SOURCES = \ intel_pixel_draw.c \ intel_pixel_read.c \ intel_state.c \ - intel_swapbuffers.c \ intel_syncobj.c \ intel_tex.c \ intel_tex_copy.c \ @@ -96,7 +95,8 @@ ASM_SOURCES = DRIVER_DEFINES = -I../intel -I../intel/server -DRI_LIB_DEPS += -ldrm_intel +INCLUDES += $(INTEL_CFLAGS) +DRI_LIB_DEPS += $(INTEL_LIBS) include ../Makefile.template diff --git a/src/mesa/drivers/dri/i965/brw_context.c b/src/mesa/drivers/dri/i965/brw_context.c index d8af2c512b..7bb15956b5 100644 --- a/src/mesa/drivers/dri/i965/brw_context.c +++ b/src/mesa/drivers/dri/i965/brw_context.c @@ -77,7 +77,7 @@ static void brwInitDriverFunctions( struct dd_function_table *functions ) } GLboolean brwCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { struct dd_function_table functions; diff --git a/src/mesa/drivers/dri/i965/brw_context.h b/src/mesa/drivers/dri/i965/brw_context.h index ea5503e2fe..0dd3087143 100644 --- a/src/mesa/drivers/dri/i965/brw_context.h +++ b/src/mesa/drivers/dri/i965/brw_context.h @@ -679,7 +679,7 @@ void brwInitVtbl( struct brw_context *brw ); * brw_context.c */ GLboolean brwCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate); /*====================================================================== diff --git a/src/mesa/drivers/dri/i965/brw_curbe.c b/src/mesa/drivers/dri/i965/brw_curbe.c index aadcfbe2da..190310afbb 100644 --- a/src/mesa/drivers/dri/i965/brw_curbe.c +++ b/src/mesa/drivers/dri/i965/brw_curbe.c @@ -340,7 +340,7 @@ static void emit_constant_buffer(struct brw_context *brw) struct intel_context *intel = &brw->intel; GLuint sz = brw->curbe.total_size; - BEGIN_BATCH(2, IGNORE_CLIPRECTS); + BEGIN_BATCH(2); if (sz == 0) { OUT_BATCH((CMD_CONST_BUFFER << 16) | (2 - 2)); OUT_BATCH(0); diff --git a/src/mesa/drivers/dri/i965/brw_draw.c b/src/mesa/drivers/dri/i965/brw_draw.c index 7ad860898f..df281b27d5 100644 --- a/src/mesa/drivers/dri/i965/brw_draw.c +++ b/src/mesa/drivers/dri/i965/brw_draw.c @@ -157,7 +157,7 @@ static void brw_emit_prim(struct brw_context *brw, } if (prim_packet.verts_per_instance) { intel_batchbuffer_data( brw->intel.batch, &prim_packet, - sizeof(prim_packet), LOOP_CLIPRECTS); + sizeof(prim_packet)); } if (intel->always_flush_cache) { intel_batchbuffer_emit_mi_flush(intel->batch); @@ -339,13 +339,6 @@ static GLboolean brw_try_draw_prims( GLcontext *ctx, * so can't access it earlier. */ - LOCK_HARDWARE(intel); - - if (!intel->constant_cliprect && intel->driDrawable->numClipRects == 0) { - UNLOCK_HARDWARE(intel); - return GL_TRUE; - } - for (i = 0; i < nr_prims; i++) { uint32_t hw_prim; @@ -356,8 +349,7 @@ static GLboolean brw_try_draw_prims( GLcontext *ctx, * an upper bound of how much we might emit in a single * brw_try_draw_prims(). */ - intel_batchbuffer_require_space(intel->batch, intel->batch->size / 4, - LOOP_CLIPRECTS); + intel_batchbuffer_require_space(intel->batch, intel->batch->size / 4); hw_prim = brw_set_prim(brw, prim[i].mode); @@ -404,7 +396,6 @@ static GLboolean brw_try_draw_prims( GLcontext *ctx, if (intel->always_flush_batch) intel_batchbuffer_flush(intel->batch); out: - UNLOCK_HARDWARE(intel); brw_state_cache_check_size(brw); diff --git a/src/mesa/drivers/dri/i965/brw_draw_upload.c b/src/mesa/drivers/dri/i965/brw_draw_upload.c index 2c9902c90f..c773b71507 100644 --- a/src/mesa/drivers/dri/i965/brw_draw_upload.c +++ b/src/mesa/drivers/dri/i965/brw_draw_upload.c @@ -494,7 +494,7 @@ static void brw_emit_vertices(struct brw_context *brw) * a VE loads from them. */ if (brw->vb.nr_enabled == 0) { - BEGIN_BATCH(3, IGNORE_CLIPRECTS); + BEGIN_BATCH(3); OUT_BATCH((CMD_VERTEX_ELEMENT << 16) | 1); OUT_BATCH((0 << BRW_VE0_INDEX_SHIFT) | BRW_VE0_VALID | @@ -514,7 +514,7 @@ static void brw_emit_vertices(struct brw_context *brw) * are interleaved or from the same VBO. TBD if this makes a * performance difference. */ - BEGIN_BATCH(1 + brw->vb.nr_enabled * 4, IGNORE_CLIPRECTS); + BEGIN_BATCH(1 + brw->vb.nr_enabled * 4); OUT_BATCH((CMD_VERTEX_BUFFER << 16) | ((1 + brw->vb.nr_enabled * 4) - 2)); @@ -537,7 +537,7 @@ static void brw_emit_vertices(struct brw_context *brw) } ADVANCE_BATCH(); - BEGIN_BATCH(1 + brw->vb.nr_enabled * 2, IGNORE_CLIPRECTS); + BEGIN_BATCH(1 + brw->vb.nr_enabled * 2); OUT_BATCH((CMD_VERTEX_ELEMENT << 16) | ((1 + brw->vb.nr_enabled * 2) - 2)); for (i = 0; i < brw->vb.nr_enabled; i++) { struct brw_vertex_element *input = brw->vb.enabled[i]; @@ -704,7 +704,7 @@ static void brw_emit_index_buffer(struct brw_context *brw) ib.header.bits.index_format = get_index_type(index_buffer->type); ib.header.bits.cut_index_enable = 0; - BEGIN_BATCH(4, IGNORE_CLIPRECTS); + BEGIN_BATCH(4); OUT_BATCH( ib.header.dword ); OUT_RELOC(brw->ib.bo, I915_GEM_DOMAIN_VERTEX, 0, diff --git a/src/mesa/drivers/dri/i965/brw_misc_state.c b/src/mesa/drivers/dri/i965/brw_misc_state.c index d437b1e030..7b70f787b7 100644 --- a/src/mesa/drivers/dri/i965/brw_misc_state.c +++ b/src/mesa/drivers/dri/i965/brw_misc_state.c @@ -78,10 +78,7 @@ static void upload_drawing_rect(struct brw_context *brw) struct intel_context *intel = &brw->intel; GLcontext *ctx = &intel->ctx; - if (!intel->constant_cliprect) - return; - - BEGIN_BATCH(4, NO_LOOP_CLIPRECTS); + BEGIN_BATCH(4); OUT_BATCH(_3DSTATE_DRAWRECT_INFO_I965); OUT_BATCH(0); /* xmin, ymin */ OUT_BATCH(((ctx->DrawBuffer->Width - 1) & 0xffff) | @@ -116,7 +113,7 @@ static void upload_binding_table_pointers(struct brw_context *brw) { struct intel_context *intel = &brw->intel; - BEGIN_BATCH(6, IGNORE_CLIPRECTS); + BEGIN_BATCH(6); OUT_BATCH(CMD_BINDING_TABLE_PTRS << 16 | (6 - 2)); if (brw->vs.bind_bo != NULL) OUT_RELOC(brw->vs.bind_bo, I915_GEM_DOMAIN_SAMPLER, 0, 0); /* vs */ @@ -150,7 +147,7 @@ static void upload_pipelined_state_pointers(struct brw_context *brw ) { struct intel_context *intel = &brw->intel; - BEGIN_BATCH(7, IGNORE_CLIPRECTS); + BEGIN_BATCH(7); OUT_BATCH(CMD_PIPELINED_STATE_POINTERS << 16 | (7 - 2)); OUT_RELOC(brw->vs.state_bo, I915_GEM_DOMAIN_INSTRUCTION, 0, 0); if (brw->gs.prog_active) @@ -215,7 +212,7 @@ static void emit_depthbuffer(struct brw_context *brw) unsigned int len = (intel->is_g4x || intel->is_ironlake) ? 6 : 5; if (region == NULL) { - BEGIN_BATCH(len, IGNORE_CLIPRECTS); + BEGIN_BATCH(len); OUT_BATCH(CMD_DEPTH_BUFFER << 16 | (len - 2)); OUT_BATCH((BRW_DEPTHFORMAT_D32_FLOAT << 18) | (BRW_SURFACE_NULL << 29)); @@ -247,7 +244,7 @@ static void emit_depthbuffer(struct brw_context *brw) assert(region->tiling != I915_TILING_X); - BEGIN_BATCH(len, IGNORE_CLIPRECTS); + BEGIN_BATCH(len); OUT_BATCH(CMD_DEPTH_BUFFER << 16 | (len - 2)); OUT_BATCH(((region->pitch * region->cpp) - 1) | (format << 18) | @@ -330,7 +327,7 @@ const struct brw_tracked_state brw_polygon_stipple = { static void upload_polygon_stipple_offset(struct brw_context *brw) { - __DRIdrawablePrivate *dPriv = brw->intel.driDrawable; + __DRIdrawable *dPriv = brw->intel.driDrawable; struct brw_polygon_stipple_offset bpso; memset(&bpso, 0, sizeof(bpso)); @@ -513,7 +510,7 @@ static void upload_state_base_address( struct brw_context *brw ) * batchbuffer, so we can emit relocations inline. */ if (intel->is_ironlake) { - BEGIN_BATCH(8, IGNORE_CLIPRECTS); + BEGIN_BATCH(8); OUT_BATCH(CMD_STATE_BASE_ADDRESS << 16 | (8 - 2)); OUT_BATCH(1); /* General state base address */ OUT_BATCH(1); /* Surface state base address */ @@ -524,7 +521,7 @@ static void upload_state_base_address( struct brw_context *brw ) OUT_BATCH(1); /* Instruction access upper bound */ ADVANCE_BATCH(); } else { - BEGIN_BATCH(6, IGNORE_CLIPRECTS); + BEGIN_BATCH(6); OUT_BATCH(CMD_STATE_BASE_ADDRESS << 16 | (6 - 2)); OUT_BATCH(1); /* General state base address */ OUT_BATCH(1); /* Surface state base address */ diff --git a/src/mesa/drivers/dri/i965/brw_queryobj.c b/src/mesa/drivers/dri/i965/brw_queryobj.c index a195bc32b0..5399a74244 100644 --- a/src/mesa/drivers/dri/i965/brw_queryobj.c +++ b/src/mesa/drivers/dri/i965/brw_queryobj.c @@ -188,7 +188,7 @@ brw_emit_query_begin(struct brw_context *brw) if (brw->query.active || is_empty_list(&brw->query.active_head)) return; - BEGIN_BATCH(4, IGNORE_CLIPRECTS); + BEGIN_BATCH(4); OUT_BATCH(_3DSTATE_PIPE_CONTROL | PIPE_CONTROL_DEPTH_STALL | PIPE_CONTROL_WRITE_DEPTH_COUNT); @@ -227,7 +227,7 @@ brw_emit_query_end(struct brw_context *brw) if (!brw->query.active) return; - BEGIN_BATCH(4, IGNORE_CLIPRECTS); + BEGIN_BATCH(4); OUT_BATCH(_3DSTATE_PIPE_CONTROL | PIPE_CONTROL_DEPTH_STALL | PIPE_CONTROL_WRITE_DEPTH_COUNT); diff --git a/src/mesa/drivers/dri/i965/brw_state.h b/src/mesa/drivers/dri/i965/brw_state.h index 14d5319796..9c9d145c4b 100644 --- a/src/mesa/drivers/dri/i965/brw_state.h +++ b/src/mesa/drivers/dri/i965/brw_state.h @@ -151,7 +151,7 @@ void brw_state_cache_bo_delete(struct brw_cache *cache, dri_bo *bo); /*********************************************************************** * brw_state_batch.c */ -#define BRW_BATCH_STRUCT(brw, s) intel_batchbuffer_data( brw->intel.batch, (s), sizeof(*(s)), IGNORE_CLIPRECTS) +#define BRW_BATCH_STRUCT(brw, s) intel_batchbuffer_data( brw->intel.batch, (s), sizeof(*(s))) #define BRW_CACHED_BATCH_STRUCT(brw, s) brw_cached_batch_struct( brw, (s), sizeof(*(s)) ) GLboolean brw_cached_batch_struct( struct brw_context *brw, diff --git a/src/mesa/drivers/dri/i965/brw_state_batch.c b/src/mesa/drivers/dri/i965/brw_state_batch.c index 7821898cf9..ed8120d617 100644 --- a/src/mesa/drivers/dri/i965/brw_state_batch.c +++ b/src/mesa/drivers/dri/i965/brw_state_batch.c @@ -48,7 +48,7 @@ GLboolean brw_cached_batch_struct( struct brw_context *brw, struct header *newheader = (struct header *)data; if (brw->emit_state_always) { - intel_batchbuffer_data(brw->intel.batch, data, sz, IGNORE_CLIPRECTS); + intel_batchbuffer_data(brw->intel.batch, data, sz); return GL_TRUE; } @@ -75,7 +75,7 @@ GLboolean brw_cached_batch_struct( struct brw_context *brw, emit: memcpy(item->header, newheader, sz); - intel_batchbuffer_data(brw->intel.batch, data, sz, IGNORE_CLIPRECTS); + intel_batchbuffer_data(brw->intel.batch, data, sz); return GL_TRUE; } diff --git a/src/mesa/drivers/dri/i965/brw_wm_emit.c b/src/mesa/drivers/dri/i965/brw_wm_emit.c index cc1052f757..f316e0cda4 100644 --- a/src/mesa/drivers/dri/i965/brw_wm_emit.c +++ b/src/mesa/drivers/dri/i965/brw_wm_emit.c @@ -692,7 +692,7 @@ void emit_xpd(struct brw_compile *p, { GLuint i; - assert(!(mask & WRITEMASK_W) == WRITEMASK_X); + assert((mask & WRITEMASK_W) != WRITEMASK_W); for (i = 0 ; i < 3; i++) { if (mask & (1<<i)) { diff --git a/src/mesa/drivers/dri/i965/brw_wm_sampler_state.c b/src/mesa/drivers/dri/i965/brw_wm_sampler_state.c index aa2e519588..ad267a4e6a 100644 --- a/src/mesa/drivers/dri/i965/brw_wm_sampler_state.c +++ b/src/mesa/drivers/dri/i965/brw_wm_sampler_state.c @@ -262,10 +262,10 @@ brw_wm_sampler_populate_key(struct brw_context *brw, dri_bo_unreference(brw->wm.sdc_bo[unit]); if (firstImage->_BaseFormat == GL_DEPTH_COMPONENT) { float bordercolor[4] = { - texObj->BorderColor[0], - texObj->BorderColor[0], - texObj->BorderColor[0], - texObj->BorderColor[0] + texObj->BorderColor.f[0], + texObj->BorderColor.f[0], + texObj->BorderColor.f[0], + texObj->BorderColor.f[0] }; /* GL specs that border color for depth textures is taken from the * R channel, while the hardware uses A. Spam R into all the @@ -274,7 +274,7 @@ brw_wm_sampler_populate_key(struct brw_context *brw, brw->wm.sdc_bo[unit] = upload_default_color(brw, bordercolor); } else { brw->wm.sdc_bo[unit] = upload_default_color(brw, - texObj->BorderColor); + texObj->BorderColor.f); } key->sampler_count = unit + 1; } diff --git a/src/mesa/drivers/dri/i965/brw_wm_surface_state.c b/src/mesa/drivers/dri/i965/brw_wm_surface_state.c index 7aca3aac8e..f26cfabb7d 100644 --- a/src/mesa/drivers/dri/i965/brw_wm_surface_state.c +++ b/src/mesa/drivers/dri/i965/brw_wm_surface_state.c @@ -511,7 +511,8 @@ brw_update_renderbuffer_surface(struct brw_context *brw, struct gl_renderbuffer *rb, unsigned int unit) { - GLcontext *ctx = &brw->intel.ctx; + struct intel_context *intel = &brw->intel;; + GLcontext *ctx = &intel->ctx; dri_bo *region_bo = NULL; struct intel_renderbuffer *irb = intel_renderbuffer(rb); struct intel_region *region = irb ? irb->region : NULL; @@ -522,7 +523,8 @@ brw_update_renderbuffer_surface(struct brw_context *brw, GLubyte color_mask[4]; GLboolean color_blend; uint32_t tiling; - uint32_t draw_offset; + uint32_t draw_x; + uint32_t draw_y; } key; memset(&key, 0, sizeof(key)); @@ -564,7 +566,8 @@ brw_update_renderbuffer_surface(struct brw_context *brw, } key.pitch = region->pitch; key.cpp = region->cpp; - key.draw_offset = region->draw_offset; /* cur 3d or cube face offset */ + key.draw_x = region->draw_x; + key.draw_y = region->draw_y; } else { key.surface_type = BRW_SURFACE_NULL; key.surface_format = BRW_SURFACEFORMAT_B8G8R8A8_UNORM; @@ -572,7 +575,8 @@ brw_update_renderbuffer_surface(struct brw_context *brw, key.width = 1; key.height = 1; key.cpp = 4; - key.draw_offset = 0; + key.draw_x = 0; + key.draw_y = 0; } /* _NEW_COLOR */ memcpy(key.color_mask, ctx->Color.ColorMask[0], @@ -602,26 +606,32 @@ brw_update_renderbuffer_surface(struct brw_context *brw, surf.ss0.surface_format = key.surface_format; surf.ss0.surface_type = key.surface_type; if (key.tiling == I915_TILING_NONE) { - surf.ss1.base_addr = key.draw_offset; + surf.ss1.base_addr = (key.draw_x + key.draw_y * key.pitch) * key.cpp; } else { - uint32_t tile_offset = key.draw_offset % 4096; - - surf.ss1.base_addr = key.draw_offset - tile_offset; + uint32_t tile_base, tile_x, tile_y; + uint32_t pitch = key.pitch * key.cpp; - if (brw->has_surface_tile_offset) { - if (key.tiling == I915_TILING_X) { - /* Note that the low bits of these fields are missing, so - * there's the possibility of getting in trouble. - */ - surf.ss5.x_offset = (tile_offset % 512) / key.cpp / 4; - surf.ss5.y_offset = tile_offset / 512 / 2; - } else { - surf.ss5.x_offset = (tile_offset % 128) / key.cpp / 4; - surf.ss5.y_offset = tile_offset / 128 / 2; - } + if (key.tiling == I915_TILING_X) { + tile_x = key.draw_x % (512 / key.cpp); + tile_y = key.draw_y % 8; + tile_base = ((key.draw_y / 8) * (8 * pitch)); + tile_base += (key.draw_x - tile_x) / (512 / key.cpp) * 4096; } else { - assert(tile_offset == 0); + /* Y */ + tile_x = key.draw_x % (128 / key.cpp); + tile_y = key.draw_y % 32; + tile_base = ((key.draw_y / 32) * (32 * pitch)); + tile_base += (key.draw_x - tile_x) / (128 / key.cpp) * 4096; } + assert(intel->is_g4x || (tile_x == 0 && tile_y == 0)); + assert(tile_x % 4 == 0); + assert(tile_y % 2 == 0); + /* Note that the low bits of these fields are missing, so + * there's the possibility of getting in trouble. + */ + surf.ss1.base_addr = tile_base; + surf.ss5.x_offset = tile_x / 4; + surf.ss5.y_offset = tile_y / 2; } if (region_bo != NULL) surf.ss1.base_addr += region_bo->offset; /* reloc */ diff --git a/src/mesa/drivers/dri/i965/intel_swapbuffers.c b/src/mesa/drivers/dri/i965/intel_swapbuffers.c deleted file mode 120000 index 148d5215aa..0000000000 --- a/src/mesa/drivers/dri/i965/intel_swapbuffers.c +++ /dev/null @@ -1 +0,0 @@ -../intel/intel_swapbuffers.c
\ No newline at end of file diff --git a/src/mesa/drivers/dri/intel/intel_batchbuffer.c b/src/mesa/drivers/dri/intel/intel_batchbuffer.c index 2eae9b66d8..3a4b21a844 100644 --- a/src/mesa/drivers/dri/intel/intel_batchbuffer.c +++ b/src/mesa/drivers/dri/intel/intel_batchbuffer.c @@ -94,7 +94,6 @@ intel_batchbuffer_reset(struct intel_batchbuffer *batch) batch->size = intel->maxBatchSize; batch->ptr = batch->map; batch->dirty_state = ~0; - batch->cliprect_mode = IGNORE_CLIPRECTS; } struct intel_batchbuffer * @@ -129,13 +128,10 @@ intel_batchbuffer_free(struct intel_batchbuffer *batch) /* TODO: Push this whole function into bufmgr. */ static void -do_flush_locked(struct intel_batchbuffer *batch, - GLuint used, GLboolean allow_unlock) +do_flush_locked(struct intel_batchbuffer *batch, GLuint used) { struct intel_context *intel = batch->intel; int ret = 0; - unsigned int num_cliprects = 0; - struct drm_clip_rect *cliprects = NULL; int x_off = 0, y_off = 0; if (batch->buffer) @@ -146,31 +142,7 @@ do_flush_locked(struct intel_batchbuffer *batch, batch->map = NULL; batch->ptr = NULL; - - if (batch->cliprect_mode == LOOP_CLIPRECTS) { - intel_get_cliprects(intel, &cliprects, &num_cliprects, &x_off, &y_off); - } - /* Dispatch the batchbuffer, if it has some effect (nonzero cliprects). - * Can't short-circuit like this once we have hardware contexts, but we - * should always be in DRI2 mode by then anyway. - */ - if ((batch->cliprect_mode != LOOP_CLIPRECTS || - num_cliprects != 0) && !intel->no_hw) { - dri_bo_exec(batch->buf, used, cliprects, num_cliprects, - (x_off & 0xffff) | (y_off << 16)); - } - - if (batch->cliprect_mode == LOOP_CLIPRECTS && num_cliprects == 0) { - if (allow_unlock) { - /* If we are not doing any actual user-visible rendering, - * do a sched_yield to keep the app from pegging the cpu while - * achieving nothing. - */ - UNLOCK_HARDWARE(intel); - sched_yield(); - LOCK_HARDWARE(intel); - } - } + dri_bo_exec(batch->buf, used, NULL, 0, (x_off & 0xffff) | (y_off << 16)); if (INTEL_DEBUG & DEBUG_BATCH) { dri_bo_map(batch->buf, GL_FALSE); @@ -183,7 +155,6 @@ do_flush_locked(struct intel_batchbuffer *batch, } if (ret != 0) { - UNLOCK_HARDWARE(intel); exit(1); } intel->vtbl.new_batch(intel); @@ -201,10 +172,8 @@ _intel_batchbuffer_flush(struct intel_batchbuffer *batch, const char *file, drm_intel_bo_reference(intel->first_post_swapbuffers_batch); } - if (used == 0) { - batch->cliprect_mode = IGNORE_CLIPRECTS; + if (used == 0) return; - } if (INTEL_DEBUG & DEBUG_BATCH) fprintf(stderr, "%s:%d: Batchbuffer flush with %db used\n", file, line, @@ -252,9 +221,7 @@ _intel_batchbuffer_flush(struct intel_batchbuffer *batch, const char *file, /* TODO: Just pass the relocation list and dma buffer up to the * kernel. */ - LOCK_HARDWARE(intel); - do_flush_locked(batch, used, GL_FALSE); - UNLOCK_HARDWARE(intel); + do_flush_locked(batch, used); if (INTEL_DEBUG & DEBUG_SYNC) { fprintf(stderr, "waiting for idle\n"); @@ -296,11 +263,10 @@ intel_batchbuffer_emit_reloc(struct intel_batchbuffer *batch, void intel_batchbuffer_data(struct intel_batchbuffer *batch, - const void *data, GLuint bytes, - enum cliprect_mode cliprect_mode) + const void *data, GLuint bytes) { assert((bytes & 3) == 0); - intel_batchbuffer_require_space(batch, bytes, cliprect_mode); + intel_batchbuffer_require_space(batch, bytes); __memcpy(batch->ptr, data, bytes); batch->ptr += bytes; } @@ -317,7 +283,7 @@ intel_batchbuffer_emit_mi_flush(struct intel_batchbuffer *batch) struct intel_context *intel = batch->intel; if (intel->gen >= 4) { - BEGIN_BATCH(4, IGNORE_CLIPRECTS); + BEGIN_BATCH(4); OUT_BATCH(_3DSTATE_PIPE_CONTROL | PIPE_CONTROL_INSTRUCTION_FLUSH | PIPE_CONTROL_WRITE_FLUSH | @@ -327,7 +293,7 @@ intel_batchbuffer_emit_mi_flush(struct intel_batchbuffer *batch) OUT_BATCH(0); /* write data */ ADVANCE_BATCH(); } else { - BEGIN_BATCH(1, IGNORE_CLIPRECTS); + BEGIN_BATCH(1); OUT_BATCH(MI_FLUSH); ADVANCE_BATCH(); } diff --git a/src/mesa/drivers/dri/intel/intel_batchbuffer.h b/src/mesa/drivers/dri/intel/intel_batchbuffer.h index d4a94454dd..b052b724d8 100644 --- a/src/mesa/drivers/dri/intel/intel_batchbuffer.h +++ b/src/mesa/drivers/dri/intel/intel_batchbuffer.h @@ -10,35 +10,6 @@ #define BATCH_SZ 16384 #define BATCH_RESERVED 16 -enum cliprect_mode { - /** - * Batchbuffer contents may be looped over per cliprect, but do not - * require it. - */ - IGNORE_CLIPRECTS, - /** - * Batchbuffer contents require looping over per cliprect at batch submit - * time. - * - * This will be upgraded to NO_LOOP_CLIPRECTS when there's a single - * constant cliprect, as in DRI2 or FBO rendering. - */ - LOOP_CLIPRECTS, - /** - * Batchbuffer contents contain drawing that should not be executed multiple - * times. - */ - NO_LOOP_CLIPRECTS, - /** - * Batchbuffer contents contain drawing that already handles cliprects, such - * as 2D drawing to front/back/depth that doesn't respect DRAWING_RECTANGLE. - * - * Equivalent behavior to NO_LOOP_CLIPRECTS, but may not persist in batch - * outside of LOCK/UNLOCK. This is upgraded to just NO_LOOP_CLIPRECTS when - * there's a constant cliprect, as in DRI2 or FBO rendering. - */ - REFERENCES_CLIPRECTS -}; struct intel_batchbuffer { @@ -51,8 +22,6 @@ struct intel_batchbuffer GLubyte *map; GLubyte *ptr; - enum cliprect_mode cliprect_mode; - GLuint size; /** Tracking of BEGIN_BATCH()/OUT_BATCH()/ADVANCE_BATCH() debugging */ @@ -85,8 +54,7 @@ void intel_batchbuffer_reset(struct intel_batchbuffer *batch); * intel_buffer_dword() calls. */ void intel_batchbuffer_data(struct intel_batchbuffer *batch, - const void *data, GLuint bytes, - enum cliprect_mode cliprect_mode); + const void *data, GLuint bytes); void intel_batchbuffer_release_space(struct intel_batchbuffer *batch, GLuint bytes); @@ -121,36 +89,19 @@ intel_batchbuffer_emit_dword(struct intel_batchbuffer *batch, GLuint dword) static INLINE void intel_batchbuffer_require_space(struct intel_batchbuffer *batch, - GLuint sz, - enum cliprect_mode cliprect_mode) + GLuint sz) { assert(sz < batch->size - 8); if (intel_batchbuffer_space(batch) < sz) intel_batchbuffer_flush(batch); - - if ((cliprect_mode == LOOP_CLIPRECTS || - cliprect_mode == REFERENCES_CLIPRECTS) && - batch->intel->constant_cliprect) - cliprect_mode = NO_LOOP_CLIPRECTS; - - if (cliprect_mode != IGNORE_CLIPRECTS) { - if (batch->cliprect_mode == IGNORE_CLIPRECTS) { - batch->cliprect_mode = cliprect_mode; - } else { - if (batch->cliprect_mode != cliprect_mode) { - intel_batchbuffer_flush(batch); - batch->cliprect_mode = cliprect_mode; - } - } - } } /* Here are the crusty old macros, to be removed: */ #define BATCH_LOCALS -#define BEGIN_BATCH(n, cliprect_mode) do { \ - intel_batchbuffer_require_space(intel->batch, (n)*4, cliprect_mode); \ +#define BEGIN_BATCH(n) do { \ + intel_batchbuffer_require_space(intel->batch, (n)*4); \ assert(intel->batch->emit.start_ptr == NULL); \ intel->batch->emit.total = (n) * 4; \ intel->batch->emit.start_ptr = intel->batch->ptr; \ diff --git a/src/mesa/drivers/dri/intel/intel_blit.c b/src/mesa/drivers/dri/intel/intel_blit.c index da9beba030..55bee0084c 100644 --- a/src/mesa/drivers/dri/intel/intel_blit.c +++ b/src/mesa/drivers/dri/intel/intel_blit.c @@ -42,134 +42,6 @@ #define FILE_DEBUG_FLAG DEBUG_BLIT -/** - * Copy the back color buffer to the front color buffer. - * Used for SwapBuffers(). - */ -void -intelCopyBuffer(const __DRIdrawablePrivate * dPriv, - const drm_clip_rect_t * rect) -{ - - struct intel_context *intel; - - DBG("%s\n", __FUNCTION__); - - assert(dPriv); - - intel = intelScreenContext(dPriv->driScreenPriv->private); - if (!intel) - return; - - /* The LOCK_HARDWARE is required for the cliprects. Buffer offsets - * should work regardless. - */ - LOCK_HARDWARE(intel); - - if (dPriv && dPriv->numClipRects) { - struct intel_framebuffer *intel_fb = dPriv->driverPrivate; - struct intel_region *src, *dst; - int nbox = dPriv->numClipRects; - drm_clip_rect_t *pbox = dPriv->pClipRects; - int cpp; - int src_pitch, dst_pitch; - unsigned short src_x, src_y; - int BR13, CMD; - int i; - dri_bo *aper_array[3]; - - src = intel_get_rb_region(&intel_fb->Base, BUFFER_BACK_LEFT); - dst = intel_get_rb_region(&intel_fb->Base, BUFFER_FRONT_LEFT); - - src_pitch = src->pitch * src->cpp; - dst_pitch = dst->pitch * dst->cpp; - - cpp = src->cpp; - - ASSERT(intel_fb); - ASSERT(intel_fb->Base.Name == 0); /* Not a user-created FBO */ - ASSERT(src); - ASSERT(dst); - ASSERT(src->cpp == dst->cpp); - - if (cpp == 2) { - BR13 = (0xCC << 16) | BR13_565; - CMD = XY_SRC_COPY_BLT_CMD; - } - else { - BR13 = (0xCC << 16) | BR13_8888; - CMD = XY_SRC_COPY_BLT_CMD | XY_BLT_WRITE_ALPHA | XY_BLT_WRITE_RGB; - } - - assert(src->tiling != I915_TILING_Y); - assert(dst->tiling != I915_TILING_Y); -#ifndef I915 - if (src->tiling != I915_TILING_NONE) { - CMD |= XY_SRC_TILED; - src_pitch /= 4; - } - if (dst->tiling != I915_TILING_NONE) { - CMD |= XY_DST_TILED; - dst_pitch /= 4; - } -#endif - /* do space/cliprects check before going any further */ - intel_batchbuffer_require_space(intel->batch, 8 * 4, - REFERENCES_CLIPRECTS); - again: - aper_array[0] = intel->batch->buf; - aper_array[1] = dst->buffer; - aper_array[2] = src->buffer; - - if (dri_bufmgr_check_aperture_space(aper_array, 3) != 0) { - intel_batchbuffer_flush(intel->batch); - goto again; - } - - for (i = 0; i < nbox; i++, pbox++) { - drm_clip_rect_t box = *pbox; - - if (rect) { - if (!intel_intersect_cliprects(&box, &box, rect)) - continue; - } - - if (box.x1 >= box.x2 || - box.y1 >= box.y2) - continue; - - assert(box.x1 < box.x2); - assert(box.y1 < box.y2); - src_x = box.x1 - dPriv->x + dPriv->backX; - src_y = box.y1 - dPriv->y + dPriv->backY; - - BEGIN_BATCH(8, REFERENCES_CLIPRECTS); - OUT_BATCH(CMD); - OUT_BATCH(BR13 | dst_pitch); - OUT_BATCH((box.y1 << 16) | box.x1); - OUT_BATCH((box.y2 << 16) | box.x2); - - OUT_RELOC(dst->buffer, - I915_GEM_DOMAIN_RENDER, I915_GEM_DOMAIN_RENDER, - 0); - OUT_BATCH((src_y << 16) | src_x); - OUT_BATCH(src_pitch); - OUT_RELOC(src->buffer, - I915_GEM_DOMAIN_RENDER, 0, - 0); - ADVANCE_BATCH(); - } - - /* Flush the rendering and the batch so that the results all land on the - * screen in a timely fashion. - */ - intel_batchbuffer_emit_mi_flush(intel->batch); - intel_batchbuffer_flush(intel->batch); - } - - UNLOCK_HARDWARE(intel); -} - static GLuint translate_raster_op(GLenum logicop) { switch(logicop) { @@ -245,7 +117,6 @@ intelEmitCopyBlit(struct intel_context *intel, } while (pass < 2); if (pass >= 2) { - LOCK_HARDWARE(intel); dri_bo_map(dst_buffer, GL_TRUE); dri_bo_map(src_buffer, GL_FALSE); _mesa_copy_rect((GLubyte *)dst_buffer->virtual + dst_offset, @@ -259,12 +130,11 @@ intelEmitCopyBlit(struct intel_context *intel, dri_bo_unmap(src_buffer); dri_bo_unmap(dst_buffer); - UNLOCK_HARDWARE(intel); return GL_TRUE; } - intel_batchbuffer_require_space(intel->batch, 8 * 4, NO_LOOP_CLIPRECTS); + intel_batchbuffer_require_space(intel->batch, 8 * 4); DBG("%s src:buf(%p)/%d+%d %d,%d dst:buf(%p)/%d+%d %d,%d sz:%dx%d\n", __FUNCTION__, src_buffer, src_pitch, src_offset, src_x, src_y, @@ -309,7 +179,7 @@ intelEmitCopyBlit(struct intel_context *intel, assert(dst_x < dst_x2); assert(dst_y < dst_y2); - BEGIN_BATCH(8, NO_LOOP_CLIPRECTS); + BEGIN_BATCH(8); OUT_BATCH(CMD); OUT_BATCH(BR13 | (uint16_t)dst_pitch); OUT_BATCH((dst_y << 16) | dst_x); @@ -367,8 +237,6 @@ intelClearWithBlit(GLcontext *ctx, GLbitfield mask) skipBuffers = BUFFER_BIT_STENCIL; } - LOCK_HARDWARE(intel); - intel_get_cliprects(intel, &cliprects, &num_cliprects, &x_off, &y_off); if (num_cliprects) { GLint cx, cy, cw, ch; @@ -525,7 +393,7 @@ intelClearWithBlit(GLcontext *ctx, GLbitfield mask) assert(x1 < x2); assert(y1 < y2); - BEGIN_BATCH(6, REFERENCES_CLIPRECTS); + BEGIN_BATCH(6); OUT_BATCH(CMD); OUT_BATCH(BR13); OUT_BATCH((y1 << 16) | x1); @@ -540,8 +408,6 @@ intelClearWithBlit(GLcontext *ctx, GLbitfield mask) } } } - - UNLOCK_HARDWARE(intel); } GLboolean @@ -583,8 +449,7 @@ intelEmitImmediateColorExpandBlit(struct intel_context *intel, intel_batchbuffer_require_space( intel->batch, (8 * 4) + (3 * 4) + - dwords * 4, - REFERENCES_CLIPRECTS ); + dwords * 4 ); opcode = XY_SETUP_BLT_CMD; if (cpp == 4) @@ -606,7 +471,7 @@ intelEmitImmediateColorExpandBlit(struct intel_context *intel, if (dst_tiling != I915_TILING_NONE) blit_cmd |= XY_DST_TILED; - BEGIN_BATCH(8 + 3, REFERENCES_CLIPRECTS); + BEGIN_BATCH(8 + 3); OUT_BATCH(opcode); OUT_BATCH(br13); OUT_BATCH((0 << 16) | 0); /* clip x1, y1 */ @@ -625,8 +490,7 @@ intelEmitImmediateColorExpandBlit(struct intel_context *intel, intel_batchbuffer_data( intel->batch, src_bits, - dwords * 4, - REFERENCES_CLIPRECTS ); + dwords * 4 ); intel_batchbuffer_emit_mi_flush(intel->batch); diff --git a/src/mesa/drivers/dri/intel/intel_blit.h b/src/mesa/drivers/dri/intel/intel_blit.h index 240cb7cd1b..eb66fe0481 100644 --- a/src/mesa/drivers/dri/intel/intel_blit.h +++ b/src/mesa/drivers/dri/intel/intel_blit.h @@ -30,7 +30,7 @@ #include "intel_context.h" -extern void intelCopyBuffer(const __DRIdrawablePrivate * dpriv, +extern void intelCopyBuffer(const __DRIdrawable * dpriv, const drm_clip_rect_t * rect); extern void intelClearWithBlit(GLcontext * ctx, GLbitfield mask); diff --git a/src/mesa/drivers/dri/intel/intel_buffers.c b/src/mesa/drivers/dri/intel/intel_buffers.c index 97d56e4e67..7c4b79f743 100644 --- a/src/mesa/drivers/dri/intel/intel_buffers.c +++ b/src/mesa/drivers/dri/intel/intel_buffers.c @@ -102,33 +102,15 @@ intel_get_cliprects(struct intel_context *intel, unsigned int *num_cliprects, int *x_off, int *y_off) { - __DRIdrawablePrivate *dPriv = intel->driDrawable; + intel->fboRect.x1 = 0; + intel->fboRect.y1 = 0; + intel->fboRect.x2 = intel->ctx.DrawBuffer->Width; + intel->fboRect.y2 = intel->ctx.DrawBuffer->Height; - if (intel->constant_cliprect) { - /* FBO or DRI2 rendering, which can just use the fb's size. */ - intel->fboRect.x1 = 0; - intel->fboRect.y1 = 0; - intel->fboRect.x2 = intel->ctx.DrawBuffer->Width; - intel->fboRect.y2 = intel->ctx.DrawBuffer->Height; - - *cliprects = &intel->fboRect; - *num_cliprects = 1; - *x_off = 0; - *y_off = 0; - } else if (intel->front_cliprects || dPriv->numBackClipRects == 0) { - /* use the front clip rects */ - *cliprects = dPriv->pClipRects; - *num_cliprects = dPriv->numClipRects; - *x_off = dPriv->x; - *y_off = dPriv->y; - } - else { - /* use the back clip rects */ - *num_cliprects = dPriv->numBackClipRects; - *cliprects = dPriv->pBackClipRects; - *x_off = dPriv->backX; - *y_off = dPriv->backY; - } + *cliprects = &intel->fboRect; + *num_cliprects = 1; + *x_off = 0; + *y_off = 0; } @@ -202,7 +184,6 @@ intel_draw_buffer(GLcontext * ctx, struct gl_framebuffer *fb) || (fb->_NumColorDrawBuffers == 0)) { /* writing to 0 */ colorRegions[0] = NULL; - intel->constant_cliprect = GL_TRUE; } else if (fb->_NumColorDrawBuffers > 1) { int i; @@ -212,34 +193,23 @@ intel_draw_buffer(GLcontext * ctx, struct gl_framebuffer *fb) irb = intel_renderbuffer(fb->_ColorDrawBuffers[i]); colorRegions[i] = irb ? irb->region : NULL; } - intel->constant_cliprect = GL_TRUE; } else { /* Get the intel_renderbuffer for the single colorbuffer we're drawing - * into, and set up cliprects if it's a DRI1 window front buffer. + * into. */ if (fb->Name == 0) { - intel->constant_cliprect = intel->driScreen->dri2.enabled; /* drawing to window system buffer */ - if (fb->_ColorDrawBufferIndexes[0] == BUFFER_FRONT_LEFT) { - if (!intel->constant_cliprect && !intel->front_cliprects) - intel_batchbuffer_flush(intel->batch); - intel->front_cliprects = GL_TRUE; + if (fb->_ColorDrawBufferIndexes[0] == BUFFER_FRONT_LEFT) colorRegions[0] = intel_get_rb_region(fb, BUFFER_FRONT_LEFT); - } - else { - if (!intel->constant_cliprect && intel->front_cliprects) - intel_batchbuffer_flush(intel->batch); - intel->front_cliprects = GL_FALSE; + else colorRegions[0] = intel_get_rb_region(fb, BUFFER_BACK_LEFT); - } } else { /* drawing to user-created FBO */ struct intel_renderbuffer *irb; irb = intel_renderbuffer(fb->_ColorDrawBuffers[0]); colorRegions[0] = (irb && irb->region) ? irb->region : NULL; - intel->constant_cliprect = GL_TRUE; } } diff --git a/src/mesa/drivers/dri/intel/intel_context.c b/src/mesa/drivers/dri/intel/intel_context.c index a3c828027f..3f6634c65a 100644 --- a/src/mesa/drivers/dri/intel/intel_context.c +++ b/src/mesa/drivers/dri/intel/intel_context.c @@ -55,10 +55,8 @@ #include "intel_decode.h" #include "intel_bufmgr.h" #include "intel_screen.h" -#include "intel_swapbuffers.h" #include "drirenderbuffer.h" -#include "vblank.h" #include "utils.h" #include "xmlpool.h" /* for symbolic values of enum-type options */ @@ -191,10 +189,11 @@ intel_bits_per_pixel(const struct intel_renderbuffer *rb) void intel_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable) { - struct intel_framebuffer *intel_fb = drawable->driverPrivate; + struct gl_framebuffer *fb = drawable->driverPrivate; struct intel_renderbuffer *rb; struct intel_region *region, *depth_region; struct intel_context *intel = context->driverPrivate; + struct intel_renderbuffer *front_rb, *back_rb, *depth_rb, *stencil_rb; __DRIbuffer *buffers = NULL; __DRIscreen *screen; int i, count; @@ -210,26 +209,25 @@ intel_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable) if (screen->dri2.loader && (screen->dri2.loader->base.version > 2) && (screen->dri2.loader->getBuffersWithFormat != NULL)) { - struct intel_renderbuffer *depth_rb; - struct intel_renderbuffer *stencil_rb; + + front_rb = intel_get_renderbuffer(fb, BUFFER_FRONT_LEFT); + back_rb = intel_get_renderbuffer(fb, BUFFER_BACK_LEFT); + depth_rb = intel_get_renderbuffer(fb, BUFFER_DEPTH); + stencil_rb = intel_get_renderbuffer(fb, BUFFER_STENCIL); i = 0; if ((intel->is_front_buffer_rendering || intel->is_front_buffer_reading || - !intel_fb->color_rb[1]) - && intel_fb->color_rb[0]) { + !back_rb) && front_rb) { attachments[i++] = __DRI_BUFFER_FRONT_LEFT; - attachments[i++] = intel_bits_per_pixel(intel_fb->color_rb[0]); + attachments[i++] = intel_bits_per_pixel(front_rb); } - if (intel_fb->color_rb[1]) { + if (back_rb) { attachments[i++] = __DRI_BUFFER_BACK_LEFT; - attachments[i++] = intel_bits_per_pixel(intel_fb->color_rb[1]); + attachments[i++] = intel_bits_per_pixel(back_rb); } - depth_rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); - stencil_rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); - if ((depth_rb != NULL) && (stencil_rb != NULL)) { attachments[i++] = __DRI_BUFFER_DEPTH_STENCIL; attachments[i++] = intel_bits_per_pixel(depth_rb); @@ -250,13 +248,13 @@ intel_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable) drawable->loaderPrivate); } else if (screen->dri2.loader) { i = 0; - if (intel_fb->color_rb[0]) + if (intel_get_renderbuffer(fb, BUFFER_FRONT_LEFT)) attachments[i++] = __DRI_BUFFER_FRONT_LEFT; - if (intel_fb->color_rb[1]) + if (intel_get_renderbuffer(fb, BUFFER_BACK_LEFT)) attachments[i++] = __DRI_BUFFER_BACK_LEFT; - if (intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH)) + if (intel_get_renderbuffer(fb, BUFFER_DEPTH)) attachments[i++] = __DRI_BUFFER_DEPTH; - if (intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL)) + if (intel_get_renderbuffer(fb, BUFFER_STENCIL)) attachments[i++] = __DRI_BUFFER_STENCIL; buffers = (*screen->dri2.loader->getBuffers)(drawable, @@ -289,32 +287,32 @@ intel_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable) for (i = 0; i < count; i++) { switch (buffers[i].attachment) { case __DRI_BUFFER_FRONT_LEFT: - rb = intel_fb->color_rb[0]; + rb = intel_get_renderbuffer(fb, BUFFER_FRONT_LEFT); region_name = "dri2 front buffer"; break; case __DRI_BUFFER_FAKE_FRONT_LEFT: - rb = intel_fb->color_rb[0]; + rb = intel_get_renderbuffer(fb, BUFFER_FRONT_LEFT); region_name = "dri2 fake front buffer"; break; case __DRI_BUFFER_BACK_LEFT: - rb = intel_fb->color_rb[1]; + rb = intel_get_renderbuffer(fb, BUFFER_BACK_LEFT); region_name = "dri2 back buffer"; break; case __DRI_BUFFER_DEPTH: - rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); + rb = intel_get_renderbuffer(fb, BUFFER_DEPTH); region_name = "dri2 depth buffer"; break; case __DRI_BUFFER_DEPTH_STENCIL: - rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); + rb = intel_get_renderbuffer(fb, BUFFER_DEPTH); region_name = "dri2 depth / stencil buffer"; break; case __DRI_BUFFER_STENCIL: - rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); + rb = intel_get_renderbuffer(fb, BUFFER_STENCIL); region_name = "dri2 stencil buffer"; break; @@ -361,7 +359,7 @@ intel_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable) intel_region_release(®ion); if (buffers[i].attachment == __DRI_BUFFER_DEPTH_STENCIL) { - rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); + rb = intel_get_renderbuffer(fb, BUFFER_STENCIL); if (rb != NULL) { struct intel_region *stencil_region = NULL; @@ -390,9 +388,6 @@ intel_viewport(GLcontext *ctx, GLint x, GLint y, GLsizei w, GLsizei h) void (*old_viewport)(GLcontext *ctx, GLint x, GLint y, GLsizei w, GLsizei h); - if (!driContext->driScreenPriv->dri2.enabled) - return; - if (!intel->meta.internal_viewport_call && ctx->DrawBuffer->Name == 0) { /* If we're rendering to the fake front buffer, make sure all the pending * drawing has landed on the real front buffer. Otherwise when we @@ -411,7 +406,6 @@ intel_viewport(GLcontext *ctx, GLint x, GLint y, GLsizei w, GLsizei h) old_viewport = ctx->Driver.Viewport; ctx->Driver.Viewport = NULL; intel->driDrawable = driContext->driDrawablePriv; - intelWindowMoved(intel); intel_draw_buffer(ctx, intel->ctx.DrawBuffer); ctx->Driver.Viewport = old_viewport; } @@ -477,13 +471,6 @@ intel_flush(GLcontext *ctx, GLboolean needs_mi_flush) if (intel->gen < 4) INTEL_FIREVERTICES(intel); - /* Emit a flush so that any frontbuffer rendering that might have occurred - * lands onscreen in a timely manner, even if the X Server doesn't trigger - * a flush for us. - */ - if (!intel->driScreen->dri2.enabled && needs_mi_flush) - intel_batchbuffer_emit_mi_flush(intel->batch); - if (intel->batch->map != intel->batch->ptr) intel_batchbuffer_flush(intel->batch); @@ -589,13 +576,13 @@ intelInitDriverFunctions(struct dd_function_table *functions) GLboolean intelInitContext(struct intel_context *intel, const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate, struct dd_function_table *functions) { GLcontext *ctx = &intel->ctx; GLcontext *shareCtx = (GLcontext *) sharedContextPrivate; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; intelScreenPrivate *intelScreen = (intelScreenPrivate *) sPriv->private; int bo_reuse_mode; @@ -608,8 +595,8 @@ intelInitContext(struct intel_context *intel, driContextPriv->driverPrivate = intel; intel->intelScreen = intelScreen; intel->driScreen = sPriv; - intel->sarea = intelScreen->sarea; intel->driContext = driContextPriv; + intel->driFd = sPriv->fd; if (IS_965(intel->intelScreen->deviceID)) { intel->gen = 4; @@ -631,11 +618,6 @@ intelInitContext(struct intel_context *intel, intel->is_g4x = GL_TRUE; } - /* Dri stuff */ - intel->hHWContext = driContextPriv->hHWContext; - intel->driFd = sPriv->fd; - intel->driHwLock = sPriv->lock; - driParseConfigFiles(&intel->optionCache, &intelScreen->optionCache, intel->driScreen->myNum, (intel->gen >= 4) ? "i965" : "i915"); @@ -749,9 +731,6 @@ intelInitContext(struct intel_context *intel, if (INTEL_DEBUG & DEBUG_BUFMGR) dri_bufmgr_set_debug(intel->bufmgr, GL_TRUE); - if (!sPriv->dri2.enabled) - intel_recreate_static_regions(intel); - intel->batch = intel_batchbuffer_alloc(intel); intel_fbo_init(intel); @@ -800,7 +779,7 @@ intelInitContext(struct intel_context *intel, } void -intelDestroyContext(__DRIcontextPrivate * driContextPriv) +intelDestroyContext(__DRIcontext * driContextPriv) { struct intel_context *intel = (struct intel_context *) driContextPriv->driverPrivate; @@ -847,57 +826,6 @@ intelDestroyContext(__DRIcontextPrivate * driContextPriv) */ } - /* XXX In intelMakeCurrent() below, the context's static regions are - * referenced inside the frame buffer; it's listed as a hack, - * with a comment of "XXX FBO temporary fix-ups!", but - * as long as it's there, we should release the regions here. - * The do/while loop around the block is used to allow the - * "continue" statements inside the block to exit the block, - * to avoid many layers of "if" constructs. - */ - do { - __DRIdrawablePrivate * driDrawPriv = intel->driDrawable; - struct intel_framebuffer *intel_fb; - struct intel_renderbuffer *irbDepth, *irbStencil; - if (!driDrawPriv) { - /* We're already detached from the drawable; exit this block. */ - continue; - } - intel_fb = (struct intel_framebuffer *) driDrawPriv->driverPrivate; - if (!intel_fb) { - /* The frame buffer is already gone; exit this block. */ - continue; - } - irbDepth = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); - irbStencil = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); - - /* If the regions of the frame buffer still match the regions - * of the context, release them. If they've changed somehow, - * leave them alone. - */ - if (intel_fb->color_rb[0] && intel_fb->color_rb[0]->region == intel->front_region) { - intel_renderbuffer_set_region(intel_fb->color_rb[0], NULL); - } - if (intel_fb->color_rb[1] && intel_fb->color_rb[1]->region == intel->back_region) { - intel_renderbuffer_set_region(intel_fb->color_rb[1], NULL); - } - - if (irbDepth && irbDepth->region == intel->depth_region) { - intel_renderbuffer_set_region(irbDepth, NULL); - } - /* Usually, the stencil buffer is the same as the depth buffer; - * but they're handled separately in MakeCurrent, so we'll - * handle them separately here. - */ - if (irbStencil && irbStencil->region == intel->depth_region) { - intel_renderbuffer_set_region(irbStencil, NULL); - } - } while (0); - - intel_region_release(&intel->front_region); - intel_region_release(&intel->back_region); - intel_region_release(&intel->depth_region); - driDestroyOptionCache(&intel->optionCache); /* free the Mesa context */ @@ -909,7 +837,7 @@ intelDestroyContext(__DRIcontextPrivate * driContextPriv) } GLboolean -intelUnbindContext(__DRIcontextPrivate * driContextPriv) +intelUnbindContext(__DRIcontext * driContextPriv) { struct intel_context *intel = (struct intel_context *) driContextPriv->driverPrivate; @@ -923,11 +851,10 @@ intelUnbindContext(__DRIcontextPrivate * driContextPriv) } GLboolean -intelMakeCurrent(__DRIcontextPrivate * driContextPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv) +intelMakeCurrent(__DRIcontext * driContextPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv) { - __DRIscreenPrivate *psp = driDrawPriv->driScreenPriv; struct intel_context *intel; GET_CURRENT_CONTEXT(curCtx); @@ -945,37 +872,12 @@ intelMakeCurrent(__DRIcontextPrivate * driContextPriv, } if (driContextPriv) { - struct intel_framebuffer *intel_fb = - (struct intel_framebuffer *) driDrawPriv->driverPrivate; - GLframebuffer *readFb = (GLframebuffer *) driReadPriv->driverPrivate; + struct gl_framebuffer *fb = driDrawPriv->driverPrivate; + struct gl_framebuffer *readFb = driReadPriv->driverPrivate; - if (!driContextPriv->driScreenPriv->dri2.enabled) { - /* XXX FBO temporary fix-ups! These are released in - * intelDextroyContext(), above. Changes here should be - * reflected there. - */ - /* if the renderbuffers don't have regions, init them from the context */ - struct intel_renderbuffer *irbDepth - = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); - struct intel_renderbuffer *irbStencil - = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); - - if (intel_fb->color_rb[0]) { - intel_renderbuffer_set_region(intel_fb->color_rb[0], - intel->front_region); - } - if (intel_fb->color_rb[1]) { - intel_renderbuffer_set_region(intel_fb->color_rb[1], - intel->back_region); - } - - if (irbDepth) { - intel_renderbuffer_set_region(irbDepth, intel->depth_region); - } - if (irbStencil) { - intel_renderbuffer_set_region(irbStencil, intel->depth_region); - } - } + intel_update_renderbuffers(driContextPriv, driDrawPriv); + if (driDrawPriv != driReadPriv) + intel_update_renderbuffers(driContextPriv, driReadPriv); /* set GLframebuffer size to match window, if needed */ driUpdateFramebufferSize(&intel->ctx, driDrawPriv); @@ -984,37 +886,10 @@ intelMakeCurrent(__DRIcontextPrivate * driContextPriv, driUpdateFramebufferSize(&intel->ctx, driReadPriv); } - _mesa_make_current(&intel->ctx, &intel_fb->Base, readFb); - + _mesa_make_current(&intel->ctx, fb, readFb); intel->driReadDrawable = driReadPriv; - - if (intel->driDrawable != driDrawPriv) { - if (driDrawPriv->swap_interval == (unsigned)-1) { - int i; - - driDrawPriv->vblFlags = (intel->intelScreen->irq_active != 0) - ? driGetDefaultVBlankFlags(&intel->optionCache) - : VBLANK_FLAG_NO_IRQ; - - /* Prevent error printf if one crtc is disabled, this will - * be properly calculated in intelWindowMoved() next. - */ - driDrawPriv->vblFlags = intelFixupVblank(intel, driDrawPriv); - - (*psp->systemTime->getUST) (&intel_fb->swap_ust); - driDrawableInitVBlank(driDrawPriv); - intel_fb->vbl_waited = driDrawPriv->vblSeq; - - for (i = 0; i < 2; i++) { - if (intel_fb->color_rb[i]) - intel_fb->color_rb[i]->vbl_pending = driDrawPriv->vblSeq; - } - } - intel->driDrawable = driDrawPriv; - intelWindowMoved(intel); - } - - intel_draw_buffer(&intel->ctx, &intel_fb->Base); + intel->driDrawable = driDrawPriv; + intel_draw_buffer(&intel->ctx, fb); } else { _mesa_make_current(NULL, NULL, NULL); @@ -1022,132 +897,3 @@ intelMakeCurrent(__DRIcontextPrivate * driContextPriv, return GL_TRUE; } - -static void -intelContendedLock(struct intel_context *intel, GLuint flags) -{ - __DRIdrawablePrivate *dPriv = intel->driDrawable; - __DRIscreenPrivate *sPriv = intel->driScreen; - volatile drm_i915_sarea_t *sarea = intel->sarea; - int me = intel->hHWContext; - - drmGetLock(intel->driFd, intel->hHWContext, flags); - - if (INTEL_DEBUG & DEBUG_LOCK) - _mesa_printf("%s - got contended lock\n", __progname); - - /* If the window moved, may need to set a new cliprect now. - * - * NOTE: This releases and regains the hw lock, so all state - * checking must be done *after* this call: - */ - if (dPriv) - DRI_VALIDATE_DRAWABLE_INFO(sPriv, dPriv); - - if (sarea && sarea->ctxOwner != me) { - if (INTEL_DEBUG & DEBUG_BUFMGR) { - fprintf(stderr, "Lost Context: sarea->ctxOwner %x me %x\n", - sarea->ctxOwner, me); - } - sarea->ctxOwner = me; - } - - /* Drawable changed? - */ - if (dPriv && intel->lastStamp != dPriv->lastStamp) { - intelWindowMoved(intel); - intel->lastStamp = dPriv->lastStamp; - } -} - - -_glthread_DECLARE_STATIC_MUTEX(lockMutex); - -/* Lock the hardware and validate our state. - */ -void LOCK_HARDWARE( struct intel_context *intel ) -{ - __DRIdrawable *dPriv = intel->driDrawable; - __DRIscreen *sPriv = intel->driScreen; - char __ret = 0; - struct intel_framebuffer *intel_fb = NULL; - struct intel_renderbuffer *intel_rb = NULL; - - intel->locked++; - if (intel->locked >= 2) - return; - - if (!sPriv->dri2.enabled) - _glthread_LOCK_MUTEX(lockMutex); - - if (intel->driDrawable) { - intel_fb = intel->driDrawable->driverPrivate; - - if (!intel->driDrawable->validBuffers) - intel_update_renderbuffers(intel->driContext, - intel->driDrawable); - - if (intel_fb) - intel_rb = - intel_get_renderbuffer(&intel_fb->Base, - intel_fb->Base._ColorDrawBufferIndexes[0]); - } - - if (intel_rb && dPriv->vblFlags && - !(dPriv->vblFlags & VBLANK_FLAG_NO_IRQ) && - (intel_fb->vbl_waited - intel_rb->vbl_pending) > (1<<23)) { - drmVBlank vbl; - - vbl.request.type = DRM_VBLANK_ABSOLUTE; - - if ( dPriv->vblFlags & VBLANK_FLAG_SECONDARY ) { - vbl.request.type |= DRM_VBLANK_SECONDARY; - } - - vbl.request.sequence = intel_rb->vbl_pending; - drmWaitVBlank(intel->driFd, &vbl); - intel_fb->vbl_waited = vbl.reply.sequence; - } - - if (!sPriv->dri2.enabled) { - DRM_CAS(intel->driHwLock, intel->hHWContext, - (DRM_LOCK_HELD|intel->hHWContext), __ret); - - if (__ret) - intelContendedLock( intel, 0 ); - } - - - if (INTEL_DEBUG & DEBUG_LOCK) - _mesa_printf("%s - locked\n", __progname); -} - - -/* Unlock the hardware using the global current context - */ -void UNLOCK_HARDWARE( struct intel_context *intel ) -{ - __DRIscreen *sPriv = intel->driScreen; - - intel->locked--; - if (intel->locked > 0) - return; - - assert(intel->locked == 0); - - if (!sPriv->dri2.enabled) { - DRM_UNLOCK(intel->driFd, intel->driHwLock, intel->hHWContext); - _glthread_UNLOCK_MUTEX(lockMutex); - } - - if (INTEL_DEBUG & DEBUG_LOCK) - _mesa_printf("%s - unlocked\n", __progname); - - /** - * Nothing should be left in batch outside of LOCK/UNLOCK which references - * cliprects. - */ - if (intel->batch->cliprect_mode == REFERENCES_CLIPRECTS) - intel_batchbuffer_flush(intel->batch); -} - diff --git a/src/mesa/drivers/dri/intel/intel_context.h b/src/mesa/drivers/dri/intel/intel_context.h index 61d0be3a5b..07207bfbec 100644 --- a/src/mesa/drivers/dri/intel/intel_context.h +++ b/src/mesa/drivers/dri/intel/intel_context.h @@ -184,10 +184,6 @@ struct intel_context int urb_size; - struct intel_region *front_region; - struct intel_region *back_region; - struct intel_region *depth_region; - struct intel_batchbuffer *batch; drm_intel_bo *first_post_swapbuffers_batch; GLboolean no_batch_wrap; @@ -252,19 +248,6 @@ struct intel_context intel_tri_func draw_tri; /** - * Set to true if a single constant cliprect should be used in the - * batchbuffer. Otherwise, cliprects must be calculated at batchbuffer - * flush time while the lock is held. - */ - GLboolean constant_cliprect; - - /** - * In !constant_cliprect mode, set to true if the front cliprects should be - * used instead of back. - */ - GLboolean front_cliprects; - - /** * Set if rendering has occured to the drawable's front buffer. * * This is used in the DRI2 case to detect that glFlush should also copy @@ -295,36 +278,20 @@ struct intel_context drm_clip_rect_t draw_rect; drm_clip_rect_t scissor_rect; - drm_context_t hHWContext; - drmLock *driHwLock; int driFd; - __DRIcontextPrivate *driContext; - __DRIdrawablePrivate *driDrawable; - __DRIdrawablePrivate *driReadDrawable; - __DRIscreenPrivate *driScreen; + __DRIcontext *driContext; + __DRIdrawable *driDrawable; + __DRIdrawable *driReadDrawable; + __DRIscreen *driScreen; intelScreenPrivate *intelScreen; - volatile drm_i915_sarea_t *sarea; - - GLuint lastStamp; /** * Configuration cache */ driOptionCache optionCache; - - int64_t swap_ust; - int64_t swap_missed_ust; - - GLuint swap_count; - GLuint swap_missed_count; }; -/* These are functions now: - */ -void LOCK_HARDWARE( struct intel_context *intel ); -void UNLOCK_HARDWARE( struct intel_context *intel ); - extern char *__progname; @@ -439,12 +406,10 @@ extern int INTEL_DEBUG; extern GLboolean intelInitContext(struct intel_context *intel, const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate, struct dd_function_table *functions); -extern void intelGetLock(struct intel_context *intel, GLuint flags); - extern void intelFinish(GLcontext * ctx); extern void intelFlush(GLcontext * ctx); extern void intel_flush(GLcontext * ctx, GLboolean needs_mi_flush); diff --git a/src/mesa/drivers/dri/intel/intel_fbo.c b/src/mesa/drivers/dri/intel/intel_fbo.c index 32c43ae185..d58ffd95fa 100644 --- a/src/mesa/drivers/dri/intel/intel_fbo.c +++ b/src/mesa/drivers/dri/intel/intel_fbo.c @@ -222,7 +222,6 @@ static void intel_resize_buffers(GLcontext *ctx, struct gl_framebuffer *fb, GLuint width, GLuint height) { - struct intel_framebuffer *intel_fb = (struct intel_framebuffer*)fb; int i; _mesa_resize_framebuffer(ctx, fb, width, height); @@ -233,9 +232,10 @@ intel_resize_buffers(GLcontext *ctx, struct gl_framebuffer *fb, return; } + /* Make sure all window system renderbuffers are up to date */ - for (i = 0; i < 2; i++) { - struct gl_renderbuffer *rb = &intel_fb->color_rb[i]->Base; + for (i = BUFFER_FRONT_LEFT; i <= BUFFER_BACK_RIGHT; i++) { + struct gl_renderbuffer *rb = fb->Attachment[i].Renderbuffer; /* only resize if size is changing */ if (rb && (rb->Width != width || rb->Height != height)) { diff --git a/src/mesa/drivers/dri/intel/intel_fbo.h b/src/mesa/drivers/dri/intel/intel_fbo.h index fa43077d6a..586dbbbb25 100644 --- a/src/mesa/drivers/dri/intel/intel_fbo.h +++ b/src/mesa/drivers/dri/intel/intel_fbo.h @@ -34,27 +34,6 @@ struct intel_context; /** - * Intel framebuffer, derived from gl_framebuffer. - */ -struct intel_framebuffer -{ - struct gl_framebuffer Base; - - struct intel_renderbuffer *color_rb[2]; - - /* VBI - */ - GLuint vbl_waited; - - int64_t swap_ust; - int64_t swap_missed_ust; - - GLuint swap_count; - GLuint swap_missed_count; -}; - - -/** * Intel renderbuffer, derived from gl_renderbuffer. */ struct intel_renderbuffer @@ -62,8 +41,6 @@ struct intel_renderbuffer struct gl_renderbuffer Base; struct intel_region *region; - GLuint vbl_pending; /**< vblank sequence number of pending flip */ - uint8_t *span_cache; unsigned long span_cache_offset; }; @@ -121,7 +98,7 @@ intel_fbo_init(struct intel_context *intel); extern void -intel_flip_renderbuffers(struct intel_framebuffer *intel_fb); +intel_flip_renderbuffers(struct gl_framebuffer *fb); static INLINE struct intel_region * diff --git a/src/mesa/drivers/dri/intel/intel_pixel_bitmap.c b/src/mesa/drivers/dri/intel/intel_pixel_bitmap.c index f23f94f35e..85e5ad2cdd 100644 --- a/src/mesa/drivers/dri/intel/intel_pixel_bitmap.c +++ b/src/mesa/drivers/dri/intel/intel_pixel_bitmap.c @@ -236,8 +236,6 @@ do_blit_bitmap( GLcontext *ctx, if (!intel_check_blit_fragment_ops(ctx, tmpColor[3] == 1.0F)) return GL_FALSE; - LOCK_HARDWARE(intel); - intel_get_cliprects(intel, &cliprects, &num_cliprects, &x_off, &y_off); if (num_cliprects != 0) { GLuint i; @@ -325,7 +323,6 @@ do_blit_bitmap( GLcontext *ctx, } } out: - UNLOCK_HARDWARE(intel); if (INTEL_DEBUG & DEBUG_SYNC) intel_batchbuffer_flush(intel->batch); diff --git a/src/mesa/drivers/dri/intel/intel_pixel_copy.c b/src/mesa/drivers/dri/intel/intel_pixel_copy.c index 689a00cb00..e002516cdd 100644 --- a/src/mesa/drivers/dri/intel/intel_pixel_copy.c +++ b/src/mesa/drivers/dri/intel/intel_pixel_copy.c @@ -35,28 +35,33 @@ #include "intel_buffers.h" #include "intel_regions.h" #include "intel_pixel.h" +#include "intel_fbo.h" #define FILE_DEBUG_FLAG DEBUG_PIXEL static struct intel_region * copypix_src_region(struct intel_context *intel, GLenum type) { + struct intel_renderbuffer *depth; + + depth = (struct intel_renderbuffer *) + &intel->ctx.DrawBuffer->Attachment[BUFFER_DEPTH].Renderbuffer; + switch (type) { case GL_COLOR: return intel_readbuf_region(intel); case GL_DEPTH: - /* Don't think this is really possible execpt at 16bpp, when we have no stencil. - */ - if (intel->depth_region && intel->depth_region->cpp == 2) - return intel->depth_region; + /* Don't think this is really possible execpt at 16bpp, when we + * have no stencil. */ + if (depth && depth->region->cpp == 2) + return depth->region; case GL_STENCIL: - /* Don't think this is really possible. - */ + /* Don't think this is really possible. */ break; case GL_DEPTH_STENCIL_EXT: /* Does it matter whether it is stencil/depth or depth/stencil? */ - return intel->depth_region; + return depth->region; default: break; } @@ -134,8 +139,6 @@ do_blit_copypixels(GLcontext * ctx, intelFlush(&intel->ctx); - LOCK_HARDWARE(intel); - intel_get_cliprects(intel, &cliprects, &num_cliprects, &x_off, &y_off); if (num_cliprects != 0) { GLint delta_x; @@ -214,13 +217,11 @@ do_blit_copypixels(GLcontext * ctx, ctx->Color.ColorLogicOpEnabled ? ctx->Color.LogicOp : GL_COPY)) { DBG("%s: blit failure\n", __FUNCTION__); - UNLOCK_HARDWARE(intel); return GL_FALSE; } } } out: - UNLOCK_HARDWARE(intel); intel_check_front_buffer_rendering(intel); diff --git a/src/mesa/drivers/dri/intel/intel_pixel_read.c b/src/mesa/drivers/dri/intel/intel_pixel_read.c index 20424e2e58..9c0fdc6067 100644 --- a/src/mesa/drivers/dri/intel/intel_pixel_read.c +++ b/src/mesa/drivers/dri/intel/intel_pixel_read.c @@ -77,7 +77,7 @@ do_texture_readpixels(GLcontext * ctx, struct intel_context *intel = intel_context(ctx); intelScreenPrivate *screen = intel->intelScreen; GLint pitch = pack->RowLength ? pack->RowLength : width; - __DRIdrawablePrivate *dPriv = intel->driDrawable; + __DRIdrawable *dPriv = intel->driDrawable; int textureFormat; GLenum glTextureFormat; int destFormat, depthFormat, destPitch; @@ -105,15 +105,12 @@ do_texture_readpixels(GLcontext * ctx, return GL_FALSE; } - LOCK_HARDWARE(intel); - if (intel->driDrawable->numClipRects) { intel->vtbl.install_meta_state(intel); intel->vtbl.meta_no_depth_write(intel); intel->vtbl.meta_no_stencil_write(intel); if (!driClipRectToFramebuffer(ctx->ReadBuffer, &x, &y, &width, &height)) { - UNLOCK_HARDWARE(intel); SET_STATE(i830, state); if (INTEL_DEBUG & DEBUG_PIXEL) fprintf(stderr, "%s: cliprect failed\n", __FUNCTION__); @@ -150,7 +147,6 @@ do_texture_readpixels(GLcontext * ctx, intel->vtbl.leave_meta_state(intel); } - UNLOCK_HARDWARE(intel); intel_region_wait_fence(ctx, dest_region); /* required by GL */ return GL_TRUE; @@ -224,7 +220,6 @@ do_blit_readpixels(GLcontext * ctx, * fire with lock held to guarentee cliprects are correct. */ intelFlush(&intel->ctx); - LOCK_HARDWARE(intel); if (intel->driReadDrawable->numClipRects) { GLboolean all = (width * height * src->cpp == dst->Base.Size && @@ -233,7 +228,7 @@ do_blit_readpixels(GLcontext * ctx, dri_bo *dst_buffer = intel_bufferobj_buffer(intel, dst, all ? INTEL_WRITE_FULL : INTEL_WRITE_PART); - __DRIdrawablePrivate *dPriv = intel->driReadDrawable; + __DRIdrawable *dPriv = intel->driReadDrawable; int nbox = dPriv->numClipRects; drm_clip_rect_t *box = dPriv->pClipRects; drm_clip_rect_t rect; @@ -261,12 +256,10 @@ do_blit_readpixels(GLcontext * ctx, rect.y2 - src_rect.y2, rect.x2 - rect.x1, rect.y2 - rect.y1, GL_COPY)) { - UNLOCK_HARDWARE(intel); return GL_FALSE; } } } - UNLOCK_HARDWARE(intel); if (INTEL_DEBUG & DEBUG_PIXEL) _mesa_printf("%s - DONE\n", __FUNCTION__); diff --git a/src/mesa/drivers/dri/intel/intel_regions.c b/src/mesa/drivers/dri/intel/intel_regions.c index d6b9dc4446..61aefa01b8 100644 --- a/src/mesa/drivers/dri/intel/intel_regions.c +++ b/src/mesa/drivers/dri/intel/intel_regions.c @@ -362,14 +362,12 @@ intel_region_data(struct intel_context *intel, intel_region_cow(intel, dst); } - LOCK_HARDWARE(intel); _mesa_copy_rect(intel_region_map(intel, dst) + dst_offset, dst->cpp, dst->pitch, dstx, dsty, width, height, src, src_pitch, srcx, srcy); intel_region_unmap(intel, dst); - UNLOCK_HARDWARE(intel); } /* Copy rectangular sub-regions. Need better logic about when to @@ -485,7 +483,6 @@ intel_region_cow(struct intel_context *intel, struct intel_region *region) /* Now blit from the texture buffer to the new buffer: */ - LOCK_HARDWARE(intel); ok = intelEmitCopyBlit(intel, region->cpp, region->pitch, pbo->buffer, 0, region->tiling, @@ -494,7 +491,6 @@ intel_region_cow(struct intel_context *intel, struct intel_region *region) region->pitch, region->height, GL_COPY); assert(ok); - UNLOCK_HARDWARE(intel); } dri_bo * @@ -510,88 +506,3 @@ intel_region_buffer(struct intel_context *intel, return region->buffer; } - -static struct intel_region * -intel_recreate_static(struct intel_context *intel, - const char *name, - struct intel_region *region, - intelRegion *region_desc) -{ - intelScreenPrivate *intelScreen = intel->intelScreen; - int ret; - - if (region == NULL) { - region = calloc(sizeof(*region), 1); - region->refcount = 1; - _DBG("%s creating new region %p\n", __FUNCTION__, region); - } - else { - _DBG("%s %p\n", __FUNCTION__, region); - } - - if (intel->ctx.Visual.rgbBits == 24) - region->cpp = 4; - else - region->cpp = intel->ctx.Visual.rgbBits / 8; - region->pitch = intelScreen->pitch; - region->width = intelScreen->width; - region->height = intelScreen->height; - - if (region->buffer != NULL) { - dri_bo_unreference(region->buffer); - region->buffer = NULL; - } - - assert(region_desc->bo_handle != -1); - region->buffer = intel_bo_gem_create_from_name(intel->bufmgr, - name, - region_desc->bo_handle); - - ret = dri_bo_get_tiling(region->buffer, ®ion->tiling, - ®ion->bit_6_swizzle); - if (ret != 0) { - fprintf(stderr, "Couldn't get tiling of buffer %d (%s): %s\n", - region_desc->bo_handle, name, strerror(-ret)); - intel_region_release(®ion); - return NULL; - } - - assert(region->buffer != NULL); - - return region; -} - -/** - * Create intel_region structs to describe the static front, back, and depth - * buffers created by the xserver. - * - * Although FBO's mean we now no longer use these as render targets in - * all circumstances, they won't go away until the back and depth - * buffers become private, and the front buffer will remain even then. - * - * Note that these don't allocate video memory, just describe - * allocations alread made by the X server. - */ -void -intel_recreate_static_regions(struct intel_context *intel) -{ - intelScreenPrivate *intelScreen = intel->intelScreen; - - intel->front_region = - intel_recreate_static(intel, "front", - intel->front_region, - &intelScreen->front); - - intel->back_region = - intel_recreate_static(intel, "back", - intel->back_region, - &intelScreen->back); - - /* Still assumes front.cpp == depth.cpp. We can kill this when we move to - * private buffers. - */ - intel->depth_region = - intel_recreate_static(intel, "depth", - intel->depth_region, - &intelScreen->depth); -} diff --git a/src/mesa/drivers/dri/intel/intel_screen.c b/src/mesa/drivers/dri/intel/intel_screen.c index 8251e91ace..e240957197 100644 --- a/src/mesa/drivers/dri/intel/intel_screen.c +++ b/src/mesa/drivers/dri/intel/intel_screen.c @@ -31,7 +31,6 @@ #include "main/renderbuffer.h" #include "utils.h" -#include "vblank.h" #include "xmlpool.h" #include "intel_batchbuffer.h" @@ -41,7 +40,6 @@ #include "intel_extensions.h" #include "intel_fbo.h" #include "intel_regions.h" -#include "intel_swapbuffers.h" #include "intel_screen.h" #include "intel_span.h" #include "intel_tex.h" @@ -104,127 +102,6 @@ const GLuint __driNConfigOptions = 11; static PFNGLXCREATECONTEXTMODES create_context_modes = NULL; #endif /*USE_NEW_INTERFACE */ -/** - * Map all the memory regions described by the screen. - * \return GL_TRUE if success, GL_FALSE if error. - */ -GLboolean -intelMapScreenRegions(__DRIscreenPrivate * sPriv) -{ - intelScreenPrivate *intelScreen = (intelScreenPrivate *) sPriv->private; - - if (0) - _mesa_printf("TEX 0x%08x ", intelScreen->tex.handle); - if (intelScreen->tex.size != 0) { - if (drmMap(sPriv->fd, - intelScreen->tex.handle, - intelScreen->tex.size, - (drmAddress *) & intelScreen->tex.map) != 0) { - intelUnmapScreenRegions(intelScreen); - return GL_FALSE; - } - } - - return GL_TRUE; -} - -void -intelUnmapScreenRegions(intelScreenPrivate * intelScreen) -{ - if (intelScreen->tex.map) { - drmUnmap(intelScreen->tex.map, intelScreen->tex.size); - intelScreen->tex.map = NULL; - } -} - - -static void -intelPrintDRIInfo(intelScreenPrivate * intelScreen, - __DRIscreenPrivate * sPriv, I830DRIPtr gDRIPriv) -{ - fprintf(stderr, "*** Front size: 0x%x offset: 0x%x pitch: %d\n", - intelScreen->front.size, intelScreen->front.offset, - intelScreen->pitch); - fprintf(stderr, "*** Back size: 0x%x offset: 0x%x pitch: %d\n", - intelScreen->back.size, intelScreen->back.offset, - intelScreen->pitch); - fprintf(stderr, "*** Depth size: 0x%x offset: 0x%x pitch: %d\n", - intelScreen->depth.size, intelScreen->depth.offset, - intelScreen->pitch); - fprintf(stderr, "*** Texture size: 0x%x offset: 0x%x\n", - intelScreen->tex.size, intelScreen->tex.offset); - fprintf(stderr, "*** Memory : 0x%x\n", gDRIPriv->mem); -} - - -static void -intelPrintSAREA(const drm_i915_sarea_t * sarea) -{ - fprintf(stderr, "SAREA: sarea width %d height %d\n", sarea->width, - sarea->height); - fprintf(stderr, "SAREA: pitch: %d\n", sarea->pitch); - fprintf(stderr, - "SAREA: front offset: 0x%08x size: 0x%x handle: 0x%x tiled: %d\n", - sarea->front_offset, sarea->front_size, - (unsigned) sarea->front_handle, sarea->front_tiled); - fprintf(stderr, - "SAREA: back offset: 0x%08x size: 0x%x handle: 0x%x tiled: %d\n", - sarea->back_offset, sarea->back_size, - (unsigned) sarea->back_handle, sarea->back_tiled); - fprintf(stderr, "SAREA: depth offset: 0x%08x size: 0x%x handle: 0x%x tiled: %d\n", - sarea->depth_offset, sarea->depth_size, - (unsigned) sarea->depth_handle, sarea->depth_tiled); - fprintf(stderr, "SAREA: tex offset: 0x%08x size: 0x%x handle: 0x%x\n", - sarea->tex_offset, sarea->tex_size, (unsigned) sarea->tex_handle); -} - - -/** - * A number of the screen parameters are obtained/computed from - * information in the SAREA. This function updates those parameters. - */ -static void -intelUpdateScreenFromSAREA(intelScreenPrivate * intelScreen, - drm_i915_sarea_t * sarea) -{ - intelScreen->width = sarea->width; - intelScreen->height = sarea->height; - intelScreen->pitch = sarea->pitch; - - intelScreen->front.offset = sarea->front_offset; - intelScreen->front.handle = sarea->front_handle; - intelScreen->front.size = sarea->front_size; - intelScreen->front.tiled = sarea->front_tiled; - - intelScreen->back.offset = sarea->back_offset; - intelScreen->back.handle = sarea->back_handle; - intelScreen->back.size = sarea->back_size; - intelScreen->back.tiled = sarea->back_tiled; - - intelScreen->depth.offset = sarea->depth_offset; - intelScreen->depth.handle = sarea->depth_handle; - intelScreen->depth.size = sarea->depth_size; - intelScreen->depth.tiled = sarea->depth_tiled; - - if (intelScreen->driScrnPriv->ddx_version.minor >= 9) { - intelScreen->front.bo_handle = sarea->front_bo_handle; - intelScreen->back.bo_handle = sarea->back_bo_handle; - intelScreen->depth.bo_handle = sarea->depth_bo_handle; - } else { - intelScreen->front.bo_handle = -1; - intelScreen->back.bo_handle = -1; - intelScreen->depth.bo_handle = -1; - } - - intelScreen->tex.offset = sarea->tex_offset; - intelScreen->logTextureGranularity = sarea->log_tex_granularity; - intelScreen->tex.handle = sarea->tex_handle; - intelScreen->tex.size = sarea->tex_size; - - if (0) - intelPrintSAREA(sarea); -} - static const __DRItexOffsetExtension intelTexOffsetExtension = { { __DRI_TEX_OFFSET }, intelSetTexOffset, @@ -263,10 +140,6 @@ static const struct __DRI2flushExtensionRec intelFlushExtension = { static const __DRIextension *intelScreenExtensions[] = { &driReadDrawableExtension, - &driCopySubBufferExtension.base, - &driSwapControlExtension.base, - &driFrameTrackingExtension.base, - &driMediaStreamCounterExtension.base, &intelTexOffsetExtension.base, &intelTexBufferExtension.base, &intelFlushExtension.base, @@ -274,7 +147,7 @@ static const __DRIextension *intelScreenExtensions[] = { }; static GLboolean -intel_get_param(__DRIscreenPrivate *psp, int param, int *value) +intel_get_param(__DRIscreen *psp, int param, int *value) { int ret; struct drm_i915_getparam gp; @@ -291,68 +164,12 @@ intel_get_param(__DRIscreenPrivate *psp, int param, int *value) return GL_TRUE; } -static GLboolean intelInitDriver(__DRIscreenPrivate *sPriv) -{ - intelScreenPrivate *intelScreen; - I830DRIPtr gDRIPriv = (I830DRIPtr) sPriv->pDevPriv; - drm_i915_sarea_t *sarea; - - if (sPriv->devPrivSize != sizeof(I830DRIRec)) { - fprintf(stderr, - "\nERROR! sizeof(I830DRIRec) does not match passed size from device driver\n"); - return GL_FALSE; - } - - /* Allocate the private area */ - intelScreen = (intelScreenPrivate *) CALLOC(sizeof(intelScreenPrivate)); - if (!intelScreen) { - fprintf(stderr, "\nERROR! Allocating private area failed\n"); - return GL_FALSE; - } - /* parse information in __driConfigOptions */ - driParseOptionInfo(&intelScreen->optionCache, - __driConfigOptions, __driNConfigOptions); - - intelScreen->driScrnPriv = sPriv; - sPriv->private = (void *) intelScreen; - sarea = (drm_i915_sarea_t *) - (((GLubyte *) sPriv->pSAREA) + gDRIPriv->sarea_priv_offset); - intelScreen->sarea = sarea; - - intelScreen->deviceID = gDRIPriv->deviceID; - - intelUpdateScreenFromSAREA(intelScreen, sarea); - - if (!intelMapScreenRegions(sPriv)) { - fprintf(stderr, "\nERROR! mapping regions\n"); - _mesa_free(intelScreen); - sPriv->private = NULL; - return GL_FALSE; - } - - if (0) - intelPrintDRIInfo(intelScreen, sPriv, gDRIPriv); - - intelScreen->drmMinor = sPriv->drm_version.minor; - - /* Determine if IRQs are active? */ - if (!intel_get_param(sPriv, I915_PARAM_IRQ_ACTIVE, - &intelScreen->irq_active)) - return GL_FALSE; - - sPriv->extensions = intelScreenExtensions; - - return GL_TRUE; -} - - static void -intelDestroyScreen(__DRIscreenPrivate * sPriv) +intelDestroyScreen(__DRIscreen * sPriv) { intelScreenPrivate *intelScreen = (intelScreenPrivate *) sPriv->private; dri_bufmgr_destroy(intelScreen->bufmgr); - intelUnmapScreenRegions(intelScreen); driDestroyOptionInfo(&intelScreen->optionCache); FREE(intelScreen); @@ -364,10 +181,12 @@ intelDestroyScreen(__DRIscreenPrivate * sPriv) * This is called when we need to set up GL rendering to a new X window. */ static GLboolean -intelCreateBuffer(__DRIscreenPrivate * driScrnPriv, - __DRIdrawablePrivate * driDrawPriv, +intelCreateBuffer(__DRIscreen * driScrnPriv, + __DRIdrawable * driDrawPriv, const __GLcontextModes * mesaVis, GLboolean isPixmap) { + struct intel_renderbuffer *rb; + if (isPixmap) { return GL_FALSE; /* not implemented */ } @@ -376,12 +195,12 @@ intelCreateBuffer(__DRIscreenPrivate * driScrnPriv, mesaVis->depthBits != 24); gl_format rgbFormat; - struct intel_framebuffer *intel_fb = CALLOC_STRUCT(intel_framebuffer); + struct gl_framebuffer *fb = CALLOC_STRUCT(gl_framebuffer); - if (!intel_fb) + if (!fb) return GL_FALSE; - _mesa_initialize_framebuffer(&intel_fb->Base, mesaVis); + _mesa_initialize_framebuffer(fb, mesaVis); if (mesaVis->redBits == 5) rgbFormat = MESA_FORMAT_RGB565; @@ -391,16 +210,12 @@ intelCreateBuffer(__DRIscreenPrivate * driScrnPriv, rgbFormat = MESA_FORMAT_ARGB8888; /* setup the hardware-based renderbuffers */ - intel_fb->color_rb[0] = intel_create_renderbuffer(rgbFormat); - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_FRONT_LEFT, - &intel_fb->color_rb[0]->Base); + rb = intel_create_renderbuffer(rgbFormat); + _mesa_add_renderbuffer(fb, BUFFER_FRONT_LEFT, &rb->Base); if (mesaVis->doubleBufferMode) { - intel_fb->color_rb[1] = intel_create_renderbuffer(rgbFormat); - - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_BACK_LEFT, - &intel_fb->color_rb[1]->Base); - + rb = intel_create_renderbuffer(rgbFormat); + _mesa_add_renderbuffer(fb, BUFFER_BACK_LEFT, &rb->Base); } if (mesaVis->depthBits == 24) { @@ -409,115 +224,63 @@ intelCreateBuffer(__DRIscreenPrivate * driScrnPriv, struct intel_renderbuffer *depthStencilRb = intel_create_renderbuffer(MESA_FORMAT_S8_Z24); /* note: bind RB to two attachment points */ - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_DEPTH, - &depthStencilRb->Base); - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_STENCIL, - &depthStencilRb->Base); + _mesa_add_renderbuffer(fb, BUFFER_DEPTH, &depthStencilRb->Base); + _mesa_add_renderbuffer(fb, BUFFER_STENCIL, &depthStencilRb->Base); } else { struct intel_renderbuffer *depthRb = intel_create_renderbuffer(MESA_FORMAT_X8_Z24); - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_DEPTH, - &depthRb->Base); + _mesa_add_renderbuffer(fb, BUFFER_DEPTH, &depthRb->Base); } } else if (mesaVis->depthBits == 16) { /* just 16-bit depth buffer, no hw stencil */ struct intel_renderbuffer *depthRb = intel_create_renderbuffer(MESA_FORMAT_Z16); - _mesa_add_renderbuffer(&intel_fb->Base, BUFFER_DEPTH, &depthRb->Base); + _mesa_add_renderbuffer(fb, BUFFER_DEPTH, &depthRb->Base); } /* now add any/all software-based renderbuffers we may need */ - _mesa_add_soft_renderbuffers(&intel_fb->Base, + _mesa_add_soft_renderbuffers(fb, GL_FALSE, /* never sw color */ GL_FALSE, /* never sw depth */ swStencil, mesaVis->accumRedBits > 0, GL_FALSE, /* never sw alpha */ GL_FALSE /* never sw aux */ ); - driDrawPriv->driverPrivate = (void *) intel_fb; + driDrawPriv->driverPrivate = fb; return GL_TRUE; } } static void -intelDestroyBuffer(__DRIdrawablePrivate * driDrawPriv) +intelDestroyBuffer(__DRIdrawable * driDrawPriv) { - struct intel_framebuffer *intel_fb = driDrawPriv->driverPrivate; - struct intel_renderbuffer *depth_rb; - struct intel_renderbuffer *stencil_rb; - - if (intel_fb) { - if (intel_fb->color_rb[0]) { - intel_renderbuffer_set_region(intel_fb->color_rb[0], NULL); - } - - if (intel_fb->color_rb[1]) { - intel_renderbuffer_set_region(intel_fb->color_rb[1], NULL); - } - - depth_rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_DEPTH); - if (depth_rb) { - intel_renderbuffer_set_region(depth_rb, NULL); - } - - stencil_rb = intel_get_renderbuffer(&intel_fb->Base, BUFFER_STENCIL); - if (stencil_rb) { - intel_renderbuffer_set_region(stencil_rb, NULL); - } - } - - _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); + struct gl_framebuffer *fb = driDrawPriv->driverPrivate; + + _mesa_reference_framebuffer(&fb, NULL); } - -/** - * Get information about previous buffer swaps. - */ -static int -intelGetSwapInfo(__DRIdrawablePrivate * dPriv, __DRIswapInfo * sInfo) -{ - struct intel_framebuffer *intel_fb; - - if ((dPriv == NULL) || (dPriv->driverPrivate == NULL) - || (sInfo == NULL)) { - return -1; - } - - intel_fb = dPriv->driverPrivate; - sInfo->swap_count = intel_fb->swap_count; - sInfo->swap_ust = intel_fb->swap_ust; - sInfo->swap_missed_count = intel_fb->swap_missed_count; - - sInfo->swap_missed_usage = (sInfo->swap_missed_count != 0) - ? driCalculateSwapUsage(dPriv, 0, intel_fb->swap_missed_ust) - : 0.0; - - return 0; -} - - /* There are probably better ways to do this, such as an * init-designated function to register chipids and createcontext * functions. */ extern GLboolean i830CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); extern GLboolean i915CreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); extern GLboolean brwCreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); static GLboolean intelCreateContext(const __GLcontextModes * mesaVis, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; intelScreenPrivate *intelScreen = (intelScreenPrivate *) sPriv->private; #ifdef I915 @@ -538,118 +301,14 @@ intelCreateContext(const __GLcontextModes * mesaVis, return GL_FALSE; } - -static __DRIconfig ** -intelFillInModes(__DRIscreenPrivate *psp, - unsigned pixel_bits, unsigned depth_bits, - unsigned stencil_bits, GLboolean have_back_buffer) -{ - __DRIconfig **configs; - __GLcontextModes *m; - unsigned depth_buffer_factor; - unsigned back_buffer_factor; - int i; - - static const GLenum back_buffer_modes[] = { - GLX_NONE, GLX_SWAP_UNDEFINED_OML, - GLX_SWAP_EXCHANGE_OML, GLX_SWAP_COPY_OML - }; - - uint8_t depth_bits_array[3]; - uint8_t stencil_bits_array[3]; - uint8_t msaa_samples_array[1]; - - depth_bits_array[0] = 0; - depth_bits_array[1] = depth_bits; - depth_bits_array[2] = depth_bits; - - /* Just like with the accumulation buffer, always provide some modes - * with a stencil buffer. It will be a sw fallback, but some apps won't - * care about that. - */ - stencil_bits_array[0] = 0; - stencil_bits_array[1] = 0; - if (depth_bits == 24) - stencil_bits_array[1] = (stencil_bits == 0) ? 8 : stencil_bits; - - stencil_bits_array[2] = (stencil_bits == 0) ? 8 : stencil_bits; - - msaa_samples_array[0] = 0; - - depth_buffer_factor = ((depth_bits != 0) || (stencil_bits != 0)) ? 3 : 1; - back_buffer_factor = (have_back_buffer) ? 3 : 1; - - if (pixel_bits == 16) { - configs = driCreateConfigs(GL_RGB, GL_UNSIGNED_SHORT_5_6_5, - depth_bits_array, stencil_bits_array, - depth_buffer_factor, back_buffer_modes, - back_buffer_factor, - msaa_samples_array, 1); - } - else { - __DRIconfig **configs_a8r8g8b8; - __DRIconfig **configs_x8r8g8b8; - - configs_a8r8g8b8 = driCreateConfigs(GL_BGRA, GL_UNSIGNED_INT_8_8_8_8_REV, - depth_bits_array, - stencil_bits_array, - depth_buffer_factor, - back_buffer_modes, - back_buffer_factor, - msaa_samples_array, 1); - configs_x8r8g8b8 = driCreateConfigs(GL_BGR, GL_UNSIGNED_INT_8_8_8_8_REV, - depth_bits_array, - stencil_bits_array, - depth_buffer_factor, - back_buffer_modes, - back_buffer_factor, - msaa_samples_array, 1); - configs = driConcatConfigs(configs_a8r8g8b8, configs_x8r8g8b8); - } - - if (configs == NULL) { - fprintf(stderr, "[%s:%u] Error creating FBConfig!\n", __func__, - __LINE__); - return NULL; - } - - /* Mark the visual as slow if there are "fake" stencil bits. - */ - for (i = 0; configs[i]; i++) { - m = &configs[i]->modes; - if ((m->stencilBits != 0) && (m->stencilBits != stencil_bits)) { - m->visualRating = GLX_SLOW_CONFIG; - } - } - - return configs; -} - static GLboolean intel_init_bufmgr(intelScreenPrivate *intelScreen) { - int gem_kernel = 0; - struct drm_i915_getparam gp; - __DRIscreenPrivate *spriv = intelScreen->driScrnPriv; + __DRIscreen *spriv = intelScreen->driScrnPriv; int num_fences = 0; intelScreen->no_hw = getenv("INTEL_NO_HW") != NULL; - gp.param = I915_PARAM_HAS_GEM; - gp.value = &gem_kernel; - - (void) drmCommandWriteRead(spriv->fd, DRM_I915_GETPARAM, &gp, sizeof(gp)); - - /* If we've got a new enough DDX that's initializing GEM and giving us - * object handles for the shared buffers, use that. - */ - if (!intelScreen->driScrnPriv->dri2.enabled && - intelScreen->driScrnPriv->ddx_version.minor < 9) { - fprintf(stderr, "[%s:%u] Error initializing GEM.\n", - __func__, __LINE__); - return GL_FALSE; - } - intelScreen->bufmgr = intel_bufmgr_gem_init(spriv->fd, BATCH_SZ); /* Otherwise, use the classic buffer manager. */ if (intelScreen->bufmgr == NULL) { @@ -668,69 +327,12 @@ intel_init_bufmgr(intelScreenPrivate *intelScreen) /** * This is the driver specific part of the createNewScreen entry point. - * Called when using legacy DRI. - * - * \todo maybe fold this into intelInitDriver - * - * \return the __GLcontextModes supported by this driver - */ -static const __DRIconfig **intelInitScreen(__DRIscreenPrivate *psp) -{ - intelScreenPrivate *intelScreen; -#ifdef I915 - static const __DRIversion ddx_expected = { 1, 5, 0 }; -#else - static const __DRIversion ddx_expected = { 1, 6, 0 }; -#endif - static const __DRIversion dri_expected = { 4, 0, 0 }; - static const __DRIversion drm_expected = { 1, 5, 0 }; - I830DRIPtr dri_priv = (I830DRIPtr) psp->pDevPriv; - - if (!driCheckDriDdxDrmVersions2("i915", - &psp->dri_version, &dri_expected, - &psp->ddx_version, &ddx_expected, - &psp->drm_version, &drm_expected)) { - return NULL; - } - - if (!intelInitDriver(psp)) - return NULL; - - psp->extensions = intelScreenExtensions; - - intelScreen = psp->private; - if (!intel_init_bufmgr(intelScreen)) - return GL_FALSE; - - return (const __DRIconfig **) - intelFillInModes(psp, dri_priv->cpp * 8, - (dri_priv->cpp == 2) ? 16 : 24, - (dri_priv->cpp == 2) ? 0 : 8, 1); -} - -struct intel_context *intelScreenContext(intelScreenPrivate *intelScreen) -{ - /* - * This should probably change to have the screen allocate a dummy - * context at screen creation. For now just use the current context. - */ - - GET_CURRENT_CONTEXT(ctx); - if (ctx == NULL) { - _mesa_problem(NULL, "No current context in intelScreenContext\n"); - return NULL; - } - return intel_context(ctx); -} - -/** - * This is the driver specific part of the createNewScreen entry point. * Called when using DRI2. * * \return the __GLcontextModes supported by this driver */ static const -__DRIconfig **intelInitScreen2(__DRIscreenPrivate *psp) +__DRIconfig **intelInitScreen2(__DRIscreen *psp) { intelScreenPrivate *intelScreen; GLenum fb_format[3]; @@ -838,19 +440,19 @@ __DRIconfig **intelInitScreen2(__DRIscreenPrivate *psp) } const struct __DriverAPIRec driDriverAPI = { - .InitScreen = intelInitScreen, .DestroyScreen = intelDestroyScreen, .CreateContext = intelCreateContext, .DestroyContext = intelDestroyContext, .CreateBuffer = intelCreateBuffer, .DestroyBuffer = intelDestroyBuffer, - .SwapBuffers = intelSwapBuffers, .MakeCurrent = intelMakeCurrent, .UnbindContext = intelUnbindContext, - .GetSwapInfo = intelGetSwapInfo, - .GetDrawableMSC = driDrawableGetMSC32, - .WaitForMSC = driWaitForMSC32, - .CopySubBuffer = intelCopySubBuffer, - .InitScreen2 = intelInitScreen2, }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driDRI2Extension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/intel/intel_screen.h b/src/mesa/drivers/dri/intel/intel_screen.h index 14ca0903b6..e87e306d86 100644 --- a/src/mesa/drivers/dri/intel/intel_screen.h +++ b/src/mesa/drivers/dri/intel/intel_screen.h @@ -66,7 +66,7 @@ typedef struct int logTextureGranularity; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; volatile drm_i915_sarea_t *sarea; @@ -88,18 +88,18 @@ typedef struct -extern GLboolean intelMapScreenRegions(__DRIscreenPrivate * sPriv); +extern GLboolean intelMapScreenRegions(__DRIscreen * sPriv); extern void intelUnmapScreenRegions(intelScreenPrivate * intelScreen); -extern void intelDestroyContext(__DRIcontextPrivate * driContextPriv); +extern void intelDestroyContext(__DRIcontext * driContextPriv); -extern GLboolean intelUnbindContext(__DRIcontextPrivate * driContextPriv); +extern GLboolean intelUnbindContext(__DRIcontext * driContextPriv); extern GLboolean -intelMakeCurrent(__DRIcontextPrivate * driContextPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv); +intelMakeCurrent(__DRIcontext * driContextPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv); extern struct intel_context *intelScreenContext(intelScreenPrivate *intelScreen); diff --git a/src/mesa/drivers/dri/intel/intel_span.c b/src/mesa/drivers/dri/intel/intel_span.c index d1681e9088..605734d8e5 100644 --- a/src/mesa/drivers/dri/intel/intel_span.c +++ b/src/mesa/drivers/dri/intel/intel_span.c @@ -517,7 +517,6 @@ intelSpanRenderStart(GLcontext * ctx) GLuint i; intelFlush(&intel->ctx); - LOCK_HARDWARE(intel); for (i = 0; i < ctx->Const.MaxTextureImageUnits; i++) { if (ctx->Texture.Unit[i]._ReallyEnabled) { @@ -553,8 +552,6 @@ intelSpanRenderFinish(GLcontext * ctx) intel_map_unmap_framebuffer(intel, ctx->DrawBuffer, GL_FALSE); if (ctx->ReadBuffer != ctx->DrawBuffer) intel_map_unmap_framebuffer(intel, ctx->ReadBuffer, GL_FALSE); - - UNLOCK_HARDWARE(intel); } diff --git a/src/mesa/drivers/dri/intel/intel_swapbuffers.c b/src/mesa/drivers/dri/intel/intel_swapbuffers.c deleted file mode 100644 index 5ae1240718..0000000000 --- a/src/mesa/drivers/dri/intel/intel_swapbuffers.c +++ /dev/null @@ -1,248 +0,0 @@ -/************************************************************************** - * - * Copyright 2003 Tungsten Graphics, Inc., Cedar Park, Texas. - * All Rights Reserved. - * - * Permission is hereby granted, free of charge, to any person obtaining a - * copy of this software and associated documentation files (the - * "Software"), to deal in the Software without restriction, including - * without limitation the rights to use, copy, modify, merge, publish, - * distribute, sub license, and/or sell copies of the Software, and to - * permit persons to whom the Software is furnished to do so, subject to - * the following conditions: - * - * The above copyright notice and this permission notice (including the - * next paragraph) shall be included in all copies or substantial portions - * of the Software. - * - * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS - * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF - * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. - * IN NO EVENT SHALL TUNGSTEN GRAPHICS AND/OR ITS SUPPLIERS BE LIABLE FOR - * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, - * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE - * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - * - **************************************************************************/ - -#include "intel_blit.h" -#include "intel_buffers.h" -#include "intel_swapbuffers.h" -#include "intel_fbo.h" -#include "intel_batchbuffer.h" -#include "drirenderbuffer.h" -#include "vblank.h" -#include "i915_drm.h" - - - -/* - * Correct a drawablePrivate's set of vblank flags WRT the current context. - * When considering multiple crtcs. - */ -GLuint -intelFixupVblank(struct intel_context *intel, __DRIdrawablePrivate *dPriv) -{ - if (!intel->intelScreen->driScrnPriv->dri2.enabled && - intel->intelScreen->driScrnPriv->ddx_version.minor >= 7) { - volatile drm_i915_sarea_t *sarea = intel->sarea; - drm_clip_rect_t drw_rect = { .x1 = dPriv->x, .x2 = dPriv->x + dPriv->w, - .y1 = dPriv->y, .y2 = dPriv->y + dPriv->h }; - drm_clip_rect_t planeA_rect = { .x1 = sarea->planeA_x, .y1 = sarea->planeA_y, - .x2 = sarea->planeA_x + sarea->planeA_w, - .y2 = sarea->planeA_y + sarea->planeA_h }; - drm_clip_rect_t planeB_rect = { .x1 = sarea->planeB_x, .y1 = sarea->planeB_y, - .x2 = sarea->planeB_x + sarea->planeB_w, - .y2 = sarea->planeB_y + sarea->planeB_h }; - GLint areaA = driIntersectArea( drw_rect, planeA_rect ); - GLint areaB = driIntersectArea( drw_rect, planeB_rect ); - GLuint flags; - - /* Update vblank info - */ - if (areaB > areaA || (areaA == areaB && areaB > 0)) { - flags = dPriv->vblFlags | VBLANK_FLAG_SECONDARY; - } else { - flags = dPriv->vblFlags & ~VBLANK_FLAG_SECONDARY; - } - - /* Do the stupid test: Is one of them actually disabled? - */ - if (sarea->planeA_w == 0 || sarea->planeA_h == 0) { - flags = dPriv->vblFlags | VBLANK_FLAG_SECONDARY; - } else if (sarea->planeB_w == 0 || sarea->planeB_h == 0) { - flags = dPriv->vblFlags & ~VBLANK_FLAG_SECONDARY; - } - - return flags; - } else { - return dPriv->vblFlags & ~VBLANK_FLAG_SECONDARY; - } -} - - -/** - * Called from driSwapBuffers() - */ -void -intelSwapBuffers(__DRIdrawablePrivate * dPriv) -{ - __DRIscreenPrivate *psp = dPriv->driScreenPriv; - - if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { - GET_CURRENT_CONTEXT(ctx); - struct intel_context *intel; - - if (ctx == NULL) - return; - - intel = intel_context(ctx); - - if (ctx->Visual.doubleBufferMode) { - GLboolean missed_target; - struct intel_framebuffer *intel_fb = dPriv->driverPrivate; - int64_t ust; - - _mesa_notifySwapBuffers(ctx); /* flush pending rendering comands */ - - /* - * The old swapping ioctl was incredibly racy, just wait for vblank - * and do the swap ourselves. - */ - driWaitForVBlank(dPriv, &missed_target); - - /* - * Update each buffer's vbl_pending so we don't get too out of - * sync - */ - intel_get_renderbuffer(&intel_fb->Base, - BUFFER_BACK_LEFT)->vbl_pending = dPriv->vblSeq; - intel_get_renderbuffer(&intel_fb->Base, - BUFFER_FRONT_LEFT)->vbl_pending = dPriv->vblSeq; - - intelCopyBuffer(dPriv, NULL); - - intel_fb->swap_count++; - (*psp->systemTime->getUST) (&ust); - if (missed_target) { - intel_fb->swap_missed_count++; - intel_fb->swap_missed_ust = ust - intel_fb->swap_ust; - } - - intel_fb->swap_ust = ust; - } - drmCommandNone(intel->driFd, DRM_I915_GEM_THROTTLE); - } - else { - /* XXX this shouldn't be an error but we can't handle it for now */ - fprintf(stderr, "%s: drawable has no context!\n", __FUNCTION__); - } -} - - -/** - * Called from driCopySubBuffer() - */ -void -intelCopySubBuffer(__DRIdrawablePrivate * dPriv, int x, int y, int w, int h) -{ - if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { - struct intel_context *intel = - (struct intel_context *) dPriv->driContextPriv->driverPrivate; - GLcontext *ctx = &intel->ctx; - - if (ctx->Visual.doubleBufferMode) { - drm_clip_rect_t rect; - rect.x1 = x + dPriv->x; - rect.y1 = (dPriv->h - y - h) + dPriv->y; - rect.x2 = rect.x1 + w; - rect.y2 = rect.y1 + h; - _mesa_notifySwapBuffers(ctx); /* flush pending rendering comands */ - intelCopyBuffer(dPriv, &rect); - } - } - else { - /* XXX this shouldn't be an error but we can't handle it for now */ - fprintf(stderr, "%s: drawable has no context!\n", __FUNCTION__); - } -} - - -/** - * This will be called whenever the currently bound window is moved/resized. - * XXX: actually, it seems to NOT be called when the window is only moved (BP). - */ -void -intelWindowMoved(struct intel_context *intel) -{ - GLcontext *ctx = &intel->ctx; - __DRIdrawablePrivate *dPriv = intel->driDrawable; - struct intel_framebuffer *intel_fb = dPriv->driverPrivate; - - if (!intel->intelScreen->driScrnPriv->dri2.enabled && - intel->intelScreen->driScrnPriv->ddx_version.minor >= 7) { - GLuint flags = intelFixupVblank(intel, dPriv); - - /* Check to see if we changed pipes */ - if (flags != dPriv->vblFlags && dPriv->vblFlags && - !(dPriv->vblFlags & VBLANK_FLAG_NO_IRQ)) { - int64_t count; - drmVBlank vbl; - int i; - - /* - * Deal with page flipping - */ - vbl.request.type = DRM_VBLANK_ABSOLUTE; - - if ( dPriv->vblFlags & VBLANK_FLAG_SECONDARY ) { - vbl.request.type |= DRM_VBLANK_SECONDARY; - } - - for (i = 0; i < 2; i++) { - if (!intel_fb->color_rb[i] || - (intel_fb->vbl_waited - intel_fb->color_rb[i]->vbl_pending) <= - (1<<23)) - continue; - - vbl.request.sequence = intel_fb->color_rb[i]->vbl_pending; - drmWaitVBlank(intel->driFd, &vbl); - } - - /* - * Update msc_base from old pipe - */ - driDrawableGetMSC32(dPriv->driScreenPriv, dPriv, &count); - dPriv->msc_base = count; - /* - * Then get new vblank_base and vblSeq values - */ - dPriv->vblFlags = flags; - driGetCurrentVBlank(dPriv); - dPriv->vblank_base = dPriv->vblSeq; - - intel_fb->vbl_waited = dPriv->vblSeq; - - for (i = 0; i < 2; i++) { - if (intel_fb->color_rb[i]) - intel_fb->color_rb[i]->vbl_pending = intel_fb->vbl_waited; - } - } - } else { - dPriv->vblFlags &= ~VBLANK_FLAG_SECONDARY; - } - - /* Update Mesa's notion of window size */ - driUpdateFramebufferSize(ctx, dPriv); - intel_fb->Base.Initialized = GL_TRUE; /* XXX remove someday */ - - /* Update hardware scissor */ - if (ctx->Driver.Scissor != NULL) { - ctx->Driver.Scissor(ctx, ctx->Scissor.X, ctx->Scissor.Y, - ctx->Scissor.Width, ctx->Scissor.Height); - } - - /* Re-calculate viewport related state */ - if (ctx->Driver.DepthRange != NULL) - ctx->Driver.DepthRange( ctx, ctx->Viewport.Near, ctx->Viewport.Far ); -} diff --git a/src/mesa/drivers/dri/intel/intel_tex_copy.c b/src/mesa/drivers/dri/intel/intel_tex_copy.c index ee953cfbe7..d8e71093c4 100644 --- a/src/mesa/drivers/dri/intel/intel_tex_copy.c +++ b/src/mesa/drivers/dri/intel/intel_tex_copy.c @@ -110,7 +110,6 @@ do_copy_texsubimage(struct intel_context *intel, } /* intelFlush(ctx); */ - LOCK_HARDWARE(intel); { drm_intel_bo *dst_bo = intel_region_buffer(intel, intelImage->mt->region, @@ -132,13 +131,12 @@ do_copy_texsubimage(struct intel_context *intel, /* Can't blit to tiled buffers with non-tile-aligned offset. */ if (intelImage->mt->region->tiling == I915_TILING_Y) { - UNLOCK_HARDWARE(intel); return GL_FALSE; } if (ctx->ReadBuffer->Name == 0) { /* reading from a window, adjust x, y */ - const __DRIdrawablePrivate *dPriv = intel->driReadDrawable; + const __DRIdrawable *dPriv = intel->driReadDrawable; y = dPriv->y + (dPriv->h - (y + height)); x += dPriv->x; @@ -160,22 +158,20 @@ do_copy_texsubimage(struct intel_context *intel, intelImage->mt->cpp, src_pitch, src->buffer, - src->draw_offset, + 0, src->tiling, intelImage->mt->pitch, dst_bo, 0, intelImage->mt->region->tiling, - x, y, image_x + dstx, image_y + dsty, + src->draw_x + x, src->draw_y + y, + image_x + dstx, image_y + dsty, width, height, GL_COPY)) { - UNLOCK_HARDWARE(intel); return GL_FALSE; } } - UNLOCK_HARDWARE(intel); - return GL_TRUE; } diff --git a/src/mesa/drivers/dri/intel/intel_tex_image.c b/src/mesa/drivers/dri/intel/intel_tex_image.c index a8f7e6c456..6f41eafd0e 100644 --- a/src/mesa/drivers/dri/intel/intel_tex_image.c +++ b/src/mesa/drivers/dri/intel/intel_tex_image.c @@ -235,7 +235,6 @@ try_pbo_upload(struct intel_context *intel, if (drm_intel_bo_references(intel->batch->buf, dst_buffer)) intelFlush(&intel->ctx); - LOCK_HARDWARE(intel); { dri_bo *src_buffer = intel_bufferobj_buffer(intel, pbo, INTEL_READ); @@ -245,11 +244,9 @@ try_pbo_upload(struct intel_context *intel, dst_stride, dst_buffer, 0, GL_FALSE, 0, 0, dst_x, dst_y, width, height, GL_COPY)) { - UNLOCK_HARDWARE(intel); return GL_FALSE; } } - UNLOCK_HARDWARE(intel); return GL_TRUE; } @@ -469,8 +466,6 @@ intelTexImage(GLcontext * ctx, pixels, unpack, "glTexImage"); } - LOCK_HARDWARE(intel); - if (intelImage->mt) { if (pixels != NULL) { /* Flush any queued rendering with the texture before mapping. */ @@ -551,8 +546,6 @@ intelTexImage(GLcontext * ctx, intel_miptree_image_unmap(intel, intelImage->mt); texImage->Data = NULL; } - - UNLOCK_HARDWARE(intel); } @@ -732,7 +725,7 @@ intelSetTexBuffer2(__DRIcontext *pDRICtx, GLint target, GLint glx_texture_format, __DRIdrawable *dPriv) { - struct intel_framebuffer *intel_fb = dPriv->driverPrivate; + struct gl_framebuffer *fb = dPriv->driverPrivate; struct intel_context *intel = pDRICtx->driverPrivate; GLcontext *ctx = &intel->ctx; struct intel_texture_object *intelObj; @@ -752,7 +745,7 @@ intelSetTexBuffer2(__DRIcontext *pDRICtx, GLint target, if (!dPriv->validBuffers) intel_update_renderbuffers(pDRICtx, dPriv); - rb = intel_fb->color_rb[0]; + rb = intel_get_renderbuffer(fb, BUFFER_FRONT_LEFT); /* If the region isn't set, then intel_update_renderbuffers was unable * to get the buffers for the drawable. */ diff --git a/src/mesa/drivers/dri/intel/intel_tex_subimage.c b/src/mesa/drivers/dri/intel/intel_tex_subimage.c index 1f68208266..7f1dc89022 100644 --- a/src/mesa/drivers/dri/intel/intel_tex_subimage.c +++ b/src/mesa/drivers/dri/intel/intel_tex_subimage.c @@ -72,8 +72,6 @@ intelTexSubimage(GLcontext * ctx, if (!pixels) return; - LOCK_HARDWARE(intel); - /* Map buffer if necessary. Need to lock to prevent other contexts * from uploading the buffer under us. */ @@ -129,8 +127,6 @@ intelTexSubimage(GLcontext * ctx, intel_miptree_image_unmap(intel, intelImage->mt); texImage->Data = NULL; } - - UNLOCK_HARDWARE(intel); } diff --git a/src/mesa/drivers/dri/mach64/mach64_context.c b/src/mesa/drivers/dri/mach64/mach64_context.c index 2bca293b3c..3b4ef7ffd8 100644 --- a/src/mesa/drivers/dri/mach64/mach64_context.c +++ b/src/mesa/drivers/dri/mach64/mach64_context.c @@ -89,11 +89,11 @@ static const struct dri_extension card_extensions[] = /* Create the device specific context. */ GLboolean mach64CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *driScreen = driContextPriv->driScreenPriv; + __DRIscreen *driScreen = driContextPriv->driScreenPriv; struct dd_function_table functions; mach64ContextPtr mmesa; mach64ScreenPtr mach64Screen; @@ -260,7 +260,7 @@ GLboolean mach64CreateContext( const __GLcontextModes *glVisual, /* Destroy the device specific context. */ -void mach64DestroyContext( __DRIcontextPrivate *driContextPriv ) +void mach64DestroyContext( __DRIcontext *driContextPriv ) { mach64ContextPtr mmesa = (mach64ContextPtr) driContextPriv->driverPrivate; @@ -307,9 +307,9 @@ void mach64DestroyContext( __DRIcontextPrivate *driContextPriv ) * buffer `b'. */ GLboolean -mach64MakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ) +mach64MakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ) { if ( driContextPriv ) { GET_CURRENT_CONTEXT(ctx); @@ -352,7 +352,7 @@ mach64MakeCurrent( __DRIcontextPrivate *driContextPriv, /* Force the context `c' to be unbound from its buffer. */ GLboolean -mach64UnbindContext( __DRIcontextPrivate *driContextPriv ) +mach64UnbindContext( __DRIcontext *driContextPriv ) { return GL_TRUE; } diff --git a/src/mesa/drivers/dri/mach64/mach64_context.h b/src/mesa/drivers/dri/mach64/mach64_context.h index 854751626d..18fc859d01 100644 --- a/src/mesa/drivers/dri/mach64/mach64_context.h +++ b/src/mesa/drivers/dri/mach64/mach64_context.h @@ -232,9 +232,9 @@ struct mach64_context { /* Mirrors of some DRI state */ - __DRIcontextPrivate *driContext; /* DRI context */ - __DRIscreenPrivate *driScreen; /* DRI screen */ - __DRIdrawablePrivate *driDrawable; /* DRI drawable bound to this ctx */ + __DRIcontext *driContext; /* DRI context */ + __DRIscreen *driScreen; /* DRI screen */ + __DRIdrawable *driDrawable; /* DRI drawable bound to this ctx */ unsigned int lastStamp; /* mirror driDrawable->lastStamp */ @@ -274,16 +274,16 @@ struct mach64_context { extern GLboolean mach64CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ); -extern void mach64DestroyContext( __DRIcontextPrivate * ); +extern void mach64DestroyContext( __DRIcontext * ); -extern GLboolean mach64MakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ); +extern GLboolean mach64MakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ); -extern GLboolean mach64UnbindContext( __DRIcontextPrivate *driContextPriv ); +extern GLboolean mach64UnbindContext( __DRIcontext *driContextPriv ); /* ================================================================ * Byte ordering diff --git a/src/mesa/drivers/dri/mach64/mach64_ioctl.c b/src/mesa/drivers/dri/mach64/mach64_ioctl.c index ef5c0625c3..03587c44fd 100644 --- a/src/mesa/drivers/dri/mach64/mach64_ioctl.c +++ b/src/mesa/drivers/dri/mach64/mach64_ioctl.c @@ -279,7 +279,7 @@ static int mach64WaitForFrameCompletion( mach64ContextPtr mmesa ) /* Copy the back color buffer to the front color buffer. */ -void mach64CopyBuffer( __DRIdrawablePrivate *dPriv ) +void mach64CopyBuffer( __DRIdrawable *dPriv ) { mach64ContextPtr mmesa; GLint nbox, i, ret; @@ -668,7 +668,7 @@ void mach64PerformanceBoxesLocked( mach64ContextPtr mmesa ) static void mach64DDClear( GLcontext *ctx, GLbitfield mask ) { mach64ContextPtr mmesa = MACH64_CONTEXT( ctx ); - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; drm_mach64_clear_t clear; GLuint flags = 0; GLint i; diff --git a/src/mesa/drivers/dri/mach64/mach64_ioctl.h b/src/mesa/drivers/dri/mach64/mach64_ioctl.h index 6ef9bc0bca..1ffda1932f 100644 --- a/src/mesa/drivers/dri/mach64/mach64_ioctl.h +++ b/src/mesa/drivers/dri/mach64/mach64_ioctl.h @@ -78,7 +78,7 @@ extern void mach64FireBlitLocked( mach64ContextPtr mmesa, void *buffer, GLint offset, GLint pitch, GLint format, GLint x, GLint y, GLint width, GLint height ); -extern void mach64CopyBuffer( __DRIdrawablePrivate *dPriv ); +extern void mach64CopyBuffer( __DRIdrawable *dPriv ); #if ENABLE_PERF_BOXES extern void mach64PerformanceCounters( mach64ContextPtr mmesa ); extern void mach64PerformanceBoxesLocked( mach64ContextPtr mmesa ); diff --git a/src/mesa/drivers/dri/mach64/mach64_lock.c b/src/mesa/drivers/dri/mach64/mach64_lock.c index d018ba4174..8653c77da5 100644 --- a/src/mesa/drivers/dri/mach64/mach64_lock.c +++ b/src/mesa/drivers/dri/mach64/mach64_lock.c @@ -51,8 +51,8 @@ int prevLockLine = 0; */ void mach64GetLock( mach64ContextPtr mmesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; - __DRIscreenPrivate *sPriv = mmesa->driScreen; + __DRIdrawable *dPriv = mmesa->driDrawable; + __DRIscreen *sPriv = mmesa->driScreen; drm_mach64_sarea_t *sarea = mmesa->sarea; int i; diff --git a/src/mesa/drivers/dri/mach64/mach64_screen.c b/src/mesa/drivers/dri/mach64/mach64_screen.c index 3b19cf5333..1ed3b0b70e 100644 --- a/src/mesa/drivers/dri/mach64/mach64_screen.c +++ b/src/mesa/drivers/dri/mach64/mach64_screen.c @@ -68,7 +68,7 @@ static const GLuint __driNConfigOptions = 2; #endif static const __DRIconfig ** -mach64FillInModes( __DRIscreenPrivate *psp, +mach64FillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -144,7 +144,7 @@ mach64FillInModes( __DRIscreenPrivate *psp, /* Create the device specific screen private data struct. */ static mach64ScreenRec * -mach64CreateScreen( __DRIscreenPrivate *sPriv ) +mach64CreateScreen( __DRIscreen *sPriv ) { mach64ScreenPtr mach64Screen; ATIDRIPtr serverInfo = (ATIDRIPtr)sPriv->pDevPriv; @@ -272,7 +272,7 @@ mach64CreateScreen( __DRIscreenPrivate *sPriv ) /* Destroy the device specific screen private data struct. */ static void -mach64DestroyScreen( __DRIscreenPrivate *driScreen ) +mach64DestroyScreen( __DRIscreen *driScreen ) { mach64ScreenRec *mach64Screen = (mach64ScreenRec *) driScreen->private; @@ -299,8 +299,8 @@ mach64DestroyScreen( __DRIscreenPrivate *driScreen ) * data. */ static GLboolean -mach64CreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +mach64CreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -370,7 +370,7 @@ mach64CreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -mach64DestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +mach64DestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } @@ -378,7 +378,7 @@ mach64DestroyBuffer(__DRIdrawablePrivate *driDrawPriv) /* Copy the back color buffer to the front color buffer */ static void -mach64SwapBuffers(__DRIdrawablePrivate *dPriv) +mach64SwapBuffers(__DRIdrawable *dPriv) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { mach64ContextPtr mmesa; @@ -400,7 +400,7 @@ mach64SwapBuffers(__DRIdrawablePrivate *dPriv) /* Initialize the driver specific screen private data. */ static GLboolean -mach64InitDriver( __DRIscreenPrivate *driScreen ) +mach64InitDriver( __DRIscreen *driScreen ) { driScreen->private = (void *) mach64CreateScreen( driScreen ); @@ -420,7 +420,7 @@ mach64InitDriver( __DRIscreenPrivate *driScreen ) * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -mach64InitScreen(__DRIscreenPrivate *psp) +mach64InitScreen(__DRIscreen *psp) { static const __DRIversion ddx_expected = { 6, 4, 0 }; static const __DRIversion dri_expected = { 4, 0, 0 }; @@ -457,3 +457,9 @@ const struct __DriverAPIRec driDriverAPI = { .SwapBuffersMSC = NULL }; +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/mach64/mach64_screen.h b/src/mesa/drivers/dri/mach64/mach64_screen.h index be5e29a3e5..1966809c03 100644 --- a/src/mesa/drivers/dri/mach64/mach64_screen.h +++ b/src/mesa/drivers/dri/mach64/mach64_screen.h @@ -70,7 +70,7 @@ typedef struct { drmBufMapPtr buffers; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; driOptionCache optionCache; diff --git a/src/mesa/drivers/dri/mach64/mach64_span.c b/src/mesa/drivers/dri/mach64/mach64_span.c index 500319e0e3..b4ba2a41c9 100644 --- a/src/mesa/drivers/dri/mach64/mach64_span.c +++ b/src/mesa/drivers/dri/mach64/mach64_span.c @@ -40,8 +40,8 @@ #define LOCAL_VARS \ mach64ContextPtr mmesa = MACH64_CONTEXT(ctx); \ - __DRIscreenPrivate *sPriv = mmesa->driScreen; \ - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; \ + __DRIscreen *sPriv = mmesa->driScreen; \ + __DRIdrawable *dPriv = mmesa->driDrawable; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ GLuint height = dPriv->h; \ GLushort p; \ @@ -49,8 +49,8 @@ #define LOCAL_DEPTH_VARS \ mach64ContextPtr mmesa = MACH64_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; \ - __DRIscreenPrivate *driScreen = mmesa->driScreen; \ + __DRIdrawable *dPriv = mmesa->driDrawable; \ + __DRIscreen *driScreen = mmesa->driScreen; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ GLuint height = dPriv->h; \ char *buf = (char *)(driScreen->pFB + drb->offset + \ diff --git a/src/mesa/drivers/dri/mach64/mach64_state.c b/src/mesa/drivers/dri/mach64/mach64_state.c index 902905de71..df7cbc8670 100644 --- a/src/mesa/drivers/dri/mach64/mach64_state.c +++ b/src/mesa/drivers/dri/mach64/mach64_state.c @@ -388,7 +388,7 @@ static void mach64UpdateClipping( GLcontext *ctx ) mach64ScreenPtr mach64Screen = mmesa->mach64Screen; if ( mmesa->driDrawable ) { - __DRIdrawablePrivate *drawable = mmesa->driDrawable; + __DRIdrawable *drawable = mmesa->driDrawable; int x1 = 0; int y1 = 0; int x2 = drawable->w - 1; @@ -689,7 +689,7 @@ static void mach64DDLogicOpCode( GLcontext *ctx, GLenum opcode ) void mach64SetCliprects( GLcontext *ctx, GLenum mode ) { mach64ContextPtr mmesa = MACH64_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; switch ( mode ) { case GL_FRONT_LEFT: diff --git a/src/mesa/drivers/dri/mach64/mach64_tex.c b/src/mesa/drivers/dri/mach64/mach64_tex.c index 72917ee13b..6627d3c38a 100644 --- a/src/mesa/drivers/dri/mach64/mach64_tex.c +++ b/src/mesa/drivers/dri/mach64/mach64_tex.c @@ -130,7 +130,7 @@ mach64AllocTexObj( struct gl_texture_object *texObj ) mach64SetTexWrap( t, texObj->WrapS, texObj->WrapT ); mach64SetTexFilter( t, texObj->MinFilter, texObj->MagFilter ); - mach64SetTexBorderColor( t, texObj->BorderColor ); + mach64SetTexBorderColor( t, texObj->BorderColor.f ); return t; } @@ -470,7 +470,7 @@ static void mach64DDTexParameter( GLcontext *ctx, GLenum target, case GL_TEXTURE_BORDER_COLOR: if ( t->base.bound ) FLUSH_BATCH( mmesa ); - mach64SetTexBorderColor( t, tObj->BorderColor ); + mach64SetTexBorderColor( t, tObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: diff --git a/src/mesa/drivers/dri/mga/mga_xmesa.c b/src/mesa/drivers/dri/mga/mga_xmesa.c index 2c7f50c498..f835cb8bd6 100644 --- a/src/mesa/drivers/dri/mga/mga_xmesa.c +++ b/src/mesa/drivers/dri/mga/mga_xmesa.c @@ -108,7 +108,7 @@ int MGA_DEBUG = 0; #endif static const __DRIconfig ** -mgaFillInModes( __DRIscreenPrivate *psp, +mgaFillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -190,7 +190,7 @@ const __DRIextension *mgaScreenExtensions[] = { }; static GLboolean -mgaInitDriver(__DRIscreenPrivate *sPriv) +mgaInitDriver(__DRIscreen *sPriv) { mgaScreenPrivate *mgaScreen; MGADRIPtr serverInfo = (MGADRIPtr)sPriv->pDevPriv; @@ -332,7 +332,7 @@ mgaInitDriver(__DRIscreenPrivate *sPriv) static void -mgaDestroyScreen(__DRIscreenPrivate *sPriv) +mgaDestroyScreen(__DRIscreen *sPriv) { mgaScreenPrivate *mgaScreen = (mgaScreenPrivate *) sPriv->private; @@ -426,14 +426,14 @@ static const struct dri_debug_control debug_control[] = static GLboolean mgaCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { int i; unsigned maxlevels; GLcontext *ctx, *shareCtx; mgaContextPtr mmesa; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; mgaScreenPrivate *mgaScreen = (mgaScreenPrivate *)sPriv->private; drm_mga_sarea_t *saPriv = (drm_mga_sarea_t *)(((char*)sPriv->pSAREA)+ mgaScreen->sarea_priv_offset); @@ -645,7 +645,7 @@ mgaCreateContext( const __GLcontextModes *mesaVis, } static void -mgaDestroyContext(__DRIcontextPrivate *driContextPriv) +mgaDestroyContext(__DRIcontext *driContextPriv) { mgaContextPtr mmesa = (mgaContextPtr) driContextPriv->driverPrivate; @@ -697,8 +697,8 @@ mgaDestroyContext(__DRIcontextPrivate *driContextPriv) static GLboolean -mgaCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +mgaCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -814,13 +814,13 @@ mgaCreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -mgaDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +mgaDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } static void -mgaSwapBuffers(__DRIdrawablePrivate *dPriv) +mgaSwapBuffers(__DRIdrawable *dPriv) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { mgaContextPtr mmesa; @@ -839,7 +839,7 @@ mgaSwapBuffers(__DRIdrawablePrivate *dPriv) } static GLboolean -mgaUnbindContext(__DRIcontextPrivate *driContextPriv) +mgaUnbindContext(__DRIcontext *driContextPriv) { mgaContextPtr mmesa = (mgaContextPtr) driContextPriv->driverPrivate; if (mmesa) @@ -855,9 +855,9 @@ mgaUnbindContext(__DRIcontextPrivate *driContextPriv) * But why are we doing context initialization here??? */ static GLboolean -mgaMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +mgaMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (driContextPriv) { mgaContextPtr mmesa = (mgaContextPtr) driContextPriv->driverPrivate; @@ -892,7 +892,7 @@ mgaMakeCurrent(__DRIcontextPrivate *driContextPriv, void mgaGetLock( mgaContextPtr mmesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; drm_mga_sarea_t *sarea = mmesa->sarea; int me = mmesa->hHWContext; int i; @@ -960,7 +960,7 @@ static const __DRIconfig **mgaInitScreen(__DRIscreen *psp) * Get information about previous buffer swaps. */ static int -getSwapInfo( __DRIdrawablePrivate *dPriv, __DRIswapInfo * sInfo ) +getSwapInfo( __DRIdrawable *dPriv, __DRIswapInfo * sInfo ) { mgaContextPtr mmesa; @@ -998,3 +998,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/mga/mga_xmesa.h b/src/mesa/drivers/dri/mga/mga_xmesa.h index 07c22bd596..aee146090c 100644 --- a/src/mesa/drivers/dri/mga/mga_xmesa.h +++ b/src/mesa/drivers/dri/mga/mga_xmesa.h @@ -67,7 +67,7 @@ typedef struct mga_screen_private_s { char *texVirtual[MGA_NR_TEX_HEAPS]; - __DRIscreenPrivate *sPriv; + __DRIscreen *sPriv; drmBufMapPtr bufs; drmRegion mmio; diff --git a/src/mesa/drivers/dri/mga/mgacontext.h b/src/mesa/drivers/dri/mga/mgacontext.h index 30640a29b3..4141565931 100644 --- a/src/mesa/drivers/dri/mga/mgacontext.h +++ b/src/mesa/drivers/dri/mga/mgacontext.h @@ -294,10 +294,10 @@ struct mga_context_t { drm_context_t hHWContext; drm_hw_lock_t *driHwLock; int driFd; - __DRIdrawablePrivate *driDrawable; - __DRIdrawablePrivate *driReadable; + __DRIdrawable *driDrawable; + __DRIdrawable *driReadable; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; struct mga_screen_private_s *mgaScreen; drm_mga_sarea_t *sarea; diff --git a/src/mesa/drivers/dri/mga/mgaioctl.c b/src/mesa/drivers/dri/mga/mgaioctl.c index 4438bad920..8ce5d802ab 100644 --- a/src/mesa/drivers/dri/mga/mgaioctl.c +++ b/src/mesa/drivers/dri/mga/mgaioctl.c @@ -207,7 +207,7 @@ static void mgaClear( GLcontext *ctx, GLbitfield mask ) { mgaContextPtr mmesa = MGA_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; GLuint flags = 0; GLuint clear_color = mmesa->ClearColor; GLuint clear_depth = 0; @@ -409,7 +409,7 @@ static void mgaWaitForFrameCompletion( mgaContextPtr mmesa ) /* * Copy the back buffer to the front buffer. */ -void mgaCopyBuffer( __DRIdrawablePrivate *dPriv ) +void mgaCopyBuffer( __DRIdrawable *dPriv ) { mgaContextPtr mmesa; drm_clip_rect_t *pbox; @@ -417,7 +417,7 @@ void mgaCopyBuffer( __DRIdrawablePrivate *dPriv ) GLint ret; GLint i; GLboolean missed_target; - __DRIscreenPrivate *psp = dPriv->driScreenPriv; + __DRIscreen *psp = dPriv->driScreenPriv; assert(dPriv); assert(dPriv->driContextPriv); diff --git a/src/mesa/drivers/dri/mga/mgaioctl.h b/src/mesa/drivers/dri/mga/mgaioctl.h index dbc823de80..7a8660d203 100644 --- a/src/mesa/drivers/dri/mga/mgaioctl.h +++ b/src/mesa/drivers/dri/mga/mgaioctl.h @@ -32,7 +32,7 @@ #include "mgacontext.h" #include "mga_xmesa.h" -void mgaCopyBuffer( __DRIdrawablePrivate *dPriv ); +void mgaCopyBuffer( __DRIdrawable *dPriv ); void mgaWaitForVBlank( mgaContextPtr mmesa ); void mgaGetILoadBufferLocked( mgaContextPtr mmesa ); diff --git a/src/mesa/drivers/dri/mga/mgapixel.c b/src/mesa/drivers/dri/mga/mgapixel.c index 05b30ba61e..69415f8a83 100644 --- a/src/mesa/drivers/dri/mga/mgapixel.c +++ b/src/mesa/drivers/dri/mga/mgapixel.c @@ -299,7 +299,7 @@ mgaTryReadPixels( GLcontext *ctx, #if 0 { - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; int nbox, retcode, i; UPDATE_LOCK( mmesa, DRM_LOCK_FLUSH | DRM_LOCK_QUIESCENT ); @@ -399,7 +399,7 @@ static void do_draw_pix( GLcontext *ctx, #if 0 mgaContextPtr mmesa = MGA_CONTEXT(ctx); drmMGABlit blit; - __DRIdrawablePrivate *dPriv = mmesa->driDrawable; + __DRIdrawable *dPriv = mmesa->driDrawable; drm_clip_rect_t pbox = dPriv->pClipRects; int nbox = dPriv->numClipRects; int retcode, i; diff --git a/src/mesa/drivers/dri/mga/mgaspan.c b/src/mesa/drivers/dri/mga/mgaspan.c index 2ff1cac8e2..10606c152c 100644 --- a/src/mesa/drivers/dri/mga/mgaspan.c +++ b/src/mesa/drivers/dri/mga/mgaspan.c @@ -36,9 +36,9 @@ #define LOCAL_VARS \ mgaContextPtr mmesa = MGA_CONTEXT(ctx); \ - __DRIscreenPrivate *sPriv = mmesa->driScreen; \ + __DRIscreen *sPriv = mmesa->driScreen; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ - const __DRIdrawablePrivate *dPriv = drb->dPriv; \ + const __DRIdrawable *dPriv = drb->dPriv; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ char *buf = (char *)(sPriv->pFB + \ @@ -52,9 +52,9 @@ #define LOCAL_DEPTH_VARS \ mgaContextPtr mmesa = MGA_CONTEXT(ctx); \ - __DRIscreenPrivate *sPriv = mmesa->driScreen; \ + __DRIscreen *sPriv = mmesa->driScreen; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ - const __DRIdrawablePrivate *dPriv = drb->dPriv; \ + const __DRIdrawable *dPriv = drb->dPriv; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ char *buf = (char *)(sPriv->pFB + \ diff --git a/src/mesa/drivers/dri/mga/mgastate.c b/src/mesa/drivers/dri/mga/mgastate.c index 1e51057534..0253044761 100644 --- a/src/mesa/drivers/dri/mga/mgastate.c +++ b/src/mesa/drivers/dri/mga/mgastate.c @@ -746,7 +746,7 @@ static void mgaDDLogicOp( GLcontext *ctx, GLenum opcode ) static void mga_set_cliprects(mgaContextPtr mmesa) { - __DRIdrawablePrivate *driDrawable = mmesa->driDrawable; + __DRIdrawable *driDrawable = mmesa->driDrawable; if ((mmesa->draw_buffer != MGA_FRONT) || (driDrawable->numBackClipRects == 0)) { @@ -774,8 +774,8 @@ static void mga_set_cliprects(mgaContextPtr mmesa) void mgaUpdateRects( mgaContextPtr mmesa, GLuint buffers ) { - __DRIdrawablePrivate *const driDrawable = mmesa->driDrawable; - __DRIdrawablePrivate *const driReadable = mmesa->driReadable; + __DRIdrawable *const driDrawable = mmesa->driDrawable; + __DRIdrawable *const driReadable = mmesa->driReadable; mmesa->dirty_cliprects = 0; diff --git a/src/mesa/drivers/dri/mga/mgatex.c b/src/mesa/drivers/dri/mga/mgatex.c index 9163371b33..62a9317cd4 100644 --- a/src/mesa/drivers/dri/mga/mgatex.c +++ b/src/mesa/drivers/dri/mga/mgatex.c @@ -332,7 +332,7 @@ mgaAllocTexObj( struct gl_texture_object *tObj ) mgaSetTexWrapping( t, tObj->WrapS, tObj->WrapT ); mgaSetTexFilter( t, tObj->MinFilter, tObj->MagFilter ); - mgaSetTexBorderColor( t, tObj->BorderColor ); + mgaSetTexBorderColor( t, tObj->BorderColor.f ); } return( t ); @@ -461,7 +461,7 @@ mgaTexParameter( GLcontext *ctx, GLenum target, case GL_TEXTURE_BORDER_COLOR: FLUSH_BATCH(mmesa); - mgaSetTexBorderColor(t, tObj->BorderColor); + mgaSetTexBorderColor(t, tObj->BorderColor.f); break; case GL_TEXTURE_BASE_LEVEL: diff --git a/src/mesa/drivers/dri/r128/r128_context.c b/src/mesa/drivers/dri/r128/r128_context.c index 0b250876c5..e389e1c87b 100644 --- a/src/mesa/drivers/dri/r128/r128_context.c +++ b/src/mesa/drivers/dri/r128/r128_context.c @@ -101,11 +101,11 @@ static const struct dri_debug_control debug_control[] = /* Create the device specific context. */ GLboolean r128CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; struct dd_function_table functions; r128ContextPtr rmesa; r128ScreenPtr r128scrn; @@ -274,7 +274,7 @@ GLboolean r128CreateContext( const __GLcontextModes *glVisual, /* Destroy the device specific context. */ -void r128DestroyContext( __DRIcontextPrivate *driContextPriv ) +void r128DestroyContext( __DRIcontext *driContextPriv ) { r128ContextPtr rmesa = (r128ContextPtr) driContextPriv->driverPrivate; @@ -325,9 +325,9 @@ void r128DestroyContext( __DRIcontextPrivate *driContextPriv ) * buffer `b'. */ GLboolean -r128MakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ) +r128MakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ) { if ( driContextPriv ) { GET_CURRENT_CONTEXT(ctx); @@ -364,7 +364,7 @@ r128MakeCurrent( __DRIcontextPrivate *driContextPriv, /* Force the context `c' to be unbound from its buffer. */ GLboolean -r128UnbindContext( __DRIcontextPrivate *driContextPriv ) +r128UnbindContext( __DRIcontext *driContextPriv ) { return GL_TRUE; } diff --git a/src/mesa/drivers/dri/r128/r128_context.h b/src/mesa/drivers/dri/r128/r128_context.h index 0e10209a6a..65f845c115 100644 --- a/src/mesa/drivers/dri/r128/r128_context.h +++ b/src/mesa/drivers/dri/r128/r128_context.h @@ -186,9 +186,9 @@ struct r128_context { /* Mirrors of some DRI state */ - __DRIcontextPrivate *driContext; /* DRI context */ - __DRIscreenPrivate *driScreen; /* DRI screen */ - __DRIdrawablePrivate *driDrawable; /* DRI drawable bound to this ctx */ + __DRIcontext *driContext; /* DRI context */ + __DRIscreen *driScreen; /* DRI screen */ + __DRIdrawable *driDrawable; /* DRI drawable bound to this ctx */ unsigned int lastStamp; /* mirror driDrawable->lastStamp */ @@ -225,16 +225,16 @@ struct r128_context { extern GLboolean r128CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ); -extern void r128DestroyContext( __DRIcontextPrivate * ); +extern void r128DestroyContext( __DRIcontext * ); -extern GLboolean r128MakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ); +extern GLboolean r128MakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ); -extern GLboolean r128UnbindContext( __DRIcontextPrivate *driContextPriv ); +extern GLboolean r128UnbindContext( __DRIcontext *driContextPriv ); /* ================================================================ * Debugging: diff --git a/src/mesa/drivers/dri/r128/r128_ioctl.c b/src/mesa/drivers/dri/r128/r128_ioctl.c index 84ac3d9f79..56758d971c 100644 --- a/src/mesa/drivers/dri/r128/r128_ioctl.c +++ b/src/mesa/drivers/dri/r128/r128_ioctl.c @@ -248,7 +248,7 @@ static int r128WaitForFrameCompletion( r128ContextPtr rmesa ) /* Copy the back color buffer to the front color buffer. */ -void r128CopyBuffer( __DRIdrawablePrivate *dPriv ) +void r128CopyBuffer( __DRIdrawable *dPriv ) { r128ContextPtr rmesa; GLint nbox, i, ret; @@ -327,7 +327,7 @@ void r128CopyBuffer( __DRIdrawablePrivate *dPriv ) #endif } -void r128PageFlip( __DRIdrawablePrivate *dPriv ) +void r128PageFlip( __DRIdrawable *dPriv ) { r128ContextPtr rmesa; GLint ret; @@ -401,7 +401,7 @@ void r128PageFlip( __DRIdrawablePrivate *dPriv ) static void r128Clear( GLcontext *ctx, GLbitfield mask ) { r128ContextPtr rmesa = R128_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = rmesa->driDrawable; + __DRIdrawable *dPriv = rmesa->driDrawable; drm_r128_clear_t clear; GLuint flags = 0; GLint i; diff --git a/src/mesa/drivers/dri/r128/r128_ioctl.h b/src/mesa/drivers/dri/r128/r128_ioctl.h index 4b0c9cdc7f..84ace900ee 100644 --- a/src/mesa/drivers/dri/r128/r128_ioctl.h +++ b/src/mesa/drivers/dri/r128/r128_ioctl.h @@ -85,8 +85,8 @@ extern void r128ReadDepthSpanLocked( r128ContextPtr rmesa, extern void r128ReadDepthPixelsLocked( r128ContextPtr rmesa, GLuint n, const GLint x[], const GLint y[] ); -extern void r128CopyBuffer( __DRIdrawablePrivate *dPriv ); -extern void r128PageFlip( __DRIdrawablePrivate *dPriv ); +extern void r128CopyBuffer( __DRIdrawable *dPriv ); +extern void r128PageFlip( __DRIdrawable *dPriv ); void r128WaitForVBlank( r128ContextPtr rmesa ); extern void r128WaitForIdleLocked( r128ContextPtr rmesa ); diff --git a/src/mesa/drivers/dri/r128/r128_lock.c b/src/mesa/drivers/dri/r128/r128_lock.c index 81488a2742..9bc3515b5a 100644 --- a/src/mesa/drivers/dri/r128/r128_lock.c +++ b/src/mesa/drivers/dri/r128/r128_lock.c @@ -68,8 +68,8 @@ r128UpdatePageFlipping( r128ContextPtr rmesa ) */ void r128GetLock( r128ContextPtr rmesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = rmesa->driDrawable; - __DRIscreenPrivate *sPriv = rmesa->driScreen; + __DRIdrawable *dPriv = rmesa->driDrawable; + __DRIscreen *sPriv = rmesa->driScreen; drm_r128_sarea_t *sarea = rmesa->sarea; int i; diff --git a/src/mesa/drivers/dri/r128/r128_screen.c b/src/mesa/drivers/dri/r128/r128_screen.c index 9da3b5fb73..80b265811e 100644 --- a/src/mesa/drivers/dri/r128/r128_screen.c +++ b/src/mesa/drivers/dri/r128/r128_screen.c @@ -91,7 +91,7 @@ static const GLuint __driNConfigOptions = 3; /* Create the device specific screen private data struct. */ static r128ScreenPtr -r128CreateScreen( __DRIscreenPrivate *sPriv ) +r128CreateScreen( __DRIscreen *sPriv ) { r128ScreenPtr r128Screen; R128DRIPtr r128DRIPriv = (R128DRIPtr)sPriv->pDevPriv; @@ -236,7 +236,7 @@ r128CreateScreen( __DRIscreenPrivate *sPriv ) /* Destroy the device specific screen private data struct. */ static void -r128DestroyScreen( __DRIscreenPrivate *sPriv ) +r128DestroyScreen( __DRIscreen *sPriv ) { r128ScreenPtr r128Screen = (r128ScreenPtr)sPriv->private; @@ -262,8 +262,8 @@ r128DestroyScreen( __DRIscreenPrivate *sPriv ) * data. */ static GLboolean -r128CreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +r128CreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -349,7 +349,7 @@ r128CreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -r128DestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +r128DestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } @@ -357,7 +357,7 @@ r128DestroyBuffer(__DRIdrawablePrivate *driDrawPriv) /* Copy the back color buffer to the front color buffer */ static void -r128SwapBuffers(__DRIdrawablePrivate *dPriv) +r128SwapBuffers(__DRIdrawable *dPriv) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { r128ContextPtr rmesa; @@ -384,7 +384,7 @@ r128SwapBuffers(__DRIdrawablePrivate *dPriv) /* Initialize the driver specific screen private data. */ static GLboolean -r128InitDriver( __DRIscreenPrivate *sPriv ) +r128InitDriver( __DRIscreen *sPriv ) { sPriv->private = (void *) r128CreateScreen( sPriv ); @@ -397,7 +397,7 @@ r128InitDriver( __DRIscreenPrivate *sPriv ) } static const __DRIconfig ** -r128FillInModes( __DRIscreenPrivate *psp, +r128FillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -478,7 +478,7 @@ r128FillInModes( __DRIscreenPrivate *psp, * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -r128InitScreen(__DRIscreenPrivate *psp) +r128InitScreen(__DRIscreen *psp) { static const __DRIversion ddx_expected = { 4, 0, 0 }; static const __DRIversion dri_expected = { 4, 0, 0 }; @@ -517,3 +517,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/r128/r128_screen.h b/src/mesa/drivers/dri/r128/r128_screen.h index e2fa1677c9..8d450adff3 100644 --- a/src/mesa/drivers/dri/r128/r128_screen.h +++ b/src/mesa/drivers/dri/r128/r128_screen.h @@ -71,7 +71,7 @@ typedef struct { drmBufMapPtr buffers; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; unsigned int sarea_priv_offset; /* Configuration cache with default values for all contexts */ diff --git a/src/mesa/drivers/dri/r128/r128_span.c b/src/mesa/drivers/dri/r128/r128_span.c index d238cc3c94..0413e5b4f1 100644 --- a/src/mesa/drivers/dri/r128/r128_span.c +++ b/src/mesa/drivers/dri/r128/r128_span.c @@ -50,8 +50,8 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. #define LOCAL_VARS \ r128ContextPtr rmesa = R128_CONTEXT(ctx); \ - __DRIscreenPrivate *sPriv = rmesa->driScreen; \ - __DRIdrawablePrivate *dPriv = rmesa->driDrawable; \ + __DRIscreen *sPriv = rmesa->driScreen; \ + __DRIdrawable *dPriv = rmesa->driDrawable; \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ GLuint height = dPriv->h; \ GLuint p; \ @@ -60,8 +60,8 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. #define LOCAL_DEPTH_VARS \ r128ContextPtr rmesa = R128_CONTEXT(ctx); \ r128ScreenPtr r128scrn = rmesa->r128Screen; \ - __DRIscreenPrivate *sPriv = rmesa->driScreen; \ - __DRIdrawablePrivate *dPriv = rmesa->driDrawable; \ + __DRIscreen *sPriv = rmesa->driScreen; \ + __DRIdrawable *dPriv = rmesa->driDrawable; \ GLuint height = dPriv->h; \ (void) r128scrn; (void) sPriv; (void) height diff --git a/src/mesa/drivers/dri/r128/r128_state.c b/src/mesa/drivers/dri/r128/r128_state.c index ac175d59ec..2254a7a4ff 100644 --- a/src/mesa/drivers/dri/r128/r128_state.c +++ b/src/mesa/drivers/dri/r128/r128_state.c @@ -572,7 +572,7 @@ static void r128UpdateClipping( GLcontext *ctx ) r128ContextPtr rmesa = R128_CONTEXT(ctx); if ( rmesa->driDrawable ) { - __DRIdrawablePrivate *drawable = rmesa->driDrawable; + __DRIdrawable *drawable = rmesa->driDrawable; int x1 = 0; int y1 = 0; int x2 = drawable->w - 1; diff --git a/src/mesa/drivers/dri/r128/r128_tex.c b/src/mesa/drivers/dri/r128/r128_tex.c index 0a1207fb89..f1be7cc1c4 100644 --- a/src/mesa/drivers/dri/r128/r128_tex.c +++ b/src/mesa/drivers/dri/r128/r128_tex.c @@ -169,7 +169,7 @@ static r128TexObjPtr r128AllocTexObj( struct gl_texture_object *texObj ) r128SetTexWrap( t, texObj->WrapS, texObj->WrapT ); r128SetTexFilter( t, texObj->MinFilter, texObj->MagFilter ); - r128SetTexBorderColor( t, texObj->BorderColor ); + r128SetTexBorderColor( t, texObj->BorderColor.f ); } return t; @@ -535,7 +535,7 @@ static void r128TexParameter( GLcontext *ctx, GLenum target, case GL_TEXTURE_BORDER_COLOR: if ( t->base.bound ) FLUSH_BATCH( rmesa ); - r128SetTexBorderColor( t, tObj->BorderColor ); + r128SetTexBorderColor( t, tObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: diff --git a/src/mesa/drivers/dri/r200/r200_context.c b/src/mesa/drivers/dri/r200/r200_context.c index 5f985d624d..f34e319222 100644 --- a/src/mesa/drivers/dri/r200/r200_context.c +++ b/src/mesa/drivers/dri/r200/r200_context.c @@ -274,10 +274,10 @@ static void r200_init_vtbl(radeonContextPtr radeon) /* Create the device specific rendering context. */ GLboolean r200CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; radeonScreenPtr screen = (radeonScreenPtr)(sPriv->private); struct dd_function_table functions; r200ContextPtr rmesa; @@ -496,7 +496,7 @@ GLboolean r200CreateContext( const __GLcontextModes *glVisual, } -void r200DestroyContext( __DRIcontextPrivate *driContextPriv ) +void r200DestroyContext( __DRIcontext *driContextPriv ) { int i; r200ContextPtr rmesa = (r200ContextPtr)driContextPriv->driverPrivate; diff --git a/src/mesa/drivers/dri/r200/r200_context.h b/src/mesa/drivers/dri/r200/r200_context.h index 246f98c6dc..17e4d8962e 100644 --- a/src/mesa/drivers/dri/r200/r200_context.h +++ b/src/mesa/drivers/dri/r200/r200_context.h @@ -636,14 +636,14 @@ struct r200_context { #define R200_CONTEXT(ctx) ((r200ContextPtr)(ctx->DriverCtx)) -extern void r200DestroyContext( __DRIcontextPrivate *driContextPriv ); +extern void r200DestroyContext( __DRIcontext *driContextPriv ); extern GLboolean r200CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate); -extern GLboolean r200MakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ); -extern GLboolean r200UnbindContext( __DRIcontextPrivate *driContextPriv ); +extern GLboolean r200MakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ); +extern GLboolean r200UnbindContext( __DRIcontext *driContextPriv ); /* ================================================================ * Debugging: diff --git a/src/mesa/drivers/dri/r200/r200_ioctl.c b/src/mesa/drivers/dri/r200/r200_ioctl.c index b238adb972..66c5d3655a 100644 --- a/src/mesa/drivers/dri/r200/r200_ioctl.c +++ b/src/mesa/drivers/dri/r200/r200_ioctl.c @@ -61,7 +61,7 @@ WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. static void r200KernelClear(GLcontext *ctx, GLuint flags) { r200ContextPtr rmesa = R200_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLint cx, cy, cw, ch, ret; GLuint i; @@ -185,7 +185,7 @@ static void r200KernelClear(GLcontext *ctx, GLuint flags) static void r200Clear( GLcontext *ctx, GLbitfield mask ) { r200ContextPtr rmesa = R200_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLuint flags = 0; GLuint color_mask = 0; GLuint orig_mask = mask; diff --git a/src/mesa/drivers/dri/r200/r200_pixel.c b/src/mesa/drivers/dri/r200/r200_pixel.c index 94e43c7d66..bfb7e2a2ed 100644 --- a/src/mesa/drivers/dri/r200/r200_pixel.c +++ b/src/mesa/drivers/dri/r200/r200_pixel.c @@ -214,7 +214,7 @@ r200TryReadPixels( GLcontext *ctx, } { - __DRIdrawablePrivate *dPriv = rmesa->radeon.dri.drawable; + __DRIdrawable *dPriv = rmesa->radeon.dri.drawable; driRenderbuffer *drb = (driRenderbuffer *) ctx->ReadBuffer->_ColorReadBuffer; int nbox = dPriv->numClipRects; int src_offset = drb->offset @@ -298,7 +298,7 @@ static void do_draw_pix( GLcontext *ctx, #if 0 r200ContextPtr rmesa = R200_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); drm_clip_rect_t *box = dPriv->pClipRects; struct gl_renderbuffer *rb = ctx->ReadBuffer->_ColorDrawBuffers[0]; driRenderbuffer *drb = (driRenderbuffer *) rb; diff --git a/src/mesa/drivers/dri/r200/r200_state.c b/src/mesa/drivers/dri/r200/r200_state.c index 529cb62264..7fe482fe15 100644 --- a/src/mesa/drivers/dri/r200/r200_state.c +++ b/src/mesa/drivers/dri/r200/r200_state.c @@ -1585,7 +1585,7 @@ static void r200ClearStencil( GLcontext *ctx, GLint s ) void r200UpdateWindow( GLcontext *ctx ) { r200ContextPtr rmesa = R200_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = dPriv ? (GLfloat) dPriv->x : 0; GLfloat yoffset = dPriv ? (GLfloat) dPriv->y + dPriv->h : 0; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -1665,7 +1665,7 @@ static void r200DepthRange( GLcontext *ctx, GLclampd nearval, void r200UpdateViewportOffset( GLcontext *ctx ) { r200ContextPtr rmesa = R200_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = (GLfloat)dPriv->x; GLfloat yoffset = (GLfloat)dPriv->y + dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; diff --git a/src/mesa/drivers/dri/r200/r200_tex.c b/src/mesa/drivers/dri/r200/r200_tex.c index a417721553..5b87ba6ccd 100644 --- a/src/mesa/drivers/dri/r200/r200_tex.c +++ b/src/mesa/drivers/dri/r200/r200_tex.c @@ -378,7 +378,7 @@ static void r200TexParameter( GLcontext *ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - r200SetTexBorderColor( t, texObj->BorderColor ); + r200SetTexBorderColor( t, texObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: @@ -470,7 +470,7 @@ static struct gl_texture_object *r200NewTextureObject(GLcontext * ctx, r200SetTexWrap( t, t->base.WrapS, t->base.WrapT, t->base.WrapR ); r200SetTexMaxAnisotropy( t, t->base.MaxAnisotropy ); r200SetTexFilter(t, t->base.MinFilter, t->base.MagFilter); - r200SetTexBorderColor(t, t->base.BorderColor); + r200SetTexBorderColor(t, t->base.BorderColor.f); return &t->base; } diff --git a/src/mesa/drivers/dri/r300/compiler/memory_pool.c b/src/mesa/drivers/dri/r300/compiler/memory_pool.c index 37aa2b6579..76c7c60d8f 100644 --- a/src/mesa/drivers/dri/r300/compiler/memory_pool.c +++ b/src/mesa/drivers/dri/r300/compiler/memory_pool.c @@ -71,12 +71,14 @@ static void refill_pool(struct memory_pool * pool) void * memory_pool_malloc(struct memory_pool * pool, unsigned int bytes) { if (bytes < POOL_LARGE_ALLOC) { + void * ptr; + if (pool->head + bytes > pool->end) refill_pool(pool); assert(pool->head + bytes <= pool->end); - void * ptr = pool->head; + ptr = pool->head; pool->head += bytes; pool->head = (unsigned char*)(((unsigned long)pool->head + POOL_ALIGN - 1) & ~(POOL_ALIGN - 1)); diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_code.c b/src/mesa/drivers/dri/r300/compiler/radeon_code.c index 1a3d8bb641..853b2becd1 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_code.c +++ b/src/mesa/drivers/dri/r300/compiler/radeon_code.c @@ -143,7 +143,8 @@ unsigned rc_constants_add_immediate_scalar(struct rc_constant_list * c, float da for(index = 0; index < c->Count; ++index) { if (c->Constants[index].Type == RC_CONSTANT_IMMEDIATE) { - for(unsigned comp = 0; comp < c->Constants[index].Size; ++comp) { + unsigned comp; + for(comp = 0; comp < c->Constants[index].Size; ++comp) { if (c->Constants[index].u.Immediate[comp] == data) { *swizzle = RC_MAKE_SWIZZLE(comp, comp, comp, comp); return index; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_code.h b/src/mesa/drivers/dri/r300/compiler/radeon_code.h index 902b7cfa53..6d979bbaec 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_code.h +++ b/src/mesa/drivers/dri/r300/compiler/radeon_code.h @@ -59,7 +59,9 @@ enum { RC_STATE_SHADOW_AMBIENT = 0, RC_STATE_R300_WINDOW_DIMENSION, - RC_STATE_R300_TEXRECT_FACTOR + RC_STATE_R300_TEXRECT_FACTOR, + RC_STATE_R300_VIEWPORT_SCALE, + RC_STATE_R300_VIEWPORT_OFFSET }; struct rc_constant { diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_compiler.c b/src/mesa/drivers/dri/r300/compiler/radeon_compiler.c index c0e7a7f7a0..272f9072d4 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_compiler.c +++ b/src/mesa/drivers/dri/r300/compiler/radeon_compiler.c @@ -229,15 +229,20 @@ void rc_copy_output(struct radeon_compiler * c, unsigned output, unsigned dup_ou /** * Introduce standard code fragment to deal with fragment.position. */ -void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsigned new_input) +void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsigned new_input, + int full_vtransform) { unsigned tempregi = rc_find_free_temporary(c); + struct rc_instruction * inst_rcp; + struct rc_instruction * inst_mul; + struct rc_instruction * inst_mad; + struct rc_instruction * inst; c->Program.InputsRead &= ~(1 << wpos); c->Program.InputsRead |= 1 << new_input; /* perspective divide */ - struct rc_instruction * inst_rcp = rc_insert_new_instruction(c, &c->Program.Instructions); + inst_rcp = rc_insert_new_instruction(c, &c->Program.Instructions); inst_rcp->U.I.Opcode = RC_OPCODE_RCP; inst_rcp->U.I.DstReg.File = RC_FILE_TEMPORARY; @@ -248,7 +253,7 @@ void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsig inst_rcp->U.I.SrcReg[0].Index = new_input; inst_rcp->U.I.SrcReg[0].Swizzle = RC_SWIZZLE_WWWW; - struct rc_instruction * inst_mul = rc_insert_new_instruction(c, inst_rcp); + inst_mul = rc_insert_new_instruction(c, inst_rcp); inst_mul->U.I.Opcode = RC_OPCODE_MUL; inst_mul->U.I.DstReg.File = RC_FILE_TEMPORARY; @@ -263,7 +268,7 @@ void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsig inst_mul->U.I.SrcReg[1].Swizzle = RC_SWIZZLE_WWWW; /* viewport transformation */ - struct rc_instruction * inst_mad = rc_insert_new_instruction(c, inst_mul); + inst_mad = rc_insert_new_instruction(c, inst_mul); inst_mad->U.I.Opcode = RC_OPCODE_MAD; inst_mad->U.I.DstReg.File = RC_FILE_TEMPORARY; @@ -275,14 +280,19 @@ void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsig inst_mad->U.I.SrcReg[0].Swizzle = RC_MAKE_SWIZZLE(RC_SWIZZLE_X, RC_SWIZZLE_Y, RC_SWIZZLE_Z, RC_SWIZZLE_ZERO); inst_mad->U.I.SrcReg[1].File = RC_FILE_CONSTANT; - inst_mad->U.I.SrcReg[1].Index = rc_constants_add_state(&c->Program.Constants, RC_STATE_R300_WINDOW_DIMENSION, 0); inst_mad->U.I.SrcReg[1].Swizzle = RC_MAKE_SWIZZLE(RC_SWIZZLE_X, RC_SWIZZLE_Y, RC_SWIZZLE_Z, RC_SWIZZLE_ZERO); inst_mad->U.I.SrcReg[2].File = RC_FILE_CONSTANT; - inst_mad->U.I.SrcReg[2].Index = inst_mad->U.I.SrcReg[1].Index; inst_mad->U.I.SrcReg[2].Swizzle = RC_MAKE_SWIZZLE(RC_SWIZZLE_X, RC_SWIZZLE_Y, RC_SWIZZLE_Z, RC_SWIZZLE_ZERO); - struct rc_instruction * inst; + if (full_vtransform) { + inst_mad->U.I.SrcReg[1].Index = rc_constants_add_state(&c->Program.Constants, RC_STATE_R300_VIEWPORT_SCALE, 0); + inst_mad->U.I.SrcReg[2].Index = rc_constants_add_state(&c->Program.Constants, RC_STATE_R300_VIEWPORT_OFFSET, 0); + } else { + inst_mad->U.I.SrcReg[1].Index = + inst_mad->U.I.SrcReg[2].Index = rc_constants_add_state(&c->Program.Constants, RC_STATE_R300_WINDOW_DIMENSION, 0); + } + for (inst = inst_mad->Next; inst != &c->Program.Instructions; inst = inst->Next) { const struct rc_opcode_info * opcode = rc_get_opcode_info(inst->U.I.Opcode); unsigned i; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_compiler.h b/src/mesa/drivers/dri/r300/compiler/radeon_compiler.h index 87a732cd90..731adc1af2 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_compiler.h +++ b/src/mesa/drivers/dri/r300/compiler/radeon_compiler.h @@ -73,7 +73,8 @@ void rc_calculate_inputs_outputs(struct radeon_compiler * c); void rc_move_input(struct radeon_compiler * c, unsigned input, struct rc_src_register new_input); void rc_move_output(struct radeon_compiler * c, unsigned output, unsigned new_output, unsigned writemask); void rc_copy_output(struct radeon_compiler * c, unsigned output, unsigned dup_output); -void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsigned new_input); +void rc_transform_fragment_wpos(struct radeon_compiler * c, unsigned wpos, unsigned new_input, + int full_vtransform); struct r300_fragment_program_compiler { struct radeon_compiler Base; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_pair_regalloc.c b/src/mesa/drivers/dri/r300/compiler/radeon_pair_regalloc.c index 828d0c8e28..b2fe7f76b2 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_pair_regalloc.c +++ b/src/mesa/drivers/dri/r300/compiler/radeon_pair_regalloc.c @@ -49,7 +49,7 @@ struct register_info { unsigned int Used:1; unsigned int Allocated:1; - rc_register_file File:3; + unsigned int File:3; unsigned int Index:RC_REGISTER_INDEX_BITS; }; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_program.c b/src/mesa/drivers/dri/r300/compiler/radeon_program.c index 0dbc5380bb..a3c41d7bd4 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_program.c +++ b/src/mesa/drivers/dri/r300/compiler/radeon_program.c @@ -94,10 +94,11 @@ unsigned int rc_find_free_temporary(struct radeon_compiler * c) { char used[RC_REGISTER_MAX_INDEX]; unsigned int i; + struct rc_instruction * rcinst; memset(used, 0, sizeof(used)); - for (struct rc_instruction * rcinst = c->Program.Instructions.Next; rcinst != &c->Program.Instructions; rcinst = rcinst->Next) { + for (rcinst = c->Program.Instructions.Next; rcinst != &c->Program.Instructions; rcinst = rcinst->Next) { const struct rc_sub_instruction *inst = &rcinst->U.I; const struct rc_opcode_info *opcode = rc_get_opcode_info(inst->Opcode); unsigned int k; @@ -168,8 +169,9 @@ void rc_remove_instruction(struct rc_instruction * inst) unsigned int rc_recompute_ips(struct radeon_compiler * c) { unsigned int ip = 0; + struct rc_instruction * inst; - for(struct rc_instruction * inst = c->Program.Instructions.Next; + for(inst = c->Program.Instructions.Next; inst != &c->Program.Instructions; inst = inst->Next) { inst->IP = ip++; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_program.h b/src/mesa/drivers/dri/r300/compiler/radeon_program.h index 03592884eb..e318867696 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_program.h +++ b/src/mesa/drivers/dri/r300/compiler/radeon_program.h @@ -39,7 +39,7 @@ struct radeon_compiler; struct rc_src_register { - rc_register_file File:3; + unsigned int File:3; /** Negative values may be used for relative addressing. */ signed int Index:(RC_REGISTER_INDEX_BITS+1); @@ -55,7 +55,7 @@ struct rc_src_register { }; struct rc_dst_register { - rc_register_file File:3; + unsigned int File:3; /** Negative values may be used for relative addressing. */ signed int Index:(RC_REGISTER_INDEX_BITS+1); @@ -79,20 +79,20 @@ struct rc_sub_instruction { /** * Opcode of this instruction, according to \ref rc_opcode enums. */ - rc_opcode Opcode:8; + unsigned int Opcode:8; /** * Saturate each value of the result to the range [0,1] or [-1,1], * according to \ref rc_saturate_mode enums. */ - rc_saturate_mode SaturateMode:2; + unsigned int SaturateMode:2; /** * Writing to the special register RC_SPECIAL_ALU_RESULT */ /*@{*/ - rc_write_aluresult WriteALUResult:2; - rc_compare_func ALUResultCompare:3; + unsigned int WriteALUResult:2; + unsigned int ALUResultCompare:3; /*@}*/ /** @@ -103,7 +103,7 @@ struct rc_sub_instruction { unsigned int TexSrcUnit:5; /** Source texture target, one of the \ref rc_texture_target enums */ - rc_texture_target TexSrcTarget:3; + unsigned int TexSrcTarget:3; /** True if tex instruction should do shadow comparison */ unsigned int TexShadow:1; diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_program_alu.c b/src/mesa/drivers/dri/r300/compiler/radeon_program_alu.c index ced66af1eb..b5c08aea49 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_program_alu.c +++ b/src/mesa/drivers/dri/r300/compiler/radeon_program_alu.c @@ -267,9 +267,9 @@ static void transform_LIT(struct radeon_compiler* c, temp = inst->U.I.DstReg.Index; srctemp = srcreg(RC_FILE_TEMPORARY, temp); - // tmp.x = max(0.0, Src.x); - // tmp.y = max(0.0, Src.y); - // tmp.w = clamp(Src.z, -128+eps, 128-eps); + /* tmp.x = max(0.0, Src.x); */ + /* tmp.y = max(0.0, Src.y); */ + /* tmp.w = clamp(Src.z, -128+eps, 128-eps); */ emit2(c, inst->Prev, RC_OPCODE_MAX, 0, dstregtmpmask(temp, RC_MASK_XYW), inst->U.I.SrcReg[0], @@ -280,7 +280,7 @@ static void transform_LIT(struct radeon_compiler* c, swizzle(srctemp, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W), negate(srcregswz(RC_FILE_CONSTANT, constant, constant_swizzle))); - // tmp.w = Pow(tmp.y, tmp.w) + /* tmp.w = Pow(tmp.y, tmp.w) */ emit1(c, inst->Prev, RC_OPCODE_LG2, 0, dstregtmpmask(temp, RC_MASK_W), swizzle(srctemp, RC_SWIZZLE_Y, RC_SWIZZLE_Y, RC_SWIZZLE_Y, RC_SWIZZLE_Y)); @@ -292,14 +292,14 @@ static void transform_LIT(struct radeon_compiler* c, dstregtmpmask(temp, RC_MASK_W), swizzle(srctemp, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W)); - // tmp.z = (tmp.x > 0) ? tmp.w : 0.0 + /* tmp.z = (tmp.x > 0) ? tmp.w : 0.0 */ emit3(c, inst->Prev, RC_OPCODE_CMP, inst->U.I.SaturateMode, dstregtmpmask(temp, RC_MASK_Z), negate(swizzle(srctemp, RC_SWIZZLE_X, RC_SWIZZLE_X, RC_SWIZZLE_X, RC_SWIZZLE_X)), swizzle(srctemp, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W, RC_SWIZZLE_W), builtin_zero); - // tmp.x, tmp.y, tmp.w = 1.0, tmp.x, 1.0 + /* tmp.x, tmp.y, tmp.w = 1.0, tmp.x, 1.0 */ emit1(c, inst->Prev, RC_OPCODE_MOV, inst->U.I.SaturateMode, dstregtmpmask(temp, RC_MASK_XYW), swizzle(srctemp, RC_SWIZZLE_ONE, RC_SWIZZLE_X, RC_SWIZZLE_ONE, RC_SWIZZLE_ONE)); @@ -533,16 +533,16 @@ static void sincos_constants(struct radeon_compiler* c, unsigned int *constants) { static const float SinCosConsts[2][4] = { { - 1.273239545, // 4/PI - -0.405284735, // -4/(PI*PI) - 3.141592654, // PI - 0.2225 // weight + 1.273239545, /* 4/PI */ + -0.405284735, /* -4/(PI*PI) */ + 3.141592654, /* PI */ + 0.2225 /* weight */ }, { 0.75, 0.5, - 0.159154943, // 1/(2*PI) - 6.283185307 // 2*PI + 0.159154943, /* 1/(2*PI) */ + 6.283185307 /* 2*PI */ } }; int i; @@ -602,9 +602,9 @@ int radeonTransformTrigSimple(struct radeon_compiler* c, sincos_constants(c, constants); if (inst->U.I.Opcode == RC_OPCODE_COS) { - // MAD tmp.x, src, 1/(2*PI), 0.75 - // FRC tmp.x, tmp.x - // MAD tmp.z, tmp.x, 2*PI, -PI + /* MAD tmp.x, src, 1/(2*PI), 0.75 */ + /* FRC tmp.x, tmp.x */ + /* MAD tmp.z, tmp.x, 2*PI, -PI */ emit3(c, inst->Prev, RC_OPCODE_MAD, 0, dstregtmpmask(tempreg, RC_MASK_W), swizzle(inst->U.I.SrcReg[0], RC_SWIZZLE_X, RC_SWIZZLE_X, RC_SWIZZLE_X, RC_SWIZZLE_X), swizzle(srcreg(RC_FILE_CONSTANT, constants[1]), RC_SWIZZLE_Z, RC_SWIZZLE_Z, RC_SWIZZLE_Z, RC_SWIZZLE_Z), diff --git a/src/mesa/drivers/dri/r300/compiler/radeon_program_pair.h b/src/mesa/drivers/dri/r300/compiler/radeon_program_pair.h index 1600598428..6685ade3ea 100644 --- a/src/mesa/drivers/dri/r300/compiler/radeon_program_pair.h +++ b/src/mesa/drivers/dri/r300/compiler/radeon_program_pair.h @@ -52,12 +52,12 @@ struct r300_fragment_program_compiler; struct radeon_pair_instruction_source { unsigned int Used:1; - rc_register_file File:3; + unsigned int File:3; unsigned int Index:RC_REGISTER_INDEX_BITS; }; struct radeon_pair_instruction_rgb { - rc_opcode Opcode:8; + unsigned int Opcode:8; unsigned int DestIndex:RC_REGISTER_INDEX_BITS; unsigned int WriteMask:3; unsigned int OutputWriteMask:3; @@ -74,7 +74,7 @@ struct radeon_pair_instruction_rgb { }; struct radeon_pair_instruction_alpha { - rc_opcode Opcode:8; + unsigned int Opcode:8; unsigned int DestIndex:RC_REGISTER_INDEX_BITS; unsigned int WriteMask:1; unsigned int OutputWriteMask:1; @@ -95,8 +95,8 @@ struct rc_pair_instruction { struct radeon_pair_instruction_rgb RGB; struct radeon_pair_instruction_alpha Alpha; - rc_write_aluresult WriteALUResult:2; - rc_compare_func ALUResultCompare:3; + unsigned int WriteALUResult:2; + unsigned int ALUResultCompare:3; }; diff --git a/src/mesa/drivers/dri/r300/r300_blit.c b/src/mesa/drivers/dri/r300/r300_blit.c index ea626d942d..2eec27e900 100644 --- a/src/mesa/drivers/dri/r300/r300_blit.c +++ b/src/mesa/drivers/dri/r300/r300_blit.c @@ -181,8 +181,6 @@ static uint32_t mesa_format_to_us_format(gl_format mesa_format) { switch(mesa_format) { - case MESA_FORMAT_S8_Z24: - case MESA_FORMAT_X8_Z24: case MESA_FORMAT_RGBA8888: // x return EASY_US_FORMAT(R500_OUT_FMT_C4_8, A, B, G, R, 0); case MESA_FORMAT_RGB565: // x @@ -216,7 +214,8 @@ static uint32_t mesa_format_to_us_format(gl_format mesa_format) return EASY_US_FORMAT(R500_OUT_FMT_C4_16, R, G, B, A, 0xf); default: - assert(!"Invalid format for US output\n"); + fprintf(stderr, "Unsupported format %s for US output\n", _mesa_get_format_name(mesa_format)); + assert(0); return 0; } } @@ -541,6 +540,19 @@ GLboolean r300_blit(struct r300_context *r300, unsigned reg_height, unsigned flip_y) { + if (_mesa_get_format_bits(src_mesaformat, GL_DEPTH_BITS) > 0) + return GL_FALSE; + + /* Make sure that colorbuffer has even width - hw limitation */ + if (dst_pitch % 2 > 0) + ++dst_pitch; + + /* Rendering to small buffer doesn't work. + * Looks like a hw limitation. + */ + if (dst_pitch < 32) + return GL_FALSE; + /* Need to clamp the region size to make sure * we don't read outside of the source buffer * or write outside of the destination buffer. @@ -562,7 +574,7 @@ GLboolean r300_blit(struct r300_context *r300, fprintf(stderr, "src: size [%d x %d], pitch %d, " "offset [%d x %d], format %s, bo %p\n", src_width, src_height, src_pitch, - src_offset, src_y_offset, + src_x_offset, src_y_offset, _mesa_get_format_name(src_mesaformat), src_bo); fprintf(stderr, "dst: pitch %d, offset[%d x %d], format %s, bo %p\n", @@ -571,6 +583,9 @@ GLboolean r300_blit(struct r300_context *r300, fprintf(stderr, "region: %d x %d\n", reg_width, reg_height); } + /* Flush is needed to make sure that source buffer has correct data */ + radeonFlush(r300->radeon.glCtx); + if (!validate_buffers(r300, src_bo, dst_bo)) return GL_FALSE; diff --git a/src/mesa/drivers/dri/r300/r300_context.c b/src/mesa/drivers/dri/r300/r300_context.c index 3c6ec2a34a..1f6ccf6ddc 100644 --- a/src/mesa/drivers/dri/r300/r300_context.c +++ b/src/mesa/drivers/dri/r300/r300_context.c @@ -463,10 +463,10 @@ static void r300InitIoctlFuncs(struct dd_function_table *functions) /* Create the device specific rendering context. */ GLboolean r300CreateContext(const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; radeonScreenPtr screen = (radeonScreenPtr) (sPriv->private); struct dd_function_table functions; r300ContextPtr r300; diff --git a/src/mesa/drivers/dri/r300/r300_context.h b/src/mesa/drivers/dri/r300/r300_context.h index 54a92a2e44..546cd8ddde 100644 --- a/src/mesa/drivers/dri/r300/r300_context.h +++ b/src/mesa/drivers/dri/r300/r300_context.h @@ -543,9 +543,9 @@ struct r300_context { #define R300_CONTEXT(ctx) ((r300ContextPtr)(ctx->DriverCtx)) -extern void r300DestroyContext(__DRIcontextPrivate * driContextPriv); +extern void r300DestroyContext(__DRIcontext * driContextPriv); extern GLboolean r300CreateContext(const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); extern void r300InitShaderFuncs(struct dd_function_table *functions); diff --git a/src/mesa/drivers/dri/r300/r300_fragprog_common.c b/src/mesa/drivers/dri/r300/r300_fragprog_common.c index 267ee81a7a..2933d31136 100644 --- a/src/mesa/drivers/dri/r300/r300_fragprog_common.c +++ b/src/mesa/drivers/dri/r300/r300_fragprog_common.c @@ -120,7 +120,7 @@ static void insert_WPOS_trailer(struct r300_fragment_program_compiler *compiler, return; } - rc_transform_fragment_wpos(&compiler->Base, FRAG_ATTRIB_WPOS, fp->wpos_attr); + rc_transform_fragment_wpos(&compiler->Base, FRAG_ATTRIB_WPOS, fp->wpos_attr, GL_FALSE); } /** diff --git a/src/mesa/drivers/dri/r300/r300_state.c b/src/mesa/drivers/dri/r300/r300_state.c index f90bfd4f4f..c51285aad9 100644 --- a/src/mesa/drivers/dri/r300/r300_state.c +++ b/src/mesa/drivers/dri/r300/r300_state.c @@ -997,7 +997,7 @@ static void r300StencilOpSeparate(GLcontext * ctx, GLenum face, static void r300UpdateWindow(GLcontext * ctx) { r300ContextPtr rmesa = R300_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = dPriv ? (GLfloat) dPriv->x : 0; GLfloat yoffset = dPriv ? (GLfloat) dPriv->y + dPriv->h : 0; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -1050,7 +1050,7 @@ static void r300DepthRange(GLcontext * ctx, GLclampd nearval, GLclampd farval) void r300UpdateViewportOffset(GLcontext * ctx) { r300ContextPtr rmesa = R300_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = (GLfloat) dPriv->x; GLfloat yoffset = (GLfloat) dPriv->y + dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -2040,7 +2040,7 @@ static const GLfloat *get_fragmentprogram_constant(GLcontext *ctx, GLuint index, } case RC_STATE_R300_WINDOW_DIMENSION: { - __DRIdrawablePrivate * drawable = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable * drawable = radeon_get_drawable(&rmesa->radeon); buffer[0] = drawable->w * 0.5f; /* width*0.5 */ buffer[1] = drawable->h * 0.5f; /* height*0.5 */ buffer[2] = 0.5F; /* for moving range [-1 1] -> [0 1] */ diff --git a/src/mesa/drivers/dri/r300/r300_tex.c b/src/mesa/drivers/dri/r300/r300_tex.c index ac3d5b1bec..963f648cb1 100644 --- a/src/mesa/drivers/dri/r300/r300_tex.c +++ b/src/mesa/drivers/dri/r300/r300_tex.c @@ -215,7 +215,7 @@ static void r300TexParameter(GLcontext * ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - r300SetTexBorderColor(t, texObj->BorderColor); + r300SetTexBorderColor(t, texObj->BorderColor.f); break; case GL_TEXTURE_BASE_LEVEL: @@ -307,7 +307,7 @@ static struct gl_texture_object *r300NewTextureObject(GLcontext * ctx, /* Initialize hardware state */ r300UpdateTexWrap(t); r300SetTexFilter(t, t->base.MinFilter, t->base.MagFilter, t->base.MaxAnisotropy); - r300SetTexBorderColor(t, t->base.BorderColor); + r300SetTexBorderColor(t, t->base.BorderColor.f); return &t->base; } diff --git a/src/mesa/drivers/dri/r600/r600_context.c b/src/mesa/drivers/dri/r600/r600_context.c index 45bbc3c071..cb549497f5 100644 --- a/src/mesa/drivers/dri/r600/r600_context.c +++ b/src/mesa/drivers/dri/r600/r600_context.c @@ -99,6 +99,7 @@ static const struct dri_extension card_extensions[] = { {"GL_ARB_depth_clamp", NULL}, {"GL_ARB_depth_texture", NULL}, {"GL_ARB_fragment_program", NULL}, + {"GL_ARB_fragment_program_shadow", NULL}, {"GL_ARB_occlusion_query", GL_ARB_occlusion_query_functions}, {"GL_ARB_multitexture", NULL}, {"GL_ARB_point_parameters", GL_ARB_point_parameters_functions}, @@ -163,6 +164,7 @@ static const struct dri_extension gl_20_extension[] = { #else {"GL_VERSION_2_0", GL_VERSION_2_0_functions }, #endif /* R600_ENABLE_GLSL_TEST */ + {NULL, NULL} }; static const struct tnl_pipeline_stage *r600_pipeline[] = { @@ -345,10 +347,10 @@ static void r600InitGLExtensions(GLcontext *ctx) /* Create the device specific rendering context. */ GLboolean r600CreateContext(const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; radeonScreenPtr screen = (radeonScreenPtr) (sPriv->private); struct dd_function_table functions; context_t *r600; diff --git a/src/mesa/drivers/dri/r600/r600_context.h b/src/mesa/drivers/dri/r600/r600_context.h index 94662ab547..a1b4af715e 100644 --- a/src/mesa/drivers/dri/r600/r600_context.h +++ b/src/mesa/drivers/dri/r600/r600_context.h @@ -154,7 +154,7 @@ struct r600_context { #define GL_CONTEXT(context) ((GLcontext *)(context->radeon.glCtx)) extern GLboolean r600CreateContext(const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); #define R700_CONTEXT_STATES(context) ((R700_CHIP_CONTEXT *)(&context->hw)) diff --git a/src/mesa/drivers/dri/r600/r600_tex.c b/src/mesa/drivers/dri/r600/r600_tex.c index 9d83a64e22..f745fe3e8a 100644 --- a/src/mesa/drivers/dri/r600/r600_tex.c +++ b/src/mesa/drivers/dri/r600/r600_tex.c @@ -305,7 +305,7 @@ static void r600TexParameter(GLcontext * ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - r600SetTexBorderColor(t, texObj->BorderColor); + r600SetTexBorderColor(t, texObj->BorderColor.f); break; case GL_TEXTURE_BASE_LEVEL: @@ -391,7 +391,7 @@ static struct gl_texture_object *r600NewTextureObject(GLcontext * ctx, r600SetTexDefaultState(t); r600UpdateTexWrap(t); r600SetTexFilter(t, t->base.MinFilter, t->base.MagFilter, t->base.MaxAnisotropy); - r600SetTexBorderColor(t, t->base.BorderColor); + r600SetTexBorderColor(t, t->base.BorderColor.f); return &t->base; } diff --git a/src/mesa/drivers/dri/r600/r600_texstate.c b/src/mesa/drivers/dri/r600/r600_texstate.c index 2a4a6e6ee1..b8466bdd75 100644 --- a/src/mesa/drivers/dri/r600/r600_texstate.c +++ b/src/mesa/drivers/dri/r600/r600_texstate.c @@ -91,7 +91,7 @@ static GLboolean r600GetTexFormat(struct gl_texture_object *tObj, gl_format mesa SETfield(t->SQ_TEX_RESOURCE4, SQ_FORMAT_COMP_UNSIGNED, FORMAT_COMP_Y_shift, FORMAT_COMP_Y_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_FORMAT_COMP_UNSIGNED, - FORMAT_COMP_X_shift, FORMAT_COMP_Z_mask); + FORMAT_COMP_Z_shift, FORMAT_COMP_Z_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_FORMAT_COMP_UNSIGNED, FORMAT_COMP_W_shift, FORMAT_COMP_W_mask); @@ -357,37 +357,37 @@ static GLboolean r600GetTexFormat(struct gl_texture_object *tObj, gl_format mesa SETfield(t->SQ_TEX_RESOURCE1, FMT_32_32_32_32_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_W, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, - SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_W, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); break; case MESA_FORMAT_RGBA_FLOAT16: SETfield(t->SQ_TEX_RESOURCE1, FMT_16_16_16_16_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_W, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, - SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_W, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); break; case MESA_FORMAT_RGB_FLOAT32: /* X, Y, Z, ONE */ SETfield(t->SQ_TEX_RESOURCE1, FMT_32_32_32_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_1, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); @@ -396,11 +396,11 @@ static GLboolean r600GetTexFormat(struct gl_texture_object *tObj, gl_format mesa SETfield(t->SQ_TEX_RESOURCE1, FMT_16_16_16_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Z, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_1, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); @@ -461,26 +461,26 @@ static GLboolean r600GetTexFormat(struct gl_texture_object *tObj, gl_format mesa SETfield(t->SQ_TEX_RESOURCE1, FMT_32_32_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, - SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); break; case MESA_FORMAT_LUMINANCE_ALPHA_FLOAT16: SETfield(t->SQ_TEX_RESOURCE1, FMT_16_16_FLOAT, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_shift, SQ_TEX_RESOURCE_WORD1_0__DATA_FORMAT_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_X_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Y_mask); - SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, - SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_X, + SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_Z_mask); + SETfield(t->SQ_TEX_RESOURCE4, SQ_SEL_Y, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_shift, SQ_TEX_RESOURCE_WORD4_0__DST_SEL_W_mask); break; case MESA_FORMAT_INTENSITY_FLOAT32: /* X, X, X, X */ @@ -626,6 +626,31 @@ static GLboolean r600GetTexFormat(struct gl_texture_object *tObj, gl_format mesa return GL_TRUE; } +static GLuint r600_translate_shadow_func(GLenum func) +{ + switch (func) { + case GL_NEVER: + return SQ_TEX_DEPTH_COMPARE_NEVER; + case GL_LESS: + return SQ_TEX_DEPTH_COMPARE_LESS; + case GL_LEQUAL: + return SQ_TEX_DEPTH_COMPARE_LESSEQUAL; + case GL_GREATER: + return SQ_TEX_DEPTH_COMPARE_GREATER; + case GL_GEQUAL: + return SQ_TEX_DEPTH_COMPARE_GREATEREQUAL; + case GL_NOTEQUAL: + return SQ_TEX_DEPTH_COMPARE_NOTEQUAL; + case GL_EQUAL: + return SQ_TEX_DEPTH_COMPARE_EQUAL; + case GL_ALWAYS: + return SQ_TEX_DEPTH_COMPARE_ALWAYS; + default: + WARN_ONCE("Unknown shadow compare function! %d", func); + return 0; + } +} + void r600SetDepthTexMode(struct gl_texture_object *tObj) { radeonTexObjPtr t; @@ -706,11 +731,22 @@ static void setup_hardware_state(context_t *rmesa, struct gl_texture_object *tex SETfield(t->SQ_TEX_RESOURCE1, firstImage->Height - 1, TEX_HEIGHT_shift, TEX_HEIGHT_mask); + t->SQ_TEX_RESOURCE2 = get_base_teximage_offset(t) / 256; + if ((t->maxLod - t->minLod) > 0) { - t->SQ_TEX_RESOURCE3 = t->mt->levels[t->minLod].size / 256; + t->SQ_TEX_RESOURCE3 = radeon_miptree_image_offset(t->mt, 0, t->minLod + 1) / 256; SETfield(t->SQ_TEX_RESOURCE4, 0, BASE_LEVEL_shift, BASE_LEVEL_mask); SETfield(t->SQ_TEX_RESOURCE5, t->maxLod - t->minLod, LAST_LEVEL_shift, LAST_LEVEL_mask); } + if(texObj->CompareMode == GL_COMPARE_R_TO_TEXTURE_ARB) + { + SETfield(t->SQ_TEX_SAMPLER0, r600_translate_shadow_func(texObj->CompareFunc), DEPTH_COMPARE_FUNCTION_shift, DEPTH_COMPARE_FUNCTION_mask); + } + else + { + CLEARfield(t->SQ_TEX_SAMPLER0, DEPTH_COMPARE_FUNCTION_mask); + } + } /** diff --git a/src/mesa/drivers/dri/r600/r700_assembler.c b/src/mesa/drivers/dri/r600/r700_assembler.c index 1ff89e18ea..0ff16b4ddd 100644 --- a/src/mesa/drivers/dri/r600/r700_assembler.c +++ b/src/mesa/drivers/dri/r600/r700_assembler.c @@ -4397,7 +4397,10 @@ GLboolean assemble_TEX(r700_AssemblerBase *pAsm) pAsm->D.dst.opcode = SQ_TEX_INST_SAMPLE_L; break; default: - pAsm->D.dst.opcode = SQ_TEX_INST_SAMPLE; + if(pAsm->pILInst[pAsm->uiCurInst].TexShadow == 1) + pAsm->D.dst.opcode = SQ_TEX_INST_SAMPLE_C; + else + pAsm->D.dst.opcode = SQ_TEX_INST_SAMPLE; } pAsm->is_tex = GL_TRUE; @@ -4443,11 +4446,46 @@ GLboolean assemble_TEX(r700_AssemblerBase *pAsm) pAsm->S[0].src.swizzlew = SQ_SEL_Y; } + if(pAsm->pILInst[pAsm->uiCurInst].TexShadow == 1) + { + /* compare value goes to w chan ? */ + pAsm->S[0].src.swizzlew = SQ_SEL_Z; + } + if ( GL_FALSE == next_ins(pAsm) ) { return GL_FALSE; } + /* add ARB shadow ambient but clamp to 0..1 */ + if(pAsm->pILInst[pAsm->uiCurInst].TexShadow == 1) + { + /* ADD_SAT dst, dst, ambient[texunit] */ + pAsm->D.dst.opcode = SQ_OP2_INST_ADD; + + if( GL_FALSE == assemble_dst(pAsm) ) + { + return GL_FALSE; + } + pAsm->D2.dst2.SaturateMode = 1; + + pAsm->S[0].src.rtype = pAsm->D.dst.rtype; + pAsm->S[0].src.reg = pAsm->D.dst.reg; + noswizzle_PVSSRC(&(pAsm->S[0].src)); + noneg_PVSSRC(&(pAsm->S[0].src)); + + pAsm->S[1].src.rtype = SRC_REG_CONSTANT; + pAsm->S[1].src.reg = pAsm->shadow_regs[pAsm->pILInst[pAsm->uiCurInst].TexSrcUnit]; + noswizzle_PVSSRC(&(pAsm->S[1].src)); + noneg_PVSSRC(&(pAsm->S[1].src)); + + if( GL_FALSE == next_ins(pAsm) ) + { + return GL_FALSE; + } + + } + return GL_TRUE; } diff --git a/src/mesa/drivers/dri/r600/r700_assembler.h b/src/mesa/drivers/dri/r600/r700_assembler.h index 86342b814f..56baf5b0d9 100644 --- a/src/mesa/drivers/dri/r600/r700_assembler.h +++ b/src/mesa/drivers/dri/r600/r700_assembler.h @@ -487,6 +487,8 @@ typedef struct r700_AssemblerBase GLuint unVetTexBits; + GLuint shadow_regs[R700_MAX_TEXTURE_UNITS]; + } r700_AssemblerBase; //Internal use diff --git a/src/mesa/drivers/dri/r600/r700_chip.c b/src/mesa/drivers/dri/r600/r700_chip.c index c124e02184..3bc2d2ba02 100644 --- a/src/mesa/drivers/dri/r600/r700_chip.c +++ b/src/mesa/drivers/dri/r600/r700_chip.c @@ -57,14 +57,11 @@ static void r700SendTexState(GLcontext *ctx, struct radeon_state_atom *atom) for (i = 0; i < R700_TEXTURE_NUMBERUNITS; i++) { if (ctx->Texture.Unit[i]._ReallyEnabled) { radeonTexObj *t = r700->textures[i]; - uint32_t offset; if (t) { if (!t->image_override) { bo = t->mt->bo; - offset = get_base_teximage_offset(t); } else { bo = t->bo; - offset = 0; } if (bo) { @@ -93,7 +90,7 @@ static void r700SendTexState(GLcontext *ctx, struct radeon_state_atom *atom) R600_OUT_BATCH(r700->textures[i]->SQ_TEX_RESOURCE6); R600_OUT_BATCH_RELOC(r700->textures[i]->SQ_TEX_RESOURCE2, bo, - offset, + r700->textures[i]->SQ_TEX_RESOURCE2, RADEON_GEM_DOMAIN_GTT|RADEON_GEM_DOMAIN_VRAM, 0, 0); R600_OUT_BATCH_RELOC(r700->textures[i]->SQ_TEX_RESOURCE3, bo, diff --git a/src/mesa/drivers/dri/r600/r700_clear.c b/src/mesa/drivers/dri/r600/r700_clear.c index c0ac54a844..98bfdd0937 100644 --- a/src/mesa/drivers/dri/r600/r700_clear.c +++ b/src/mesa/drivers/dri/r600/r700_clear.c @@ -49,7 +49,7 @@ static GLboolean r700ClearFast(context_t *context, GLbitfield mask) void r700Clear(GLcontext * ctx, GLbitfield mask) { context_t *context = R700_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&context->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&context->radeon); const GLuint colorMask = *((GLuint *) & ctx->Color.ColorMask[0]); GLbitfield swrast_mask = 0, tri_mask = 0; int i; diff --git a/src/mesa/drivers/dri/r600/r700_fragprog.c b/src/mesa/drivers/dri/r600/r700_fragprog.c index ce2d9fdf79..84d51e6606 100644 --- a/src/mesa/drivers/dri/r600/r700_fragprog.c +++ b/src/mesa/drivers/dri/r600/r700_fragprog.c @@ -362,8 +362,11 @@ GLboolean r700TranslateFragmentShader(struct r700_fragment_program *fp, { GLuint number_of_colors_exported; GLboolean z_enabled = GL_FALSE; - GLuint unBit; + GLuint unBit, shadow_unit; int i; + struct prog_instruction *inst; + gl_state_index shadow_ambient[STATE_LENGTH] + = { STATE_INTERNAL, STATE_SHADOW_AMBIENT, 0, 0, 0}; //Init_Program Init_r700_AssemblerBase( SPT_FP, &(fp->r700AsmCode), &(fp->r700Shader) ); @@ -373,6 +376,23 @@ GLboolean r700TranslateFragmentShader(struct r700_fragment_program *fp, insert_wpos_code(ctx, mesa_fp); } + /* add/map consts for ARB_shadow_ambient */ + if(mesa_fp->Base.ShadowSamplers) + { + inst = mesa_fp->Base.Instructions; + for (i = 0; i < mesa_fp->Base.NumInstructions; i++) + { + if(inst->TexShadow == 1) + { + shadow_unit = inst->TexSrcUnit; + shadow_ambient[2] = shadow_unit; + fp->r700AsmCode.shadow_regs[shadow_unit] = + _mesa_add_state_reference(mesa_fp->Base.Parameters, shadow_ambient); + } + inst++; + } + } + Map_Fragment_Program(&(fp->r700AsmCode), mesa_fp, ctx); if( GL_FALSE == Find_Instruction_Dependencies_fp(fp, mesa_fp) ) diff --git a/src/mesa/drivers/dri/r600/r700_state.c b/src/mesa/drivers/dri/r600/r700_state.c index fc6fb29fd6..3c8cb579f9 100644 --- a/src/mesa/drivers/dri/r600/r700_state.c +++ b/src/mesa/drivers/dri/r600/r700_state.c @@ -85,7 +85,7 @@ void r700UpdateViewportOffset(GLcontext * ctx) //------------------ { context_t *context = R700_CONTEXT(ctx); R700_CHIP_CONTEXT *r700 = (R700_CHIP_CONTEXT*)(&context->hw); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&context->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&context->radeon); GLfloat xoffset = (GLfloat) dPriv->x; GLfloat yoffset = (GLfloat) dPriv->y + dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -1071,7 +1071,7 @@ static void r700UpdateWindow(GLcontext * ctx, int id) //-------------------- { context_t *context = R700_CONTEXT(ctx); R700_CHIP_CONTEXT *r700 = (R700_CHIP_CONTEXT*)(&context->hw); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&context->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&context->radeon); GLfloat xoffset = dPriv ? (GLfloat) dPriv->x : 0; GLfloat yoffset = dPriv ? (GLfloat) dPriv->y + dPriv->h : 0; const GLfloat *v = ctx->Viewport._WindowMap.m; diff --git a/src/mesa/drivers/dri/radeon/radeon_common.c b/src/mesa/drivers/dri/radeon/radeon_common.c index c0b3165dda..e0b853bc97 100644 --- a/src/mesa/drivers/dri/radeon/radeon_common.c +++ b/src/mesa/drivers/dri/radeon/radeon_common.c @@ -137,7 +137,7 @@ void radeon_get_cliprects(radeonContextPtr radeon, unsigned int *num_cliprects, int *x_off, int *y_off) { - __DRIdrawablePrivate *dPriv = radeon_get_drawable(radeon); + __DRIdrawable *dPriv = radeon_get_drawable(radeon); struct radeon_framebuffer *rfb = dPriv->driverPrivate; if (radeon->constant_cliprect) { @@ -169,8 +169,8 @@ void radeon_get_cliprects(radeonContextPtr radeon, */ void radeonSetCliprects(radeonContextPtr radeon) { - __DRIdrawablePrivate *const drawable = radeon_get_drawable(radeon); - __DRIdrawablePrivate *const readable = radeon_get_readable(radeon); + __DRIdrawable *const drawable = radeon_get_drawable(radeon); + __DRIdrawable *const readable = radeon_get_readable(radeon); struct radeon_framebuffer *const draw_rfb = drawable->driverPrivate; struct radeon_framebuffer *const read_rfb = readable->driverPrivate; int x_off, y_off; @@ -229,7 +229,7 @@ void radeonUpdateScissor( GLcontext *ctx ) } if (!rmesa->radeonScreen->kernel_mm) { /* Fix scissors for dri 1 */ - __DRIdrawablePrivate *dPriv = radeon_get_drawable(rmesa); + __DRIdrawable *dPriv = radeon_get_drawable(rmesa); x1 += dPriv->x; x2 += dPriv->x + 1; min_x += dPriv->x; @@ -428,7 +428,7 @@ static void radeon_flip_renderbuffers(struct radeon_framebuffer *rfb) /* Copy the back color buffer to the front color buffer. */ -void radeonCopyBuffer( __DRIdrawablePrivate *dPriv, +void radeonCopyBuffer( __DRIdrawable *dPriv, const drm_clip_rect_t *rect) { radeonContextPtr rmesa; @@ -496,7 +496,7 @@ void radeonCopyBuffer( __DRIdrawablePrivate *dPriv, UNLOCK_HARDWARE( rmesa ); } -static int radeonScheduleSwap(__DRIdrawablePrivate *dPriv, GLboolean *missed_target) +static int radeonScheduleSwap(__DRIdrawable *dPriv, GLboolean *missed_target) { radeonContextPtr rmesa; @@ -519,11 +519,11 @@ static int radeonScheduleSwap(__DRIdrawablePrivate *dPriv, GLboolean *missed_tar return 0; } -static GLboolean radeonPageFlip( __DRIdrawablePrivate *dPriv ) +static GLboolean radeonPageFlip( __DRIdrawable *dPriv ) { radeonContextPtr radeon; GLint ret; - __DRIscreenPrivate *psp; + __DRIscreen *psp; struct radeon_renderbuffer *rrb; struct radeon_framebuffer *rfb; @@ -571,10 +571,10 @@ static GLboolean radeonPageFlip( __DRIdrawablePrivate *dPriv ) /** * Swap front and back buffer. */ -void radeonSwapBuffers(__DRIdrawablePrivate * dPriv) +void radeonSwapBuffers(__DRIdrawable * dPriv) { int64_t ust; - __DRIscreenPrivate *psp; + __DRIscreen *psp; if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { radeonContextPtr radeon; @@ -615,7 +615,7 @@ void radeonSwapBuffers(__DRIdrawablePrivate * dPriv) } } -void radeonCopySubBuffer(__DRIdrawablePrivate * dPriv, +void radeonCopySubBuffer(__DRIdrawable * dPriv, int x, int y, int w, int h ) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { @@ -1130,7 +1130,7 @@ flush_front: if (screen->dri2.loader && (screen->dri2.loader->base.version >= 2) && (screen->dri2.loader->flushFrontBuffer != NULL)) { - __DRIdrawablePrivate * drawable = radeon_get_drawable(radeon); + __DRIdrawable * drawable = radeon_get_drawable(radeon); (*screen->dri2.loader->flushFrontBuffer)(drawable, drawable->loaderPrivate); /* Only clear the dirty bit if front-buffer rendering is no longer diff --git a/src/mesa/drivers/dri/radeon/radeon_common.h b/src/mesa/drivers/dri/radeon/radeon_common.h index faad145cc4..f31f08edf3 100644 --- a/src/mesa/drivers/dri/radeon/radeon_common.h +++ b/src/mesa/drivers/dri/radeon/radeon_common.h @@ -13,10 +13,10 @@ void radeonScissor(GLcontext* ctx, GLint x, GLint y, GLsizei w, GLsizei h); void radeonWaitForIdleLocked(radeonContextPtr radeon); extern uint32_t radeonGetAge(radeonContextPtr radeon); -void radeonCopyBuffer( __DRIdrawablePrivate *dPriv, +void radeonCopyBuffer( __DRIdrawable *dPriv, const drm_clip_rect_t *rect); -void radeonSwapBuffers(__DRIdrawablePrivate * dPriv); -void radeonCopySubBuffer(__DRIdrawablePrivate * dPriv, +void radeonSwapBuffers(__DRIdrawable * dPriv); +void radeonCopySubBuffer(__DRIdrawable * dPriv, int x, int y, int w, int h ); void radeonUpdatePageFlipping(radeonContextPtr rmesa); @@ -42,7 +42,7 @@ void radeon_renderbuffer_set_bo(struct radeon_renderbuffer *rb, struct radeon_bo *bo); struct radeon_renderbuffer * -radeon_create_renderbuffer(gl_format format, __DRIdrawablePrivate *driDrawPriv); +radeon_create_renderbuffer(gl_format format, __DRIdrawable *driDrawPriv); void radeon_check_front_buffer_rendering(GLcontext *ctx); static inline struct radeon_renderbuffer *radeon_renderbuffer(struct gl_renderbuffer *rb) diff --git a/src/mesa/drivers/dri/radeon/radeon_common_context.c b/src/mesa/drivers/dri/radeon/radeon_common_context.c index 5c68bf5df6..b9c29b937e 100644 --- a/src/mesa/drivers/dri/radeon/radeon_common_context.c +++ b/src/mesa/drivers/dri/radeon/radeon_common_context.c @@ -181,10 +181,10 @@ static void radeonInitDriverFuncs(struct dd_function_table *functions) GLboolean radeonInitContext(radeonContextPtr radeon, struct dd_function_table* functions, const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; radeonScreenPtr screen = (radeonScreenPtr) (sPriv->private); GLcontext* ctx; GLcontext* shareCtx; @@ -291,7 +291,7 @@ static void radeon_destroy_atom_list(radeonContextPtr radeon) * Cleanup common context fields. * Called by r200DestroyContext/r300DestroyContext */ -void radeonDestroyContext(__DRIcontextPrivate *driContextPriv ) +void radeonDestroyContext(__DRIcontext *driContextPriv ) { #ifdef RADEON_BO_TRACK FILE *track; @@ -355,7 +355,7 @@ void radeonDestroyContext(__DRIcontextPrivate *driContextPriv ) /* Force the context `c' to be unbound from its buffer. */ -GLboolean radeonUnbindContext(__DRIcontextPrivate * driContextPriv) +GLboolean radeonUnbindContext(__DRIcontext * driContextPriv) { radeonContextPtr radeon = (radeonContextPtr) driContextPriv->driverPrivate; @@ -720,9 +720,9 @@ radeon_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable, /* Force the context `c' to be the current context and associate with it * buffer `b'. */ -GLboolean radeonMakeCurrent(__DRIcontextPrivate * driContextPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv) +GLboolean radeonMakeCurrent(__DRIcontext * driContextPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv) { radeonContextPtr radeon; struct radeon_framebuffer *drfb; diff --git a/src/mesa/drivers/dri/radeon/radeon_common_context.h b/src/mesa/drivers/dri/radeon/radeon_common_context.h index 0739496e03..ab79d2dc0f 100644 --- a/src/mesa/drivers/dri/radeon/radeon_common_context.h +++ b/src/mesa/drivers/dri/radeon/radeon_common_context.h @@ -92,7 +92,7 @@ struct radeon_renderbuffer GLuint pf_pending; /**< sequence number of pending flip */ GLuint vbl_pending; /**< vblank sequence number of pending flip */ - __DRIdrawablePrivate *dPriv; + __DRIdrawable *dPriv; }; struct radeon_framebuffer @@ -381,8 +381,8 @@ struct radeon_store { }; struct radeon_dri_mirror { - __DRIcontextPrivate *context; /* DRI context */ - __DRIscreenPrivate *screen; /* DRI screen */ + __DRIcontext *context; /* DRI context */ + __DRIscreen *screen; /* DRI screen */ drm_context_t hwContext; drm_hw_lock_t *hwLock; @@ -523,12 +523,12 @@ struct radeon_context { #define RADEON_CONTEXT(glctx) ((radeonContextPtr)(ctx->DriverCtx)) -static inline __DRIdrawablePrivate* radeon_get_drawable(radeonContextPtr radeon) +static inline __DRIdrawable* radeon_get_drawable(radeonContextPtr radeon) { return radeon->dri.context->driDrawablePriv; } -static inline __DRIdrawablePrivate* radeon_get_readable(radeonContextPtr radeon) +static inline __DRIdrawable* radeon_get_readable(radeonContextPtr radeon) { return radeon->dri.context->driReadablePriv; } @@ -581,16 +581,16 @@ static INLINE uint32_t radeonPackFloat24(float f) GLboolean radeonInitContext(radeonContextPtr radeon, struct dd_function_table* functions, const __GLcontextModes * glVisual, - __DRIcontextPrivate * driContextPriv, + __DRIcontext * driContextPriv, void *sharedContextPrivate); void radeonCleanupContext(radeonContextPtr radeon); -GLboolean radeonUnbindContext(__DRIcontextPrivate * driContextPriv); +GLboolean radeonUnbindContext(__DRIcontext * driContextPriv); void radeon_update_renderbuffers(__DRIcontext *context, __DRIdrawable *drawable, GLboolean front_only); -GLboolean radeonMakeCurrent(__DRIcontextPrivate * driContextPriv, - __DRIdrawablePrivate * driDrawPriv, - __DRIdrawablePrivate * driReadPriv); -extern void radeonDestroyContext(__DRIcontextPrivate * driContextPriv); +GLboolean radeonMakeCurrent(__DRIcontext * driContextPriv, + __DRIdrawable * driDrawPriv, + __DRIdrawable * driReadPriv); +extern void radeonDestroyContext(__DRIcontext * driContextPriv); #endif diff --git a/src/mesa/drivers/dri/radeon/radeon_context.c b/src/mesa/drivers/dri/radeon/radeon_context.c index 5e700be4a5..3cd305b0a2 100644 --- a/src/mesa/drivers/dri/radeon/radeon_context.c +++ b/src/mesa/drivers/dri/radeon/radeon_context.c @@ -208,10 +208,10 @@ static void r100_init_vtbl(radeonContextPtr radeon) */ GLboolean r100CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; radeonScreenPtr screen = (radeonScreenPtr)(sPriv->private); struct dd_function_table functions; r100ContextPtr rmesa; diff --git a/src/mesa/drivers/dri/radeon/radeon_context.h b/src/mesa/drivers/dri/radeon/radeon_context.h index 12ab33a009..dfedc38bfd 100644 --- a/src/mesa/drivers/dri/radeon/radeon_context.h +++ b/src/mesa/drivers/dri/radeon/radeon_context.h @@ -451,7 +451,7 @@ struct r100_context { #define RADEON_OLD_PACKETS 1 extern GLboolean r100CreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate); diff --git a/src/mesa/drivers/dri/radeon/radeon_cs_legacy.c b/src/mesa/drivers/dri/radeon/radeon_cs_legacy.c index 45b608a1b9..bf46eb8aab 100644 --- a/src/mesa/drivers/dri/radeon/radeon_cs_legacy.c +++ b/src/mesa/drivers/dri/radeon/radeon_cs_legacy.c @@ -182,7 +182,7 @@ static int cs_begin(struct radeon_cs_int *cs, uint32_t tmp, *ptr; int num = (ndw > 0x3FF) ? ndw : 0x3FF; - tmp = (cs->cdw + 1 + num) & (~num); + tmp = (cs->cdw + ndw + 0x3ff) & (~0x3ff); ptr = (uint32_t*)realloc(cs->packets, 4 * tmp); if (ptr == NULL) { return -ENOMEM; diff --git a/src/mesa/drivers/dri/radeon/radeon_fbo.c b/src/mesa/drivers/dri/radeon/radeon_fbo.c index a536436d55..7b1f84a715 100644 --- a/src/mesa/drivers/dri/radeon/radeon_fbo.c +++ b/src/mesa/drivers/dri/radeon/radeon_fbo.c @@ -247,7 +247,7 @@ radeon_nop_alloc_storage(GLcontext * ctx, struct gl_renderbuffer *rb, * Not used for user-created renderbuffers. */ struct radeon_renderbuffer * -radeon_create_renderbuffer(gl_format format, __DRIdrawablePrivate *driDrawPriv) +radeon_create_renderbuffer(gl_format format, __DRIdrawable *driDrawPriv) { struct radeon_renderbuffer *rrb; diff --git a/src/mesa/drivers/dri/radeon/radeon_ioctl.c b/src/mesa/drivers/dri/radeon/radeon_ioctl.c index 13fd6f9971..a9d50c5d07 100644 --- a/src/mesa/drivers/dri/radeon/radeon_ioctl.c +++ b/src/mesa/drivers/dri/radeon/radeon_ioctl.c @@ -449,7 +449,7 @@ void radeonEmitAOS( r100ContextPtr rmesa, static void radeonKernelClear(GLcontext *ctx, GLuint flags) { r100ContextPtr rmesa = R100_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); drm_radeon_sarea_t *sarea = rmesa->radeon.sarea; uint32_t clear; GLint ret, i; @@ -570,7 +570,7 @@ static void radeonKernelClear(GLcontext *ctx, GLuint flags) static void radeonClear( GLcontext *ctx, GLbitfield mask ) { r100ContextPtr rmesa = R100_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLuint flags = 0; GLuint color_mask = 0; GLuint orig_mask = mask; diff --git a/src/mesa/drivers/dri/radeon/radeon_lock.c b/src/mesa/drivers/dri/radeon/radeon_lock.c index 7ad781ba61..9dee691938 100644 --- a/src/mesa/drivers/dri/radeon/radeon_lock.c +++ b/src/mesa/drivers/dri/radeon/radeon_lock.c @@ -58,9 +58,9 @@ WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. */ void radeonGetLock(radeonContextPtr rmesa, GLuint flags) { - __DRIdrawablePrivate *const drawable = radeon_get_drawable(rmesa); - __DRIdrawablePrivate *const readable = radeon_get_readable(rmesa); - __DRIscreenPrivate *sPriv = rmesa->dri.screen; + __DRIdrawable *const drawable = radeon_get_drawable(rmesa); + __DRIdrawable *const readable = radeon_get_readable(rmesa); + __DRIscreen *sPriv = rmesa->dri.screen; drmGetLock(rmesa->dri.fd, rmesa->dri.hwContext, flags); diff --git a/src/mesa/drivers/dri/radeon/radeon_screen.c b/src/mesa/drivers/dri/radeon/radeon_screen.c index be2d8365ef..3080a0fcd0 100644 --- a/src/mesa/drivers/dri/radeon/radeon_screen.c +++ b/src/mesa/drivers/dri/radeon/radeon_screen.c @@ -214,10 +214,10 @@ static const GLuint __driNConfigOptions = 17; #endif -static int getSwapInfo( __DRIdrawablePrivate *dPriv, __DRIswapInfo * sInfo ); +static int getSwapInfo( __DRIdrawable *dPriv, __DRIswapInfo * sInfo ); static int -radeonGetParam(__DRIscreenPrivate *sPriv, int param, void *value) +radeonGetParam(__DRIscreen *sPriv, int param, void *value) { int ret; drm_radeon_getparam_t gp = { 0 }; @@ -249,7 +249,7 @@ radeonGetParam(__DRIscreenPrivate *sPriv, int param, void *value) } static const __DRIconfig ** -radeonFillInModes( __DRIscreenPrivate *psp, +radeonFillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -911,7 +911,7 @@ static int radeon_set_screen_flags(radeonScreenPtr screen, int device_id) /* Create the device specific screen private data struct. */ static radeonScreenPtr -radeonCreateScreen( __DRIscreenPrivate *sPriv ) +radeonCreateScreen( __DRIscreen *sPriv ) { radeonScreenPtr screen; RADEONDRIPtr dri_priv = (RADEONDRIPtr)sPriv->pDevPriv; @@ -1250,7 +1250,7 @@ radeonCreateScreen( __DRIscreenPrivate *sPriv ) } static radeonScreenPtr -radeonCreateScreen2(__DRIscreenPrivate *sPriv) +radeonCreateScreen2(__DRIscreen *sPriv) { radeonScreenPtr screen; int i; @@ -1401,7 +1401,7 @@ radeonCreateScreen2(__DRIscreenPrivate *sPriv) /* Destroy the device specific screen private data struct. */ static void -radeonDestroyScreen( __DRIscreenPrivate *sPriv ) +radeonDestroyScreen( __DRIscreen *sPriv ) { radeonScreenPtr screen = (radeonScreenPtr)sPriv->private; @@ -1435,7 +1435,7 @@ radeonDestroyScreen( __DRIscreenPrivate *sPriv ) /* Initialize the driver specific screen private data. */ static GLboolean -radeonInitDriver( __DRIscreenPrivate *sPriv ) +radeonInitDriver( __DRIscreen *sPriv ) { if (sPriv->dri2.enabled) { sPriv->private = (void *) radeonCreateScreen2( sPriv ); @@ -1459,8 +1459,8 @@ radeonInitDriver( __DRIscreenPrivate *sPriv ) * pbuffers. */ static GLboolean -radeonCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +radeonCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -1559,7 +1559,7 @@ static void radeon_cleanup_renderbuffers(struct radeon_framebuffer *rfb) } void -radeonDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +radeonDestroyBuffer(__DRIdrawable *driDrawPriv) { struct radeon_framebuffer *rfb; if (!driDrawPriv) @@ -1581,7 +1581,7 @@ radeonDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -radeonInitScreen(__DRIscreenPrivate *psp) +radeonInitScreen(__DRIscreen *psp) { #if defined(RADEON_R100) static const char *driver_name = "Radeon"; @@ -1631,7 +1631,7 @@ radeonInitScreen(__DRIscreenPrivate *psp) * \return the __GLcontextModes supported by this driver */ static const -__DRIconfig **radeonInitScreen2(__DRIscreenPrivate *psp) +__DRIconfig **radeonInitScreen2(__DRIscreen *psp) { GLenum fb_format[3]; GLenum fb_type[3]; @@ -1698,7 +1698,7 @@ __DRIconfig **radeonInitScreen2(__DRIscreenPrivate *psp) * Get information about previous buffer swaps. */ static int -getSwapInfo( __DRIdrawablePrivate *dPriv, __DRIswapInfo * sInfo ) +getSwapInfo( __DRIdrawable *dPriv, __DRIswapInfo * sInfo ) { struct radeon_framebuffer *rfb; @@ -1751,3 +1751,10 @@ const struct __DriverAPIRec driDriverAPI = { .InitScreen2 = radeonInitScreen2, }; +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + &driDRI2Extension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/radeon/radeon_screen.h b/src/mesa/drivers/dri/radeon/radeon_screen.h index 15744e8828..5e6d432e11 100644 --- a/src/mesa/drivers/dri/radeon/radeon_screen.h +++ b/src/mesa/drivers/dri/radeon/radeon_screen.h @@ -86,7 +86,7 @@ typedef struct radeon_screen { __volatile__ uint32_t *scratch; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; unsigned int sarea_priv_offset; unsigned int gart_buffer_offset; /* offset in card memory space */ unsigned int gart_texture_offset; /* offset in card memory space */ @@ -123,5 +123,5 @@ typedef struct radeon_screen { #define IS_R600_CLASS(screen) \ ((screen->chip_flags & RADEON_CLASS_MASK) == RADEON_CLASS_R600) -extern void radeonDestroyBuffer(__DRIdrawablePrivate *driDrawPriv); +extern void radeonDestroyBuffer(__DRIdrawable *driDrawPriv); #endif /* __RADEON_SCREEN_H__ */ diff --git a/src/mesa/drivers/dri/radeon/radeon_state.c b/src/mesa/drivers/dri/radeon/radeon_state.c index 1fcb545204..1c9ec36dae 100644 --- a/src/mesa/drivers/dri/radeon/radeon_state.c +++ b/src/mesa/drivers/dri/radeon/radeon_state.c @@ -1400,7 +1400,7 @@ static void radeonClearStencil( GLcontext *ctx, GLint s ) void radeonUpdateWindow( GLcontext *ctx ) { r100ContextPtr rmesa = R100_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = dPriv ? (GLfloat) dPriv->x : 0; GLfloat yoffset = dPriv ? (GLfloat) dPriv->y + dPriv->h : 0; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -1455,7 +1455,7 @@ static void radeonDepthRange( GLcontext *ctx, GLclampd nearval, void radeonUpdateViewportOffset( GLcontext *ctx ) { r100ContextPtr rmesa = R100_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = radeon_get_drawable(&rmesa->radeon); + __DRIdrawable *dPriv = radeon_get_drawable(&rmesa->radeon); GLfloat xoffset = (GLfloat)dPriv->x; GLfloat yoffset = (GLfloat)dPriv->y + dPriv->h; const GLfloat *v = ctx->Viewport._WindowMap.m; diff --git a/src/mesa/drivers/dri/radeon/radeon_tcl.c b/src/mesa/drivers/dri/radeon/radeon_tcl.c index b334ea05e5..cd02bfbcf5 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tcl.c +++ b/src/mesa/drivers/dri/radeon/radeon_tcl.c @@ -412,6 +412,7 @@ static GLuint radeonEnsureEmitSize( GLcontext * ctx , GLuint inputs ) space_required += vbuf; else space_required += index + elts; + space_required += VB->Primitive[i].count * 3; space_required += AOS_BUFSZ(nr_aos); } space_required += SCISSOR_BUFSZ; diff --git a/src/mesa/drivers/dri/radeon/radeon_tex.c b/src/mesa/drivers/dri/radeon/radeon_tex.c index 749ab75f20..14163f13af 100644 --- a/src/mesa/drivers/dri/radeon/radeon_tex.c +++ b/src/mesa/drivers/dri/radeon/radeon_tex.c @@ -341,7 +341,7 @@ static void radeonTexParameter( GLcontext *ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - radeonSetTexBorderColor( t, texObj->BorderColor ); + radeonSetTexBorderColor( t, texObj->BorderColor.f ); break; case GL_TEXTURE_BASE_LEVEL: @@ -428,7 +428,7 @@ radeonNewTextureObject( GLcontext *ctx, GLuint name, GLenum target ) radeonSetTexWrap( t, t->base.WrapS, t->base.WrapT ); radeonSetTexMaxAnisotropy( t, t->base.MaxAnisotropy ); radeonSetTexFilter( t, t->base.MinFilter, t->base.MagFilter ); - radeonSetTexBorderColor( t, t->base.BorderColor ); + radeonSetTexBorderColor( t, t->base.BorderColor.f ); return &t->base; } diff --git a/src/mesa/drivers/dri/savage/savage_init.h b/src/mesa/drivers/dri/savage/savage_init.h index abb8440fc4..bfd3077d70 100644 --- a/src/mesa/drivers/dri/savage/savage_init.h +++ b/src/mesa/drivers/dri/savage/savage_init.h @@ -66,7 +66,7 @@ typedef struct { unsigned int logTextureGranularity[SAVAGE_NR_TEX_HEAPS]; drmAddress texVirtual[SAVAGE_NR_TEX_HEAPS]; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; savageRegion aperture; savageRegion agpTextures; diff --git a/src/mesa/drivers/dri/savage/savage_xmesa.c b/src/mesa/drivers/dri/savage/savage_xmesa.c index d307b81e8e..8e879ca41c 100644 --- a/src/mesa/drivers/dri/savage/savage_xmesa.c +++ b/src/mesa/drivers/dri/savage/savage_xmesa.c @@ -168,7 +168,7 @@ PUBLIC const __DRIextension *savageScreenExtensions[] = { }; static GLboolean -savageInitDriver(__DRIscreenPrivate *sPriv) +savageInitDriver(__DRIscreen *sPriv) { savageScreenPrivate *savageScreen; SAVAGEDRIPtr gDRIPriv = (SAVAGEDRIPtr)sPriv->pDevPriv; @@ -272,7 +272,7 @@ savageInitDriver(__DRIscreenPrivate *sPriv) /* Accessed by dlsym from dri_mesa_init.c */ static void -savageDestroyScreen(__DRIscreenPrivate *sPriv) +savageDestroyScreen(__DRIscreen *sPriv) { savageScreenPrivate *savageScreen = (savageScreenPrivate *)sPriv->private; @@ -288,12 +288,12 @@ savageDestroyScreen(__DRIscreenPrivate *sPriv) static GLboolean savageCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { GLcontext *ctx, *shareCtx; savageContextPtr imesa; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; struct dd_function_table functions; savageScreenPrivate *savageScreen = (savageScreenPrivate *)sPriv->private; drm_savage_sarea_t *saPriv=(drm_savage_sarea_t *)(((char*)sPriv->pSAREA)+ @@ -546,7 +546,7 @@ savageCreateContext( const __GLcontextModes *mesaVis, } static void -savageDestroyContext(__DRIcontextPrivate *driContextPriv) +savageDestroyContext(__DRIcontext *driContextPriv) { savageContextPtr imesa = (savageContextPtr) driContextPriv->driverPrivate; GLuint i; @@ -580,8 +580,8 @@ savageDestroyContext(__DRIcontextPrivate *driContextPriv) static GLboolean -savageCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +savageCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap) { @@ -675,13 +675,13 @@ savageCreateBuffer( __DRIscreenPrivate *driScrnPriv, } static void -savageDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +savageDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } #if 0 -void XMesaSwapBuffers(__DRIdrawablePrivate *driDrawPriv) +void XMesaSwapBuffers(__DRIdrawable *driDrawPriv) { /* XXX should do swap according to the buffer, not the context! */ savageContextPtr imesa = savageCtx; @@ -694,7 +694,7 @@ void XMesaSwapBuffers(__DRIdrawablePrivate *driDrawPriv) void savageXMesaSetClipRects(savageContextPtr imesa) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; + __DRIdrawable *dPriv = imesa->driDrawable; if ((dPriv->numBackClipRects == 0) || (imesa->glCtx->DrawBuffer->_ColorDrawBufferIndexes[0] == BUFFER_FRONT_LEFT)) { @@ -715,8 +715,8 @@ void savageXMesaSetClipRects(savageContextPtr imesa) static void savageXMesaWindowMoved( savageContextPtr imesa ) { - __DRIdrawablePrivate *const drawable = imesa->driDrawable; - __DRIdrawablePrivate *const readable = imesa->driReadable; + __DRIdrawable *const drawable = imesa->driDrawable; + __DRIdrawable *const readable = imesa->driReadable; if (0) fprintf(stderr, "savageXMesaWindowMoved\n\n"); @@ -731,7 +731,7 @@ static void savageXMesaWindowMoved( savageContextPtr imesa ) static GLboolean -savageUnbindContext(__DRIcontextPrivate *driContextPriv) +savageUnbindContext(__DRIcontext *driContextPriv) { savageContextPtr savage = (savageContextPtr) driContextPriv->driverPrivate; if (savage) @@ -742,7 +742,7 @@ savageUnbindContext(__DRIcontextPrivate *driContextPriv) #if 0 static GLboolean -savageOpenFullScreen(__DRIcontextPrivate *driContextPriv) +savageOpenFullScreen(__DRIcontext *driContextPriv) { @@ -761,7 +761,7 @@ savageOpenFullScreen(__DRIcontextPrivate *driContextPriv) } static GLboolean -savageCloseFullScreen(__DRIcontextPrivate *driContextPriv) +savageCloseFullScreen(__DRIcontext *driContextPriv) { if (driContextPriv) { @@ -777,9 +777,9 @@ savageCloseFullScreen(__DRIcontextPrivate *driContextPriv) #endif static GLboolean -savageMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +savageMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (driContextPriv) { savageContextPtr imesa @@ -816,9 +816,9 @@ savageMakeCurrent(__DRIcontextPrivate *driContextPriv, void savageGetLock( savageContextPtr imesa, GLuint flags ) { - __DRIdrawablePrivate *const drawable = imesa->driDrawable; - __DRIdrawablePrivate *const readable = imesa->driReadable; - __DRIscreenPrivate *sPriv = imesa->driScreen; + __DRIdrawable *const drawable = imesa->driDrawable; + __DRIdrawable *const readable = imesa->driReadable; + __DRIscreen *sPriv = imesa->driScreen; drm_savage_sarea_t *sarea = imesa->sarea; int me = imesa->hHWContext; int stamp = drawable->lastStamp; @@ -883,7 +883,7 @@ void savageGetLock( savageContextPtr imesa, GLuint flags ) } static const __DRIconfig ** -savageFillInModes( __DRIscreenPrivate *psp, +savageFillInModes( __DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, GLboolean have_back_buffer ) { @@ -967,7 +967,7 @@ savageFillInModes( __DRIscreenPrivate *psp, * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -savageInitScreen(__DRIscreenPrivate *psp) +savageInitScreen(__DRIscreen *psp) { static const __DRIversion ddx_expected = { 2, 0, 0 }; static const __DRIversion dri_expected = { 4, 0, 0 }; @@ -1001,3 +1001,10 @@ const struct __DriverAPIRec driDriverAPI = { savageMakeCurrent, savageUnbindContext }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/savage/savagecontext.h b/src/mesa/drivers/dri/savage/savagecontext.h index 53a37db1cb..ba1e6e1e1a 100644 --- a/src/mesa/drivers/dri/savage/savagecontext.h +++ b/src/mesa/drivers/dri/savage/savagecontext.h @@ -271,10 +271,10 @@ struct savage_context_t { drm_hw_lock_t *driHwLock; GLuint driFd; - __DRIdrawablePrivate *driDrawable; - __DRIdrawablePrivate *driReadable; + __DRIdrawable *driDrawable; + __DRIdrawable *driReadable; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; savageScreenPrivate *savageScreen; drm_savage_sarea_t *sarea; diff --git a/src/mesa/drivers/dri/savage/savageioctl.c b/src/mesa/drivers/dri/savage/savageioctl.c index 706fc97935..d0b64e801a 100644 --- a/src/mesa/drivers/dri/savage/savageioctl.c +++ b/src/mesa/drivers/dri/savage/savageioctl.c @@ -433,7 +433,7 @@ static void savageDDClear( GLcontext *ctx, GLbitfield mask ) /* * Copy the back buffer to the front buffer. */ -void savageSwapBuffers( __DRIdrawablePrivate *dPriv ) +void savageSwapBuffers( __DRIdrawable *dPriv ) { savageContextPtr imesa; @@ -537,7 +537,7 @@ void savageFlushVertices( savageContextPtr imesa ) void savageFlushCmdBufLocked( savageContextPtr imesa, GLboolean discard ) { - __DRIdrawablePrivate *dPriv = imesa->driDrawable; + __DRIdrawable *dPriv = imesa->driDrawable; if (!imesa->dmaVtxBuf.total) discard = GL_FALSE; diff --git a/src/mesa/drivers/dri/savage/savageioctl.h b/src/mesa/drivers/dri/savage/savageioctl.h index 639605cc51..e7e80816c1 100644 --- a/src/mesa/drivers/dri/savage/savageioctl.h +++ b/src/mesa/drivers/dri/savage/savageioctl.h @@ -39,7 +39,7 @@ void savageFlushCmdBuf( savageContextPtr imesa, GLboolean discard ); void savageDDInitIoctlFuncs( GLcontext *ctx ); -void savageSwapBuffers( __DRIdrawablePrivate *dPriv ); +void savageSwapBuffers( __DRIdrawable *dPriv ); #define WAIT_IDLE_EMPTY(imesa) do { \ if (SAVAGE_DEBUG & DEBUG_VERBOSE_MSG) \ diff --git a/src/mesa/drivers/dri/savage/savagespan.c b/src/mesa/drivers/dri/savage/savagespan.c index 3bb6fbcc63..792e166d9c 100644 --- a/src/mesa/drivers/dri/savage/savagespan.c +++ b/src/mesa/drivers/dri/savage/savagespan.c @@ -34,7 +34,7 @@ #define LOCAL_VARS \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ - __DRIdrawablePrivate *const dPriv = drb->dPriv; \ + __DRIdrawable *const dPriv = drb->dPriv; \ GLuint cpp = drb->cpp; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ @@ -44,7 +44,7 @@ #define LOCAL_DEPTH_VARS \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ - __DRIdrawablePrivate *const dPriv = drb->dPriv; \ + __DRIdrawable *const dPriv = drb->dPriv; \ GLuint zpp = drb->cpp; \ GLuint pitch = drb->pitch; \ GLuint height = dPriv->h; \ diff --git a/src/mesa/drivers/dri/savage/savagetex.c b/src/mesa/drivers/dri/savage/savagetex.c index 6c97bb6c70..97598f599e 100644 --- a/src/mesa/drivers/dri/savage/savagetex.c +++ b/src/mesa/drivers/dri/savage/savagetex.c @@ -507,7 +507,7 @@ savageAllocTexObj( struct gl_texture_object *texObj ) savageSetTexWrapping(t,texObj->WrapS,texObj->WrapT); savageSetTexFilter(t,texObj->MinFilter,texObj->MagFilter); - savageSetTexBorderColor(t,texObj->BorderColor); + savageSetTexBorderColor(t,texObj->BorderColor.f); } return t; @@ -2044,7 +2044,7 @@ static void savageTexParameter( GLcontext *ctx, GLenum target, break; case GL_TEXTURE_BORDER_COLOR: - savageSetTexBorderColor(t,tObj->BorderColor); + savageSetTexBorderColor(t,tObj->BorderColor.f); break; default: diff --git a/src/mesa/drivers/dri/sis/sis_context.c b/src/mesa/drivers/dri/sis/sis_context.c index f501e7ad2e..0944f4d8b4 100644 --- a/src/mesa/drivers/dri/sis/sis_context.c +++ b/src/mesa/drivers/dri/sis/sis_context.c @@ -83,6 +83,7 @@ static struct dri_extension card_extensions[] = { NULL, NULL } }; +#if 0 static struct dri_extension card_extensions_6326[] = { /*{ "GL_ARB_texture_border_clamp", NULL },*/ @@ -90,6 +91,7 @@ static struct dri_extension card_extensions_6326[] = /*{ "GL_MESA_ycbcr_texture", NULL },*/ { NULL, NULL } }; +#endif static const struct dri_debug_control debug_control[] = { @@ -160,11 +162,11 @@ void sisReAllocateBuffers(GLcontext *ctx, GLframebuffer *drawbuffer, GLboolean sisCreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; sisContextPtr smesa; sisScreenPtr sisScreen; int i; @@ -337,7 +339,7 @@ sisCreateContext( const __GLcontextModes *glVisual, } void -sisDestroyContext ( __DRIcontextPrivate *driContextPriv ) +sisDestroyContext ( __DRIcontext *driContextPriv ) { sisContextPtr smesa = (sisContextPtr)driContextPriv->driverPrivate; @@ -365,9 +367,9 @@ sisDestroyContext ( __DRIcontextPrivate *driContextPriv ) } GLboolean -sisMakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ) +sisMakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ) { if ( driContextPriv ) { GET_CURRENT_CONTEXT(ctx); @@ -396,7 +398,7 @@ sisMakeCurrent( __DRIcontextPrivate *driContextPriv, } GLboolean -sisUnbindContext( __DRIcontextPrivate *driContextPriv ) +sisUnbindContext( __DRIcontext *driContextPriv ) { return GL_TRUE; } diff --git a/src/mesa/drivers/dri/sis/sis_context.h b/src/mesa/drivers/dri/sis/sis_context.h index bc53cb5efa..4179ee081a 100644 --- a/src/mesa/drivers/dri/sis/sis_context.h +++ b/src/mesa/drivers/dri/sis/sis_context.h @@ -359,9 +359,9 @@ struct sis_context /* Mirrors of some DRI state */ - __DRIcontextPrivate *driContext; /* DRI context */ - __DRIscreenPrivate *driScreen; /* DRI screen */ - __DRIdrawablePrivate *driDrawable; /* DRI drawable bound to this ctx */ + __DRIcontext *driContext; /* DRI context */ + __DRIscreen *driScreen; /* DRI screen */ + __DRIdrawable *driDrawable; /* DRI drawable bound to this ctx */ unsigned int lastStamp; /* mirror driDrawable->lastStamp */ @@ -439,18 +439,18 @@ enum _sis_verbose { }; extern GLboolean sisCreateContext( const __GLcontextModes *glVisual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ); -extern void sisDestroyContext( __DRIcontextPrivate * ); +extern void sisDestroyContext( __DRIcontext * ); void sisReAllocateBuffers(GLcontext *ctx, GLframebuffer *drawbuffer, GLuint width, GLuint height); -extern GLboolean sisMakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ); +extern GLboolean sisMakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ); -extern GLboolean sisUnbindContext( __DRIcontextPrivate *driContextPriv ); +extern GLboolean sisUnbindContext( __DRIcontext *driContextPriv ); void WaitEngIdle (sisContextPtr smesa); void Wait2DEngIdle (sisContextPtr smesa); diff --git a/src/mesa/drivers/dri/sis/sis_lock.c b/src/mesa/drivers/dri/sis/sis_lock.c index 806110cad4..b8ff4e31e2 100644 --- a/src/mesa/drivers/dri/sis/sis_lock.c +++ b/src/mesa/drivers/dri/sis/sis_lock.c @@ -46,8 +46,8 @@ CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. void sisGetLock( sisContextPtr smesa, GLuint flags ) { - __DRIdrawablePrivate *dPriv = smesa->driDrawable; - __DRIscreenPrivate *sPriv = smesa->driScreen; + __DRIdrawable *dPriv = smesa->driDrawable; + __DRIscreen *sPriv = smesa->driScreen; SISSAREAPrivPtr sarea = smesa->sarea; drmGetLock( smesa->driFd, smesa->hHWContext, flags ); diff --git a/src/mesa/drivers/dri/sis/sis_screen.c b/src/mesa/drivers/dri/sis/sis_screen.c index fec9158236..d38b93ec9b 100644 --- a/src/mesa/drivers/dri/sis/sis_screen.c +++ b/src/mesa/drivers/dri/sis/sis_screen.c @@ -65,7 +65,7 @@ static const GLuint __driNConfigOptions = 3; extern const struct dri_extension card_extensions[]; static const __DRIconfig ** -sisFillInModes(__DRIscreenPrivate *psp, int bpp) +sisFillInModes(__DRIscreen *psp, int bpp) { __DRIconfig **configs; unsigned depth_buffer_factor; @@ -117,7 +117,7 @@ sisFillInModes(__DRIscreenPrivate *psp, int bpp) /* Create the device specific screen private data struct. */ static sisScreenPtr -sisCreateScreen( __DRIscreenPrivate *sPriv ) +sisCreateScreen( __DRIscreen *sPriv ) { sisScreenPtr sisScreen; SISDRIPtr sisDRIPriv = (SISDRIPtr)sPriv->pDevPriv; @@ -172,7 +172,7 @@ sisCreateScreen( __DRIscreenPrivate *sPriv ) /* Destroy the device specific screen private data struct. */ static void -sisDestroyScreen( __DRIscreenPrivate *sPriv ) +sisDestroyScreen( __DRIscreen *sPriv ) { sisScreenPtr sisScreen = (sisScreenPtr)sPriv->private; @@ -192,8 +192,8 @@ sisDestroyScreen( __DRIscreenPrivate *sPriv ) * data. */ static GLboolean -sisCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +sisCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -219,12 +219,12 @@ sisCreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -sisDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +sisDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } -static void sisCopyBuffer( __DRIdrawablePrivate *dPriv ) +static void sisCopyBuffer( __DRIdrawable *dPriv ) { sisContextPtr smesa = (sisContextPtr)dPriv->driContextPriv->driverPrivate; int i; @@ -259,7 +259,7 @@ static void sisCopyBuffer( __DRIdrawablePrivate *dPriv ) /* Copy the back color buffer to the front color buffer */ static void -sisSwapBuffers(__DRIdrawablePrivate *dPriv) +sisSwapBuffers(__DRIdrawable *dPriv) { if (dPriv->driContextPriv && dPriv->driContextPriv->driverPrivate) { sisContextPtr smesa = (sisContextPtr) dPriv->driContextPriv->driverPrivate; @@ -284,7 +284,7 @@ sisSwapBuffers(__DRIdrawablePrivate *dPriv) * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -sisInitScreen(__DRIscreenPrivate *psp) +sisInitScreen(__DRIscreen *psp) { static const __DRIversion ddx_expected = {0, 8, 0}; static const __DRIversion dri_expected = {4, 0, 0}; @@ -325,3 +325,10 @@ const struct __DriverAPIRec driDriverAPI = { .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/sis/sis_screen.h b/src/mesa/drivers/dri/sis/sis_screen.h index 07c29cfa09..8009fecc31 100644 --- a/src/mesa/drivers/dri/sis/sis_screen.h +++ b/src/mesa/drivers/dri/sis/sis_screen.h @@ -50,7 +50,7 @@ typedef struct { int cpp; unsigned int screenX, screenY; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; unsigned int sarea_priv_offset; /* Configuration cache with default values for all contexts */ diff --git a/src/mesa/drivers/dri/sis/sis_span.c b/src/mesa/drivers/dri/sis/sis_span.c index cfbb51007d..008b00160e 100644 --- a/src/mesa/drivers/dri/sis/sis_span.c +++ b/src/mesa/drivers/dri/sis/sis_span.c @@ -42,7 +42,7 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. #define LOCAL_VARS \ sisContextPtr smesa = SIS_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = smesa->driDrawable; \ + __DRIdrawable *dPriv = smesa->driDrawable; \ struct sis_renderbuffer *srb = (struct sis_renderbuffer *) rb; \ GLuint pitch = srb->pitch; \ char *buf = srb->map; \ @@ -52,7 +52,7 @@ USE OR OTHER DEALINGS IN THE SOFTWARE. #define LOCAL_DEPTH_VARS \ sisContextPtr smesa = SIS_CONTEXT(ctx); \ - __DRIdrawablePrivate *dPriv = smesa->driDrawable; \ + __DRIdrawable *dPriv = smesa->driDrawable; \ struct sis_renderbuffer *srb = (struct sis_renderbuffer *) rb; \ char *buf = srb->map; diff --git a/src/mesa/drivers/dri/sis/sis_texstate.c b/src/mesa/drivers/dri/sis/sis_texstate.c index a507173b21..4c22a10cf7 100644 --- a/src/mesa/drivers/dri/sis/sis_texstate.c +++ b/src/mesa/drivers/dri/sis/sis_texstate.c @@ -457,10 +457,10 @@ sis_set_texobj_parm( GLcontext *ctx, struct gl_texture_object *texObj, { GLubyte c[4]; - CLAMPED_FLOAT_TO_UBYTE(c[0], texObj->BorderColor[0]); - CLAMPED_FLOAT_TO_UBYTE(c[1], texObj->BorderColor[1]); - CLAMPED_FLOAT_TO_UBYTE(c[2], texObj->BorderColor[2]); - CLAMPED_FLOAT_TO_UBYTE(c[3], texObj->BorderColor[3]); + CLAMPED_FLOAT_TO_UBYTE(c[0], texObj->BorderColor.f[0]); + CLAMPED_FLOAT_TO_UBYTE(c[1], texObj->BorderColor.f[1]); + CLAMPED_FLOAT_TO_UBYTE(c[2], texObj->BorderColor.f[2]); + CLAMPED_FLOAT_TO_UBYTE(c[3], texObj->BorderColor.f[3]); current->texture[hw_unit].hwTextureBorderColor = PACK_COLOR_8888(c[3], c[0], c[1], c[2]); diff --git a/src/mesa/drivers/dri/tdfx/tdfx_context.c b/src/mesa/drivers/dri/tdfx/tdfx_context.c index e742d414a5..edb1875f76 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_context.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_context.c @@ -165,12 +165,12 @@ static const struct dri_debug_control debug_control[] = }; GLboolean tdfxCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ) { tdfxContextPtr fxMesa; GLcontext *ctx, *shareCtx; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; tdfxScreenPrivate *fxScreen = (tdfxScreenPrivate *) sPriv->private; TDFXSAREAPriv *saPriv = (TDFXSAREAPriv *) ((char *) sPriv->pSAREA + sizeof(drm_sarea_t)); @@ -441,7 +441,7 @@ static GLboolean tdfxInitVertexFormats( tdfxContextPtr fxMesa ) * Initialize the state in an tdfxContextPtr struct. */ static GLboolean -tdfxInitContext( __DRIdrawablePrivate *driDrawPriv, tdfxContextPtr fxMesa ) +tdfxInitContext( __DRIdrawable *driDrawPriv, tdfxContextPtr fxMesa ) { /* KW: Would be nice to make one of these a member of the other. */ @@ -563,7 +563,7 @@ tdfxInitContext( __DRIdrawablePrivate *driDrawPriv, tdfxContextPtr fxMesa ) void -tdfxDestroyContext( __DRIcontextPrivate *driContextPriv ) +tdfxDestroyContext( __DRIcontext *driContextPriv ) { tdfxContextPtr fxMesa = (tdfxContextPtr) driContextPriv->driverPrivate; @@ -607,7 +607,7 @@ tdfxDestroyContext( __DRIcontextPrivate *driContextPriv ) GLboolean -tdfxUnbindContext( __DRIcontextPrivate *driContextPriv ) +tdfxUnbindContext( __DRIcontext *driContextPriv ) { GET_CURRENT_CONTEXT(ctx); tdfxContextPtr fxMesa = TDFX_CONTEXT(ctx); @@ -626,9 +626,9 @@ tdfxUnbindContext( __DRIcontextPrivate *driContextPriv ) GLboolean -tdfxMakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ) +tdfxMakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ) { if ( TDFX_DEBUG & DEBUG_VERBOSE_DRI ) { fprintf( stderr, "%s( %p )\n", __FUNCTION__, (void *)driContextPriv ); diff --git a/src/mesa/drivers/dri/tdfx/tdfx_context.h b/src/mesa/drivers/dri/tdfx/tdfx_context.h index 3bcb545119..6e25cac301 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_context.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_context.h @@ -892,18 +892,18 @@ struct tdfx_context { char rendererString[100]; /* stuff added for DRI */ - __DRIscreenPrivate *driScreen; - __DRIcontextPrivate *driContext; + __DRIscreen *driScreen; + __DRIcontext *driContext; /** * DRI drawable bound to this context for drawing. */ - __DRIdrawablePrivate *driDrawable; + __DRIdrawable *driDrawable; /** * DRI drawable bound to this context for reading. */ - __DRIdrawablePrivate *driReadable; + __DRIdrawable *driReadable; drm_context_t hHWContext; drm_hw_lock_t *driHwLock; @@ -938,19 +938,19 @@ struct tdfx_context { extern GLboolean tdfxCreateContext( const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate ); extern void -tdfxDestroyContext( __DRIcontextPrivate *driContextPriv ); +tdfxDestroyContext( __DRIcontext *driContextPriv ); extern GLboolean -tdfxUnbindContext( __DRIcontextPrivate *driContextPriv ); +tdfxUnbindContext( __DRIcontext *driContextPriv ); extern GLboolean -tdfxMakeCurrent( __DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv ); +tdfxMakeCurrent( __DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv ); extern GLboolean tdfxInitGlide( tdfxContextPtr tmesa ); diff --git a/src/mesa/drivers/dri/tdfx/tdfx_dd.c b/src/mesa/drivers/dri/tdfx/tdfx_dd.c index 8472df607a..ed8a331549 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_dd.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_dd.c @@ -91,7 +91,7 @@ static const GLubyte *tdfxDDGetString( GLcontext *ctx, GLenum name ) else { /* unexpected result: replace spaces with hyphens */ int i; - for (i = 0; hardware[i] && (i < sizeof(hardware)); i++) { + for (i = 0; i < sizeof(hardware) && hardware[i]; i++) { if (hardware[i] == ' ' || hardware[i] == '\t') { hardware[i] = '-'; } diff --git a/src/mesa/drivers/dri/tdfx/tdfx_lock.c b/src/mesa/drivers/dri/tdfx/tdfx_lock.c index 17cdc51ee1..4f84240104 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_lock.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_lock.c @@ -45,10 +45,10 @@ void tdfxGetLock( tdfxContextPtr fxMesa ) { - __DRIcontextPrivate *cPriv = fxMesa->driContext; - __DRIdrawablePrivate *const drawable = cPriv->driDrawablePriv; - __DRIdrawablePrivate *const readable = cPriv->driReadablePriv; - __DRIscreenPrivate *sPriv = drawable->driScreenPriv; + __DRIcontext *cPriv = fxMesa->driContext; + __DRIdrawable *const drawable = cPriv->driDrawablePriv; + __DRIdrawable *const readable = cPriv->driReadablePriv; + __DRIscreen *sPriv = drawable->driScreenPriv; TDFXSAREAPriv *saPriv = (TDFXSAREAPriv *) (((char *) sPriv->pSAREA) + fxMesa->fxScreen->sarea_priv_offset); unsigned int stamp = drawable->lastStamp; diff --git a/src/mesa/drivers/dri/tdfx/tdfx_pixels.c b/src/mesa/drivers/dri/tdfx/tdfx_pixels.c index a3b1775e90..65f0464f8a 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_pixels.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_pixels.c @@ -495,7 +495,7 @@ tdfx_readpixels_R5G6B5(GLcontext * ctx, GLint x, GLint y, { tdfxContextPtr fxMesa = TDFX_CONTEXT(ctx); GrLfbInfo_t info; - __DRIdrawablePrivate *const readable = fxMesa->driReadable; + __DRIdrawable *const readable = fxMesa->driReadable; const GLint winX = readable->x; const GLint winY = readable->y + readable->h - 1; const GLint scrX = winX + x; @@ -553,7 +553,7 @@ tdfx_readpixels_R8G8B8A8(GLcontext * ctx, GLint x, GLint y, { tdfxContextPtr fxMesa = TDFX_CONTEXT(ctx); GrLfbInfo_t info; - __DRIdrawablePrivate *const readable = fxMesa->driReadable; + __DRIdrawable *const readable = fxMesa->driReadable; const GLint winX = readable->x; const GLint winY = readable->y + readable->h - 1; const GLint scrX = winX + x; diff --git a/src/mesa/drivers/dri/tdfx/tdfx_render.c b/src/mesa/drivers/dri/tdfx/tdfx_render.c index 79d63f72ac..979bcd4514 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_render.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_render.c @@ -556,7 +556,7 @@ static void uploadTextureImages( tdfxContextPtr fxMesa ) */ void tdfxUploadClipping( tdfxContextPtr fxMesa ) { - __DRIdrawablePrivate *dPriv = fxMesa->driDrawable; + __DRIdrawable *dPriv = fxMesa->driDrawable; assert(dPriv); diff --git a/src/mesa/drivers/dri/tdfx/tdfx_screen.c b/src/mesa/drivers/dri/tdfx/tdfx_screen.c index 2eb0024d40..4422b5dec4 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_screen.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_screen.c @@ -70,7 +70,7 @@ static const __DRIextension *tdfxExtensions[] = { static const GLuint __driNConfigOptions = 1; static GLboolean -tdfxCreateScreen( __DRIscreenPrivate *sPriv ) +tdfxCreateScreen( __DRIscreen *sPriv ) { tdfxScreenPrivate *fxScreen; TDFXDRIPtr fxDRIPriv = (TDFXDRIPtr) sPriv->pDevPriv; @@ -121,7 +121,7 @@ tdfxCreateScreen( __DRIscreenPrivate *sPriv ) static void -tdfxDestroyScreen( __DRIscreenPrivate *sPriv ) +tdfxDestroyScreen( __DRIscreen *sPriv ) { tdfxScreenPrivate *fxScreen = (tdfxScreenPrivate *) sPriv->private; @@ -139,7 +139,7 @@ tdfxDestroyScreen( __DRIscreenPrivate *sPriv ) static GLboolean -tdfxInitDriver( __DRIscreenPrivate *sPriv ) +tdfxInitDriver( __DRIscreen *sPriv ) { if ( TDFX_DEBUG & DEBUG_VERBOSE_DRI ) { fprintf( stderr, "%s( %p )\n", __FUNCTION__, (void *)sPriv ); @@ -155,8 +155,8 @@ tdfxInitDriver( __DRIscreenPrivate *sPriv ) static GLboolean -tdfxCreateBuffer( __DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +tdfxCreateBuffer( __DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap ) { @@ -227,14 +227,14 @@ tdfxCreateBuffer( __DRIscreenPrivate *driScrnPriv, static void -tdfxDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +tdfxDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } static void -tdfxSwapBuffers( __DRIdrawablePrivate *driDrawPriv ) +tdfxSwapBuffers( __DRIdrawable *driDrawPriv ) { GET_CURRENT_CONTEXT(ctx); @@ -253,7 +253,7 @@ tdfxSwapBuffers( __DRIdrawablePrivate *driDrawPriv ) * we have to do a glFinish (per the GLX spec). */ if ( ctx ) { - __DRIdrawablePrivate *curDrawPriv; + __DRIdrawable *curDrawPriv; fxMesa = TDFX_CONTEXT(ctx); curDrawPriv = fxMesa->driContext->driDrawablePriv; @@ -341,7 +341,7 @@ tdfxSwapBuffers( __DRIdrawablePrivate *driDrawPriv ) } static const __DRIconfig ** -tdfxFillInModes(__DRIscreenPrivate *psp, +tdfxFillInModes(__DRIscreen *psp, unsigned pixel_bits, unsigned depth_bits, unsigned stencil_bits, @@ -440,3 +440,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/tdfx/tdfx_screen.h b/src/mesa/drivers/dri/tdfx/tdfx_screen.h index 5a68898b36..6aa42e8667 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_screen.h +++ b/src/mesa/drivers/dri/tdfx/tdfx_screen.h @@ -61,7 +61,7 @@ typedef struct { int textureOffset; int textureSize; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; unsigned int sarea_priv_offset; /* Configuration cache with default values for all contexts */ diff --git a/src/mesa/drivers/dri/tdfx/tdfx_span.c b/src/mesa/drivers/dri/tdfx/tdfx_span.c index 6b38fa5a01..a17bcd952a 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_span.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_span.c @@ -47,7 +47,7 @@ #define LOCAL_VARS \ driRenderbuffer *drb = (driRenderbuffer *) rb; \ - __DRIdrawablePrivate *const dPriv = drb->dPriv; \ + __DRIdrawable *const dPriv = drb->dPriv; \ GLuint pitch = drb->backBuffer ? info.strideInBytes \ : (drb->pitch * drb->cpp); \ const GLuint bottom = dPriv->h - 1; \ @@ -104,7 +104,7 @@ #define HW_READ_CLIPLOOP() \ do { \ - const __DRIdrawablePrivate *dPriv = fxMesa->driDrawable; \ + const __DRIdrawable *dPriv = fxMesa->driDrawable; \ drm_clip_rect_t *rect = dPriv->pClipRects; \ int _nc = dPriv->numClipRects; \ while (_nc--) { \ diff --git a/src/mesa/drivers/dri/tdfx/tdfx_state.c b/src/mesa/drivers/dri/tdfx/tdfx_state.c index cf2712720f..cdb61a0ce0 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_state.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_state.c @@ -621,7 +621,7 @@ static int intersect_rect( drm_clip_rect_t *out, void tdfxUpdateClipping( GLcontext *ctx ) { tdfxContextPtr fxMesa = TDFX_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = fxMesa->driDrawable; + __DRIdrawable *dPriv = fxMesa->driDrawable; if ( TDFX_DEBUG & DEBUG_VERBOSE_API ) { fprintf( stderr, "%s()\n", __FUNCTION__ ); diff --git a/src/mesa/drivers/dri/tdfx/tdfx_texstate.c b/src/mesa/drivers/dri/tdfx/tdfx_texstate.c index bbd2c8cfee..3f737878ed 100644 --- a/src/mesa/drivers/dri/tdfx/tdfx_texstate.c +++ b/src/mesa/drivers/dri/tdfx/tdfx_texstate.c @@ -1314,7 +1314,7 @@ SetupDoubleTexEnvVoodoo3(GLcontext *ctx, int tmu0, fxMesa->TexCombine[0].InvertRGB = FXFALSE; fxMesa->TexCombine[0].InvertAlpha = FXFALSE; - if ((baseFormat0 == GL_RGB) && (baseFormat0 == GL_LUMINANCE)) { + if ((baseFormat0 == GL_RGB) || (baseFormat0 == GL_LUMINANCE)) { fxMesa->AlphaCombine.Function = GR_COMBINE_FUNCTION_LOCAL; fxMesa->AlphaCombine.Factor = GR_COMBINE_FACTOR_NONE; fxMesa->AlphaCombine.Local = locala; diff --git a/src/mesa/drivers/dri/unichrome/via_context.c b/src/mesa/drivers/dri/unichrome/via_context.c index 0524becf3e..d17a160271 100644 --- a/src/mesa/drivers/dri/unichrome/via_context.c +++ b/src/mesa/drivers/dri/unichrome/via_context.c @@ -148,7 +148,7 @@ viaRenderbufferStorage(GLcontext *ctx, struct gl_renderbuffer *rb, static void viaInitRenderbuffer(struct via_renderbuffer *vrb, GLenum format, - __DRIdrawablePrivate *dPriv) + __DRIdrawable *dPriv) { const GLuint name = 0; struct gl_renderbuffer *rb = & vrb->Base; @@ -207,7 +207,7 @@ viaInitRenderbuffer(struct via_renderbuffer *vrb, GLenum format, static GLboolean calculate_buffer_parameters(struct via_context *vmesa, struct gl_framebuffer *fb, - __DRIdrawablePrivate *dPriv) + __DRIdrawable *dPriv) { const unsigned shift = vmesa->viaScreen->bitsPerPixel / 16; const unsigned extra = 32; @@ -460,12 +460,12 @@ FreeBuffer(struct via_context *vmesa) GLboolean viaCreateContext(const __GLcontextModes *visual, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate) { GLcontext *ctx, *shareCtx; struct via_context *vmesa; - __DRIscreenPrivate *sPriv = driContextPriv->driScreenPriv; + __DRIscreen *sPriv = driContextPriv->driScreenPriv; viaScreenPrivate *viaScreen = (viaScreenPrivate *)sPriv->private; drm_via_sarea_t *saPriv = (drm_via_sarea_t *) (((GLubyte *)sPriv->pSAREA) + viaScreen->sareaPrivOffset); @@ -679,7 +679,7 @@ viaCreateContext(const __GLcontextModes *visual, } void -viaDestroyContext(__DRIcontextPrivate *driContextPriv) +viaDestroyContext(__DRIcontext *driContextPriv) { GET_CURRENT_CONTEXT(ctx); struct via_context *vmesa = @@ -729,8 +729,8 @@ viaDestroyContext(__DRIcontextPrivate *driContextPriv) void viaXMesaWindowMoved(struct via_context *vmesa) { - __DRIdrawablePrivate *const drawable = vmesa->driDrawable; - __DRIdrawablePrivate *const readable = vmesa->driReadable; + __DRIdrawable *const drawable = vmesa->driDrawable; + __DRIdrawable *const readable = vmesa->driReadable; struct via_renderbuffer * draw_buffer; struct via_renderbuffer * read_buffer; GLuint bytePerPixel = vmesa->viaScreen->bitsPerPixel >> 3; @@ -813,15 +813,15 @@ void viaXMesaWindowMoved(struct via_context *vmesa) } GLboolean -viaUnbindContext(__DRIcontextPrivate *driContextPriv) +viaUnbindContext(__DRIcontext *driContextPriv) { return GL_TRUE; } GLboolean -viaMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv) +viaMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv) { if (VIA_DEBUG & DEBUG_DRI) { fprintf(stderr, "driContextPriv = %016lx\n", (unsigned long)driContextPriv); @@ -897,8 +897,8 @@ viaMakeCurrent(__DRIcontextPrivate *driContextPriv, void viaGetLock(struct via_context *vmesa, GLuint flags) { - __DRIdrawablePrivate *dPriv = vmesa->driDrawable; - __DRIscreenPrivate *sPriv = vmesa->driScreen; + __DRIdrawable *dPriv = vmesa->driDrawable; + __DRIscreen *sPriv = vmesa->driScreen; drmGetLock(vmesa->driFd, vmesa->hHWContext, flags); @@ -928,9 +928,9 @@ void viaGetLock(struct via_context *vmesa, GLuint flags) void -viaSwapBuffers(__DRIdrawablePrivate *drawablePrivate) +viaSwapBuffers(__DRIdrawable *drawablePrivate) { - __DRIdrawablePrivate *dPriv = (__DRIdrawablePrivate *)drawablePrivate; + __DRIdrawable *dPriv = (__DRIdrawable *)drawablePrivate; if (dPriv && dPriv->driContextPriv && diff --git a/src/mesa/drivers/dri/unichrome/via_context.h b/src/mesa/drivers/dri/unichrome/via_context.h index 4cc9e475c2..4e1ab3a6ca 100644 --- a/src/mesa/drivers/dri/unichrome/via_context.h +++ b/src/mesa/drivers/dri/unichrome/via_context.h @@ -105,7 +105,7 @@ struct via_renderbuffer { int drawW; int drawH; - __DRIdrawablePrivate *dPriv; + __DRIdrawable *dPriv; }; @@ -294,14 +294,14 @@ struct via_context { /** * DRI drawable bound to this context for drawing. */ - __DRIdrawablePrivate *driDrawable; + __DRIdrawable *driDrawable; /** * DRI drawable bound to this context for reading. */ - __DRIdrawablePrivate *driReadable; + __DRIdrawable *driReadable; - __DRIscreenPrivate *driScreen; + __DRIscreen *driScreen; viaScreenPrivate *viaScreen; drm_via_sarea_t *sarea; volatile GLuint* regMMIOBase; diff --git a/src/mesa/drivers/dri/unichrome/via_ioctl.c b/src/mesa/drivers/dri/unichrome/via_ioctl.c index 91c94fa377..8d4edfa305 100644 --- a/src/mesa/drivers/dri/unichrome/via_ioctl.c +++ b/src/mesa/drivers/dri/unichrome/via_ioctl.c @@ -205,7 +205,7 @@ static void viaFillBuffer(struct via_context *vmesa, static void viaClear(GLcontext *ctx, GLbitfield mask) { struct via_context *vmesa = VIA_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = vmesa->driDrawable; + __DRIdrawable *dPriv = vmesa->driDrawable; struct via_renderbuffer *const vrb = (struct via_renderbuffer *) dPriv->driverPrivate; int flag = 0; @@ -507,12 +507,12 @@ void viaWaitIdleLocked( struct via_context *vmesa, GLboolean light ) * except that WAIT_IDLE() will spin the CPU polling, while this is * IRQ driven. */ -static void viaWaitIdleVBlank( __DRIdrawablePrivate *dPriv, +static void viaWaitIdleVBlank( __DRIdrawable *dPriv, struct via_context *vmesa, GLuint value ) { GLboolean missed_target; - __DRIscreenPrivate *psp = dPriv->driScreenPriv; + __DRIscreen *psp = dPriv->driScreenPriv; VIA_FLUSH_DMA(vmesa); @@ -591,11 +591,11 @@ void viaResetPageFlippingLocked(struct via_context *vmesa) /* * Copy the back buffer to the front buffer. */ -void viaCopyBuffer(__DRIdrawablePrivate *dPriv) +void viaCopyBuffer(__DRIdrawable *dPriv) { struct via_context *vmesa = (struct via_context *)dPriv->driContextPriv->driverPrivate; - __DRIscreenPrivate *psp = dPriv->driScreenPriv; + __DRIscreen *psp = dPriv->driScreenPriv; if (VIA_DEBUG & DEBUG_IOCTL) fprintf(stderr, @@ -635,12 +635,12 @@ void viaCopyBuffer(__DRIdrawablePrivate *dPriv) } -void viaPageFlip(__DRIdrawablePrivate *dPriv) +void viaPageFlip(__DRIdrawable *dPriv) { struct via_context *vmesa = (struct via_context *)dPriv->driContextPriv->driverPrivate; struct via_renderbuffer buffer_tmp; - __DRIscreenPrivate *psp = dPriv->driScreenPriv; + __DRIscreen *psp = dPriv->driScreenPriv; VIA_FLUSH_DMA(vmesa); if (dPriv->vblFlags == VBLANK_FLAG_SYNC && diff --git a/src/mesa/drivers/dri/unichrome/via_ioctl.h b/src/mesa/drivers/dri/unichrome/via_ioctl.h index 14a833a97d..c6b32cf085 100644 --- a/src/mesa/drivers/dri/unichrome/via_ioctl.h +++ b/src/mesa/drivers/dri/unichrome/via_ioctl.h @@ -33,8 +33,8 @@ void viaFlushDma(struct via_context *vmesa); void viaFlushDmaLocked(struct via_context *vmesa, GLuint flags); void viaInitIoctlFuncs(GLcontext *ctx); -void viaCopyBuffer(__DRIdrawablePrivate *dpriv); -void viaPageFlip(__DRIdrawablePrivate *dpriv); +void viaCopyBuffer(__DRIdrawable *dpriv); +void viaPageFlip(__DRIdrawable *dpriv); void viaCheckDma(struct via_context *vmesa, GLuint bytes); void viaResetPageFlippingLocked(struct via_context *vmesa); void viaWaitIdle(struct via_context *vmesa, GLboolean light); diff --git a/src/mesa/drivers/dri/unichrome/via_screen.c b/src/mesa/drivers/dri/unichrome/via_screen.c index e0bf58ca9a..2cfb98317d 100644 --- a/src/mesa/drivers/dri/unichrome/via_screen.c +++ b/src/mesa/drivers/dri/unichrome/via_screen.c @@ -90,7 +90,7 @@ static void via_free_empty_buffers( drmBufMapPtr bufs ) static GLboolean -viaInitDriver(__DRIscreenPrivate *sPriv) +viaInitDriver(__DRIscreen *sPriv) { viaScreenPrivate *viaScreen; VIADRIPtr gDRIPriv = (VIADRIPtr)sPriv->pDevPriv; @@ -184,7 +184,7 @@ viaInitDriver(__DRIscreenPrivate *sPriv) } static void -viaDestroyScreen(__DRIscreenPrivate *sPriv) +viaDestroyScreen(__DRIscreen *sPriv) { viaScreenPrivate *viaScreen = (viaScreenPrivate *)sPriv->private; VIADRIPtr gDRIPriv = (VIADRIPtr)sPriv->pDevPriv; @@ -203,8 +203,8 @@ viaDestroyScreen(__DRIscreenPrivate *sPriv) static GLboolean -viaCreateBuffer(__DRIscreenPrivate *driScrnPriv, - __DRIdrawablePrivate *driDrawPriv, +viaCreateBuffer(__DRIscreen *driScrnPriv, + __DRIdrawable *driDrawPriv, const __GLcontextModes *mesaVis, GLboolean isPixmap) { @@ -314,13 +314,13 @@ viaCreateBuffer(__DRIscreenPrivate *driScrnPriv, static void -viaDestroyBuffer(__DRIdrawablePrivate *driDrawPriv) +viaDestroyBuffer(__DRIdrawable *driDrawPriv) { _mesa_reference_framebuffer((GLframebuffer **)(&(driDrawPriv->driverPrivate)), NULL); } static const __DRIconfig ** -viaFillInModes( __DRIscreenPrivate *psp, +viaFillInModes( __DRIscreen *psp, unsigned pixel_bits, GLboolean have_back_buffer ) { __DRIconfig **configs; @@ -377,7 +377,7 @@ viaFillInModes( __DRIscreenPrivate *psp, * \return the __GLcontextModes supported by this driver */ static const __DRIconfig ** -viaInitScreen(__DRIscreenPrivate *psp) +viaInitScreen(__DRIscreen *psp) { static const __DRIversion ddx_expected = { VIA_DRIDDX_VERSION_MAJOR, VIA_DRIDDX_VERSION_MINOR, @@ -405,7 +405,7 @@ viaInitScreen(__DRIscreenPrivate *psp) * Get information about previous buffer swaps. */ static int -getSwapInfo( __DRIdrawablePrivate *dPriv, __DRIswapInfo * sInfo ) +getSwapInfo( __DRIdrawable *dPriv, __DRIswapInfo * sInfo ) { struct via_context *vmesa; @@ -443,3 +443,10 @@ const struct __DriverAPIRec driDriverAPI = { .WaitForSBC = NULL, .SwapBuffersMSC = NULL }; + +/* This is the table of extensions that the loader will dlsym() for. */ +PUBLIC const __DRIextension *__driDriverExtensions[] = { + &driCoreExtension.base, + &driLegacyExtension.base, + NULL +}; diff --git a/src/mesa/drivers/dri/unichrome/via_screen.h b/src/mesa/drivers/dri/unichrome/via_screen.h index c3ef722ff0..aa662e01c0 100644 --- a/src/mesa/drivers/dri/unichrome/via_screen.h +++ b/src/mesa/drivers/dri/unichrome/via_screen.h @@ -61,7 +61,7 @@ typedef struct { drmAddress agpLinearStart; GLuint agpBase; - __DRIscreenPrivate *driScrnPriv; + __DRIscreen *driScrnPriv; drmBufMapPtr bufs; unsigned int sareaPrivOffset; /*=* John Sheng [2003.12.9] Tuxracer & VQ *=*/ @@ -77,21 +77,21 @@ typedef struct { extern GLboolean viaCreateContext(const __GLcontextModes *mesaVis, - __DRIcontextPrivate *driContextPriv, + __DRIcontext *driContextPriv, void *sharedContextPrivate); extern void -viaDestroyContext(__DRIcontextPrivate *driContextPriv); +viaDestroyContext(__DRIcontext *driContextPriv); extern GLboolean -viaUnbindContext(__DRIcontextPrivate *driContextPriv); +viaUnbindContext(__DRIcontext *driContextPriv); extern GLboolean -viaMakeCurrent(__DRIcontextPrivate *driContextPriv, - __DRIdrawablePrivate *driDrawPriv, - __DRIdrawablePrivate *driReadPriv); +viaMakeCurrent(__DRIcontext *driContextPriv, + __DRIdrawable *driDrawPriv, + __DRIdrawable *driReadPriv); extern void -viaSwapBuffers(__DRIdrawablePrivate *drawablePrivate); +viaSwapBuffers(__DRIdrawable *drawablePrivate); #endif diff --git a/src/mesa/drivers/dri/unichrome/via_span.c b/src/mesa/drivers/dri/unichrome/via_span.c index e847164cd0..fa3cbf7a79 100644 --- a/src/mesa/drivers/dri/unichrome/via_span.c +++ b/src/mesa/drivers/dri/unichrome/via_span.c @@ -43,7 +43,7 @@ #undef LOCAL_VARS #define LOCAL_VARS \ struct via_renderbuffer *vrb = (struct via_renderbuffer *) rb; \ - __DRIdrawablePrivate *dPriv = vrb->dPriv; \ + __DRIdrawable *dPriv = vrb->dPriv; \ GLuint pitch = vrb->pitch; \ GLuint height = dPriv->h; \ GLint p = 0; \ @@ -80,7 +80,7 @@ */ #define LOCAL_DEPTH_VARS \ struct via_renderbuffer *vrb = (struct via_renderbuffer *) rb; \ - __DRIdrawablePrivate *dPriv = vrb->dPriv; \ + __DRIdrawable *dPriv = vrb->dPriv; \ GLuint depth_pitch = vrb->pitch; \ GLuint height = dPriv->h; \ char *buf = (char *)(vrb->map) diff --git a/src/mesa/drivers/dri/unichrome/via_state.c b/src/mesa/drivers/dri/unichrome/via_state.c index a9db6c45f7..e6e5526d34 100644 --- a/src/mesa/drivers/dri/unichrome/via_state.c +++ b/src/mesa/drivers/dri/unichrome/via_state.c @@ -476,7 +476,7 @@ void viaEmitState(struct via_context *vmesa) */ if (ctx->Polygon.StippleFlag) { GLuint *stipple = &ctx->PolygonStipple[0]; - __DRIdrawablePrivate *dPriv = vmesa->driDrawable; + __DRIdrawable *dPriv = vmesa->driDrawable; struct via_renderbuffer *const vrb = (struct via_renderbuffer *) dPriv->driverPrivate; GLint i; @@ -722,7 +722,7 @@ static void viaColorMask(GLcontext *ctx, void viaCalcViewport(GLcontext *ctx) { struct via_context *vmesa = VIA_CONTEXT(ctx); - __DRIdrawablePrivate *dPriv = vmesa->driDrawable; + __DRIdrawable *dPriv = vmesa->driDrawable; struct via_renderbuffer *const vrb = (struct via_renderbuffer *) dPriv->driverPrivate; const GLfloat *v = ctx->Viewport._WindowMap.m; @@ -891,10 +891,10 @@ static GLboolean viaChooseTextureState(GLcontext *ctx) if (texObj->Image[0][texObj->BaseLevel]->Border > 0) { vmesa->regHTXnTB[0] |= (HC_HTXnTB_TBC_S | HC_HTXnTB_TBC_T); vmesa->regHTXnTBC[0] = - PACK_COLOR_888(FLOAT_TO_UBYTE(texObj->BorderColor[0]), - FLOAT_TO_UBYTE(texObj->BorderColor[1]), - FLOAT_TO_UBYTE(texObj->BorderColor[2])); - vmesa->regHTXnTRAH[0] = FLOAT_TO_UBYTE(texObj->BorderColor[3]); + PACK_COLOR_888(FLOAT_TO_UBYTE(texObj->BorderColor.f[0]), + FLOAT_TO_UBYTE(texObj->BorderColor.f[1]), + FLOAT_TO_UBYTE(texObj->BorderColor.f[2])); + vmesa->regHTXnTRAH[0] = FLOAT_TO_UBYTE(texObj->BorderColor.f[3]); } if (texUnit0->LodBias != 0.0f) { @@ -924,10 +924,10 @@ static GLboolean viaChooseTextureState(GLcontext *ctx) if (texObj->Image[0][texObj->BaseLevel]->Border > 0) { vmesa->regHTXnTB[1] |= (HC_HTXnTB_TBC_S | HC_HTXnTB_TBC_T); vmesa->regHTXnTBC[1] = - PACK_COLOR_888(FLOAT_TO_UBYTE(texObj->BorderColor[0]), - FLOAT_TO_UBYTE(texObj->BorderColor[1]), - FLOAT_TO_UBYTE(texObj->BorderColor[2])); - vmesa->regHTXnTRAH[1] = FLOAT_TO_UBYTE(texObj->BorderColor[3]); + PACK_COLOR_888(FLOAT_TO_UBYTE(texObj->BorderColor.f[0]), + FLOAT_TO_UBYTE(texObj->BorderColor.f[1]), + FLOAT_TO_UBYTE(texObj->BorderColor.f[2])); + vmesa->regHTXnTRAH[1] = FLOAT_TO_UBYTE(texObj->BorderColor.f[3]); } diff --git a/src/mesa/glapi/ARB_sync.xml b/src/mesa/glapi/ARB_sync.xml index 37f474980c..4e4eebac32 100644 --- a/src/mesa/glapi/ARB_sync.xml +++ b/src/mesa/glapi/ARB_sync.xml @@ -33,8 +33,10 @@ <enum name="WAIT_FAILED" value="0x911D"/> <enum name="SYNC_FLUSH_COMMANDS_BIT" value="0x00000001"/> - <enum name="TIMEOUT_IGNORED" value="0xFFFFFFFFFFFFFFFF"/> + <!-- Not really an enum: + <enum name="TIMEOUT_IGNORED" value="0xFFFFFFFFFFFFFFFF"/> + --> <function name="FenceSync" offset="assign"> diff --git a/src/mesa/main/attrib.c b/src/mesa/main/attrib.c index f5b77e82a9..0641b98b3b 100644 --- a/src/mesa/main/attrib.c +++ b/src/mesa/main/attrib.c @@ -835,7 +835,7 @@ pop_texture_group(GLcontext *ctx, struct texture_state *texstate) _mesa_BindTexture(target, obj->Name); - _mesa_TexParameterfv(target, GL_TEXTURE_BORDER_COLOR, obj->BorderColor); + _mesa_TexParameterfv(target, GL_TEXTURE_BORDER_COLOR, obj->BorderColor.f); _mesa_TexParameterf(target, GL_TEXTURE_PRIORITY, obj->Priority); _mesa_TexParameteri(target, GL_TEXTURE_WRAP_S, obj->WrapS); _mesa_TexParameteri(target, GL_TEXTURE_WRAP_T, obj->WrapT); @@ -1077,22 +1077,39 @@ _mesa_PopAttrib(void) _math_matrix_analyse( ctx->ModelviewMatrixStack.Top ); for (i = 0; i < ctx->Const.MaxLights; i++) { - const struct gl_light *l = &light->Light[i]; + const struct gl_light *l = &light->Light[i]; _mesa_set_enable(ctx, GL_LIGHT0 + i, l->Enabled); - _mesa_light(ctx, i, GL_AMBIENT, l->Ambient); - _mesa_light(ctx, i, GL_DIFFUSE, l->Diffuse); - _mesa_light(ctx, i, GL_SPECULAR, l->Specular ); - _mesa_light(ctx, i, GL_POSITION, l->EyePosition); - _mesa_light(ctx, i, GL_SPOT_DIRECTION, l->SpotDirection); - _mesa_light(ctx, i, GL_SPOT_EXPONENT, &l->SpotExponent); - _mesa_light(ctx, i, GL_SPOT_CUTOFF, &l->SpotCutoff); - _mesa_light(ctx, i, GL_CONSTANT_ATTENUATION, - &l->ConstantAttenuation); - _mesa_light(ctx, i, GL_LINEAR_ATTENUATION, - &l->LinearAttenuation); - _mesa_light(ctx, i, GL_QUADRATIC_ATTENUATION, - &l->QuadraticAttenuation); - } + _mesa_light(ctx, i, GL_AMBIENT, l->Ambient); + _mesa_light(ctx, i, GL_DIFFUSE, l->Diffuse); + _mesa_light(ctx, i, GL_SPECULAR, l->Specular ); + _mesa_light(ctx, i, GL_POSITION, l->EyePosition); + _mesa_light(ctx, i, GL_SPOT_DIRECTION, l->SpotDirection); + { + GLfloat p[4] = { 0 }; + p[0] = l->SpotExponent; + _mesa_light(ctx, i, GL_SPOT_EXPONENT, p); + } + { + GLfloat p[4] = { 0 }; + p[0] = l->SpotCutoff; + _mesa_light(ctx, i, GL_SPOT_CUTOFF, p); + } + { + GLfloat p[4] = { 0 }; + p[0] = l->ConstantAttenuation; + _mesa_light(ctx, i, GL_CONSTANT_ATTENUATION, p); + } + { + GLfloat p[4] = { 0 }; + p[0] = l->LinearAttenuation; + _mesa_light(ctx, i, GL_LINEAR_ATTENUATION, p); + } + { + GLfloat p[4] = { 0 }; + p[0] = l->QuadraticAttenuation; + _mesa_light(ctx, i, GL_QUADRATIC_ATTENUATION, p); + } + } /* light model */ _mesa_LightModelfv(GL_LIGHT_MODEL_AMBIENT, light->Model.Ambient); diff --git a/src/mesa/main/context.c b/src/mesa/main/context.c index 5c20ce017f..320c59068c 100644 --- a/src/mesa/main/context.c +++ b/src/mesa/main/context.c @@ -1015,6 +1015,9 @@ _mesa_free_context_data( GLcontext *ctx ) if (ctx->Extensions.String) _mesa_free((void *) ctx->Extensions.String); + if (ctx->VersionString) + _mesa_free(ctx->VersionString); + /* unbind the context if it's currently bound */ if (ctx == _mesa_get_current_context()) { _mesa_make_current(NULL, NULL, NULL); @@ -1374,6 +1377,8 @@ _mesa_make_current( GLcontext *newCtx, GLframebuffer *drawBuffer, } if (newCtx->FirstTimeCurrent) { + _mesa_compute_version(newCtx); + check_context_limits(newCtx); /* We can use this to help debug user's problems. Tell them to set diff --git a/src/mesa/main/dispatch.c b/src/mesa/main/dispatch.c index 97d213e8e1..eb0d1ff8a7 100644 --- a/src/mesa/main/dispatch.c +++ b/src/mesa/main/dispatch.c @@ -37,8 +37,6 @@ * \author Brian Paul <brian@precisioninsight.com> */ -#ifndef GLX_USE_APPLEGL - #include "main/glheader.h" #include "main/compiler.h" #include "glapi/glapi.h" @@ -92,5 +90,3 @@ #include "glapi/glapitemp.h" #endif /* USE_X86_ASM */ - -#endif /* !GLX_USE_APPLEGL */ diff --git a/src/mesa/main/enums.c b/src/mesa/main/enums.c index 73d6e6af3e..2273138d23 100644 --- a/src/mesa/main/enums.c +++ b/src/mesa/main/enums.c @@ -1791,7 +1791,6 @@ LONGSTRING static const char enum_string_table[] = "GL_TEXTURE_WRAP_S\0" "GL_TEXTURE_WRAP_T\0" "GL_TIMEOUT_EXPIRED\0" - "GL_TIMEOUT_IGNORED\0" "GL_TIME_ELAPSED_EXT\0" "GL_TRACK_MATRIX_NV\0" "GL_TRACK_MATRIX_TRANSFORM_NV\0" @@ -1923,7 +1922,7 @@ LONGSTRING static const char enum_string_table[] = "GL_ZOOM_Y\0" ; -static const enum_elt all_enums[1885] = +static const enum_elt all_enums[1884] = { { 0, 0x00000600 }, /* GL_2D */ { 6, 0x00001407 }, /* GL_2_BYTES */ @@ -3680,147 +3679,146 @@ static const enum_elt all_enums[1885] = { 37780, 0x00002802 }, /* GL_TEXTURE_WRAP_S */ { 37798, 0x00002803 }, /* GL_TEXTURE_WRAP_T */ { 37816, 0x0000911B }, /* GL_TIMEOUT_EXPIRED */ - { 37835, 0xFFFFFFFF }, /* GL_TIMEOUT_IGNORED */ - { 37854, 0x000088BF }, /* GL_TIME_ELAPSED_EXT */ - { 37874, 0x00008648 }, /* GL_TRACK_MATRIX_NV */ - { 37893, 0x00008649 }, /* GL_TRACK_MATRIX_TRANSFORM_NV */ - { 37922, 0x00001000 }, /* GL_TRANSFORM_BIT */ - { 37939, 0x000084E6 }, /* GL_TRANSPOSE_COLOR_MATRIX */ - { 37965, 0x000084E6 }, /* GL_TRANSPOSE_COLOR_MATRIX_ARB */ - { 37995, 0x000088B7 }, /* GL_TRANSPOSE_CURRENT_MATRIX_ARB */ - { 38027, 0x000084E3 }, /* GL_TRANSPOSE_MODELVIEW_MATRIX */ - { 38057, 0x000084E3 }, /* GL_TRANSPOSE_MODELVIEW_MATRIX_ARB */ - { 38091, 0x0000862C }, /* GL_TRANSPOSE_NV */ - { 38107, 0x000084E4 }, /* GL_TRANSPOSE_PROJECTION_MATRIX */ - { 38138, 0x000084E4 }, /* GL_TRANSPOSE_PROJECTION_MATRIX_ARB */ - { 38173, 0x000084E5 }, /* GL_TRANSPOSE_TEXTURE_MATRIX */ - { 38201, 0x000084E5 }, /* GL_TRANSPOSE_TEXTURE_MATRIX_ARB */ - { 38233, 0x00000004 }, /* GL_TRIANGLES */ - { 38246, 0x00000006 }, /* GL_TRIANGLE_FAN */ - { 38262, 0x00008615 }, /* GL_TRIANGLE_MESH_SUN */ - { 38283, 0x00000005 }, /* GL_TRIANGLE_STRIP */ - { 38301, 0x00000001 }, /* GL_TRUE */ - { 38309, 0x00000CF5 }, /* GL_UNPACK_ALIGNMENT */ - { 38329, 0x0000806E }, /* GL_UNPACK_IMAGE_HEIGHT */ - { 38352, 0x00000CF1 }, /* GL_UNPACK_LSB_FIRST */ - { 38372, 0x00000CF2 }, /* GL_UNPACK_ROW_LENGTH */ - { 38393, 0x0000806D }, /* GL_UNPACK_SKIP_IMAGES */ - { 38415, 0x00000CF4 }, /* GL_UNPACK_SKIP_PIXELS */ - { 38437, 0x00000CF3 }, /* GL_UNPACK_SKIP_ROWS */ - { 38457, 0x00000CF0 }, /* GL_UNPACK_SWAP_BYTES */ - { 38478, 0x00009118 }, /* GL_UNSIGNALED */ - { 38492, 0x00001401 }, /* GL_UNSIGNED_BYTE */ - { 38509, 0x00008362 }, /* GL_UNSIGNED_BYTE_2_3_3_REV */ - { 38536, 0x00008032 }, /* GL_UNSIGNED_BYTE_3_3_2 */ - { 38559, 0x00001405 }, /* GL_UNSIGNED_INT */ - { 38575, 0x00008036 }, /* GL_UNSIGNED_INT_10_10_10_2 */ - { 38602, 0x000084FA }, /* GL_UNSIGNED_INT_24_8 */ - { 38623, 0x000084FA }, /* GL_UNSIGNED_INT_24_8_EXT */ - { 38648, 0x000084FA }, /* GL_UNSIGNED_INT_24_8_NV */ - { 38672, 0x00008368 }, /* GL_UNSIGNED_INT_2_10_10_10_REV */ - { 38703, 0x00008035 }, /* GL_UNSIGNED_INT_8_8_8_8 */ - { 38727, 0x00008367 }, /* GL_UNSIGNED_INT_8_8_8_8_REV */ - { 38755, 0x00008C17 }, /* GL_UNSIGNED_NORMALIZED */ - { 38778, 0x00001403 }, /* GL_UNSIGNED_SHORT */ - { 38796, 0x00008366 }, /* GL_UNSIGNED_SHORT_1_5_5_5_REV */ - { 38826, 0x00008033 }, /* GL_UNSIGNED_SHORT_4_4_4_4 */ - { 38852, 0x00008365 }, /* GL_UNSIGNED_SHORT_4_4_4_4_REV */ - { 38882, 0x00008034 }, /* GL_UNSIGNED_SHORT_5_5_5_1 */ - { 38908, 0x00008363 }, /* GL_UNSIGNED_SHORT_5_6_5 */ - { 38932, 0x00008364 }, /* GL_UNSIGNED_SHORT_5_6_5_REV */ - { 38960, 0x000085BA }, /* GL_UNSIGNED_SHORT_8_8_APPLE */ - { 38988, 0x000085BA }, /* GL_UNSIGNED_SHORT_8_8_MESA */ - { 39015, 0x000085BB }, /* GL_UNSIGNED_SHORT_8_8_REV_APPLE */ - { 39047, 0x000085BB }, /* GL_UNSIGNED_SHORT_8_8_REV_MESA */ - { 39078, 0x00008CA2 }, /* GL_UPPER_LEFT */ - { 39092, 0x00002A20 }, /* GL_V2F */ - { 39099, 0x00002A21 }, /* GL_V3F */ - { 39106, 0x00008B83 }, /* GL_VALIDATE_STATUS */ - { 39125, 0x00001F00 }, /* GL_VENDOR */ - { 39135, 0x00001F02 }, /* GL_VERSION */ - { 39146, 0x00008074 }, /* GL_VERTEX_ARRAY */ - { 39162, 0x000085B5 }, /* GL_VERTEX_ARRAY_BINDING */ - { 39186, 0x000085B5 }, /* GL_VERTEX_ARRAY_BINDING_APPLE */ - { 39216, 0x00008896 }, /* GL_VERTEX_ARRAY_BUFFER_BINDING */ - { 39247, 0x00008896 }, /* GL_VERTEX_ARRAY_BUFFER_BINDING_ARB */ - { 39282, 0x0000808E }, /* GL_VERTEX_ARRAY_POINTER */ - { 39306, 0x0000807A }, /* GL_VERTEX_ARRAY_SIZE */ - { 39327, 0x0000807C }, /* GL_VERTEX_ARRAY_STRIDE */ - { 39350, 0x0000807B }, /* GL_VERTEX_ARRAY_TYPE */ - { 39371, 0x00008650 }, /* GL_VERTEX_ATTRIB_ARRAY0_NV */ - { 39398, 0x0000865A }, /* GL_VERTEX_ATTRIB_ARRAY10_NV */ - { 39426, 0x0000865B }, /* GL_VERTEX_ATTRIB_ARRAY11_NV */ - { 39454, 0x0000865C }, /* GL_VERTEX_ATTRIB_ARRAY12_NV */ - { 39482, 0x0000865D }, /* GL_VERTEX_ATTRIB_ARRAY13_NV */ - { 39510, 0x0000865E }, /* GL_VERTEX_ATTRIB_ARRAY14_NV */ - { 39538, 0x0000865F }, /* GL_VERTEX_ATTRIB_ARRAY15_NV */ - { 39566, 0x00008651 }, /* GL_VERTEX_ATTRIB_ARRAY1_NV */ - { 39593, 0x00008652 }, /* GL_VERTEX_ATTRIB_ARRAY2_NV */ - { 39620, 0x00008653 }, /* GL_VERTEX_ATTRIB_ARRAY3_NV */ - { 39647, 0x00008654 }, /* GL_VERTEX_ATTRIB_ARRAY4_NV */ - { 39674, 0x00008655 }, /* GL_VERTEX_ATTRIB_ARRAY5_NV */ - { 39701, 0x00008656 }, /* GL_VERTEX_ATTRIB_ARRAY6_NV */ - { 39728, 0x00008657 }, /* GL_VERTEX_ATTRIB_ARRAY7_NV */ - { 39755, 0x00008658 }, /* GL_VERTEX_ATTRIB_ARRAY8_NV */ - { 39782, 0x00008659 }, /* GL_VERTEX_ATTRIB_ARRAY9_NV */ - { 39809, 0x0000889F }, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING */ - { 39847, 0x0000889F }, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB */ - { 39889, 0x00008622 }, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED */ - { 39920, 0x00008622 }, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB */ - { 39955, 0x0000886A }, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED */ - { 39989, 0x0000886A }, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB */ - { 40027, 0x00008645 }, /* GL_VERTEX_ATTRIB_ARRAY_POINTER */ - { 40058, 0x00008645 }, /* GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB */ - { 40093, 0x00008623 }, /* GL_VERTEX_ATTRIB_ARRAY_SIZE */ - { 40121, 0x00008623 }, /* GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB */ - { 40153, 0x00008624 }, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE */ - { 40183, 0x00008624 }, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB */ - { 40217, 0x00008625 }, /* GL_VERTEX_ATTRIB_ARRAY_TYPE */ - { 40245, 0x00008625 }, /* GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB */ - { 40277, 0x000086A7 }, /* GL_VERTEX_BLEND_ARB */ - { 40297, 0x00008620 }, /* GL_VERTEX_PROGRAM_ARB */ - { 40319, 0x0000864A }, /* GL_VERTEX_PROGRAM_BINDING_NV */ - { 40348, 0x00008620 }, /* GL_VERTEX_PROGRAM_NV */ - { 40369, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE */ - { 40398, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE_ARB */ - { 40431, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE_NV */ - { 40463, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE */ - { 40490, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE_ARB */ - { 40521, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE_NV */ - { 40551, 0x00008B31 }, /* GL_VERTEX_SHADER */ - { 40568, 0x00008B31 }, /* GL_VERTEX_SHADER_ARB */ - { 40589, 0x00008621 }, /* GL_VERTEX_STATE_PROGRAM_NV */ - { 40616, 0x00000BA2 }, /* GL_VIEWPORT */ - { 40628, 0x00000800 }, /* GL_VIEWPORT_BIT */ - { 40644, 0x0000911D }, /* GL_WAIT_FAILED */ - { 40659, 0x000086AD }, /* GL_WEIGHT_ARRAY_ARB */ - { 40679, 0x0000889E }, /* GL_WEIGHT_ARRAY_BUFFER_BINDING */ - { 40710, 0x0000889E }, /* GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB */ - { 40745, 0x000086AC }, /* GL_WEIGHT_ARRAY_POINTER_ARB */ - { 40773, 0x000086AB }, /* GL_WEIGHT_ARRAY_SIZE_ARB */ - { 40798, 0x000086AA }, /* GL_WEIGHT_ARRAY_STRIDE_ARB */ - { 40825, 0x000086A9 }, /* GL_WEIGHT_ARRAY_TYPE_ARB */ - { 40850, 0x000086A6 }, /* GL_WEIGHT_SUM_UNITY_ARB */ - { 40874, 0x000081D4 }, /* GL_WRAP_BORDER_SUN */ - { 40893, 0x000088B9 }, /* GL_WRITE_ONLY */ - { 40907, 0x000088B9 }, /* GL_WRITE_ONLY_ARB */ - { 40925, 0x00001506 }, /* GL_XOR */ - { 40932, 0x000085B9 }, /* GL_YCBCR_422_APPLE */ - { 40951, 0x00008757 }, /* GL_YCBCR_MESA */ - { 40965, 0x00000000 }, /* GL_ZERO */ - { 40973, 0x00000D16 }, /* GL_ZOOM_X */ - { 40983, 0x00000D17 }, /* GL_ZOOM_Y */ + { 37835, 0x000088BF }, /* GL_TIME_ELAPSED_EXT */ + { 37855, 0x00008648 }, /* GL_TRACK_MATRIX_NV */ + { 37874, 0x00008649 }, /* GL_TRACK_MATRIX_TRANSFORM_NV */ + { 37903, 0x00001000 }, /* GL_TRANSFORM_BIT */ + { 37920, 0x000084E6 }, /* GL_TRANSPOSE_COLOR_MATRIX */ + { 37946, 0x000084E6 }, /* GL_TRANSPOSE_COLOR_MATRIX_ARB */ + { 37976, 0x000088B7 }, /* GL_TRANSPOSE_CURRENT_MATRIX_ARB */ + { 38008, 0x000084E3 }, /* GL_TRANSPOSE_MODELVIEW_MATRIX */ + { 38038, 0x000084E3 }, /* GL_TRANSPOSE_MODELVIEW_MATRIX_ARB */ + { 38072, 0x0000862C }, /* GL_TRANSPOSE_NV */ + { 38088, 0x000084E4 }, /* GL_TRANSPOSE_PROJECTION_MATRIX */ + { 38119, 0x000084E4 }, /* GL_TRANSPOSE_PROJECTION_MATRIX_ARB */ + { 38154, 0x000084E5 }, /* GL_TRANSPOSE_TEXTURE_MATRIX */ + { 38182, 0x000084E5 }, /* GL_TRANSPOSE_TEXTURE_MATRIX_ARB */ + { 38214, 0x00000004 }, /* GL_TRIANGLES */ + { 38227, 0x00000006 }, /* GL_TRIANGLE_FAN */ + { 38243, 0x00008615 }, /* GL_TRIANGLE_MESH_SUN */ + { 38264, 0x00000005 }, /* GL_TRIANGLE_STRIP */ + { 38282, 0x00000001 }, /* GL_TRUE */ + { 38290, 0x00000CF5 }, /* GL_UNPACK_ALIGNMENT */ + { 38310, 0x0000806E }, /* GL_UNPACK_IMAGE_HEIGHT */ + { 38333, 0x00000CF1 }, /* GL_UNPACK_LSB_FIRST */ + { 38353, 0x00000CF2 }, /* GL_UNPACK_ROW_LENGTH */ + { 38374, 0x0000806D }, /* GL_UNPACK_SKIP_IMAGES */ + { 38396, 0x00000CF4 }, /* GL_UNPACK_SKIP_PIXELS */ + { 38418, 0x00000CF3 }, /* GL_UNPACK_SKIP_ROWS */ + { 38438, 0x00000CF0 }, /* GL_UNPACK_SWAP_BYTES */ + { 38459, 0x00009118 }, /* GL_UNSIGNALED */ + { 38473, 0x00001401 }, /* GL_UNSIGNED_BYTE */ + { 38490, 0x00008362 }, /* GL_UNSIGNED_BYTE_2_3_3_REV */ + { 38517, 0x00008032 }, /* GL_UNSIGNED_BYTE_3_3_2 */ + { 38540, 0x00001405 }, /* GL_UNSIGNED_INT */ + { 38556, 0x00008036 }, /* GL_UNSIGNED_INT_10_10_10_2 */ + { 38583, 0x000084FA }, /* GL_UNSIGNED_INT_24_8 */ + { 38604, 0x000084FA }, /* GL_UNSIGNED_INT_24_8_EXT */ + { 38629, 0x000084FA }, /* GL_UNSIGNED_INT_24_8_NV */ + { 38653, 0x00008368 }, /* GL_UNSIGNED_INT_2_10_10_10_REV */ + { 38684, 0x00008035 }, /* GL_UNSIGNED_INT_8_8_8_8 */ + { 38708, 0x00008367 }, /* GL_UNSIGNED_INT_8_8_8_8_REV */ + { 38736, 0x00008C17 }, /* GL_UNSIGNED_NORMALIZED */ + { 38759, 0x00001403 }, /* GL_UNSIGNED_SHORT */ + { 38777, 0x00008366 }, /* GL_UNSIGNED_SHORT_1_5_5_5_REV */ + { 38807, 0x00008033 }, /* GL_UNSIGNED_SHORT_4_4_4_4 */ + { 38833, 0x00008365 }, /* GL_UNSIGNED_SHORT_4_4_4_4_REV */ + { 38863, 0x00008034 }, /* GL_UNSIGNED_SHORT_5_5_5_1 */ + { 38889, 0x00008363 }, /* GL_UNSIGNED_SHORT_5_6_5 */ + { 38913, 0x00008364 }, /* GL_UNSIGNED_SHORT_5_6_5_REV */ + { 38941, 0x000085BA }, /* GL_UNSIGNED_SHORT_8_8_APPLE */ + { 38969, 0x000085BA }, /* GL_UNSIGNED_SHORT_8_8_MESA */ + { 38996, 0x000085BB }, /* GL_UNSIGNED_SHORT_8_8_REV_APPLE */ + { 39028, 0x000085BB }, /* GL_UNSIGNED_SHORT_8_8_REV_MESA */ + { 39059, 0x00008CA2 }, /* GL_UPPER_LEFT */ + { 39073, 0x00002A20 }, /* GL_V2F */ + { 39080, 0x00002A21 }, /* GL_V3F */ + { 39087, 0x00008B83 }, /* GL_VALIDATE_STATUS */ + { 39106, 0x00001F00 }, /* GL_VENDOR */ + { 39116, 0x00001F02 }, /* GL_VERSION */ + { 39127, 0x00008074 }, /* GL_VERTEX_ARRAY */ + { 39143, 0x000085B5 }, /* GL_VERTEX_ARRAY_BINDING */ + { 39167, 0x000085B5 }, /* GL_VERTEX_ARRAY_BINDING_APPLE */ + { 39197, 0x00008896 }, /* GL_VERTEX_ARRAY_BUFFER_BINDING */ + { 39228, 0x00008896 }, /* GL_VERTEX_ARRAY_BUFFER_BINDING_ARB */ + { 39263, 0x0000808E }, /* GL_VERTEX_ARRAY_POINTER */ + { 39287, 0x0000807A }, /* GL_VERTEX_ARRAY_SIZE */ + { 39308, 0x0000807C }, /* GL_VERTEX_ARRAY_STRIDE */ + { 39331, 0x0000807B }, /* GL_VERTEX_ARRAY_TYPE */ + { 39352, 0x00008650 }, /* GL_VERTEX_ATTRIB_ARRAY0_NV */ + { 39379, 0x0000865A }, /* GL_VERTEX_ATTRIB_ARRAY10_NV */ + { 39407, 0x0000865B }, /* GL_VERTEX_ATTRIB_ARRAY11_NV */ + { 39435, 0x0000865C }, /* GL_VERTEX_ATTRIB_ARRAY12_NV */ + { 39463, 0x0000865D }, /* GL_VERTEX_ATTRIB_ARRAY13_NV */ + { 39491, 0x0000865E }, /* GL_VERTEX_ATTRIB_ARRAY14_NV */ + { 39519, 0x0000865F }, /* GL_VERTEX_ATTRIB_ARRAY15_NV */ + { 39547, 0x00008651 }, /* GL_VERTEX_ATTRIB_ARRAY1_NV */ + { 39574, 0x00008652 }, /* GL_VERTEX_ATTRIB_ARRAY2_NV */ + { 39601, 0x00008653 }, /* GL_VERTEX_ATTRIB_ARRAY3_NV */ + { 39628, 0x00008654 }, /* GL_VERTEX_ATTRIB_ARRAY4_NV */ + { 39655, 0x00008655 }, /* GL_VERTEX_ATTRIB_ARRAY5_NV */ + { 39682, 0x00008656 }, /* GL_VERTEX_ATTRIB_ARRAY6_NV */ + { 39709, 0x00008657 }, /* GL_VERTEX_ATTRIB_ARRAY7_NV */ + { 39736, 0x00008658 }, /* GL_VERTEX_ATTRIB_ARRAY8_NV */ + { 39763, 0x00008659 }, /* GL_VERTEX_ATTRIB_ARRAY9_NV */ + { 39790, 0x0000889F }, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING */ + { 39828, 0x0000889F }, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB */ + { 39870, 0x00008622 }, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED */ + { 39901, 0x00008622 }, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB */ + { 39936, 0x0000886A }, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED */ + { 39970, 0x0000886A }, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB */ + { 40008, 0x00008645 }, /* GL_VERTEX_ATTRIB_ARRAY_POINTER */ + { 40039, 0x00008645 }, /* GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB */ + { 40074, 0x00008623 }, /* GL_VERTEX_ATTRIB_ARRAY_SIZE */ + { 40102, 0x00008623 }, /* GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB */ + { 40134, 0x00008624 }, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE */ + { 40164, 0x00008624 }, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB */ + { 40198, 0x00008625 }, /* GL_VERTEX_ATTRIB_ARRAY_TYPE */ + { 40226, 0x00008625 }, /* GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB */ + { 40258, 0x000086A7 }, /* GL_VERTEX_BLEND_ARB */ + { 40278, 0x00008620 }, /* GL_VERTEX_PROGRAM_ARB */ + { 40300, 0x0000864A }, /* GL_VERTEX_PROGRAM_BINDING_NV */ + { 40329, 0x00008620 }, /* GL_VERTEX_PROGRAM_NV */ + { 40350, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE */ + { 40379, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE_ARB */ + { 40412, 0x00008642 }, /* GL_VERTEX_PROGRAM_POINT_SIZE_NV */ + { 40444, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE */ + { 40471, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE_ARB */ + { 40502, 0x00008643 }, /* GL_VERTEX_PROGRAM_TWO_SIDE_NV */ + { 40532, 0x00008B31 }, /* GL_VERTEX_SHADER */ + { 40549, 0x00008B31 }, /* GL_VERTEX_SHADER_ARB */ + { 40570, 0x00008621 }, /* GL_VERTEX_STATE_PROGRAM_NV */ + { 40597, 0x00000BA2 }, /* GL_VIEWPORT */ + { 40609, 0x00000800 }, /* GL_VIEWPORT_BIT */ + { 40625, 0x0000911D }, /* GL_WAIT_FAILED */ + { 40640, 0x000086AD }, /* GL_WEIGHT_ARRAY_ARB */ + { 40660, 0x0000889E }, /* GL_WEIGHT_ARRAY_BUFFER_BINDING */ + { 40691, 0x0000889E }, /* GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB */ + { 40726, 0x000086AC }, /* GL_WEIGHT_ARRAY_POINTER_ARB */ + { 40754, 0x000086AB }, /* GL_WEIGHT_ARRAY_SIZE_ARB */ + { 40779, 0x000086AA }, /* GL_WEIGHT_ARRAY_STRIDE_ARB */ + { 40806, 0x000086A9 }, /* GL_WEIGHT_ARRAY_TYPE_ARB */ + { 40831, 0x000086A6 }, /* GL_WEIGHT_SUM_UNITY_ARB */ + { 40855, 0x000081D4 }, /* GL_WRAP_BORDER_SUN */ + { 40874, 0x000088B9 }, /* GL_WRITE_ONLY */ + { 40888, 0x000088B9 }, /* GL_WRITE_ONLY_ARB */ + { 40906, 0x00001506 }, /* GL_XOR */ + { 40913, 0x000085B9 }, /* GL_YCBCR_422_APPLE */ + { 40932, 0x00008757 }, /* GL_YCBCR_MESA */ + { 40946, 0x00000000 }, /* GL_ZERO */ + { 40954, 0x00000D16 }, /* GL_ZOOM_X */ + { 40964, 0x00000D17 }, /* GL_ZOOM_Y */ }; -static const unsigned reduced_enums[1351] = +static const unsigned reduced_enums[1350] = { 479, /* GL_FALSE */ 701, /* GL_LINES */ 703, /* GL_LINE_LOOP */ 710, /* GL_LINE_STRIP */ - 1770, /* GL_TRIANGLES */ - 1773, /* GL_TRIANGLE_STRIP */ - 1771, /* GL_TRIANGLE_FAN */ + 1769, /* GL_TRIANGLES */ + 1772, /* GL_TRIANGLE_STRIP */ + 1770, /* GL_TRIANGLE_FAN */ 1285, /* GL_QUADS */ 1289, /* GL_QUAD_STRIP */ 1171, /* GL_POLYGON */ @@ -3954,7 +3952,7 @@ static const unsigned reduced_enums[1351] = 1537, /* GL_STENCIL_WRITEMASK */ 853, /* GL_MATRIX_MODE */ 1025, /* GL_NORMALIZE */ - 1865, /* GL_VIEWPORT */ + 1864, /* GL_VIEWPORT */ 999, /* GL_MODELVIEW_STACK_DEPTH */ 1263, /* GL_PROJECTION_STACK_DEPTH */ 1744, /* GL_TEXTURE_STACK_DEPTH */ @@ -4016,12 +4014,12 @@ static const unsigned reduced_enums[1351] = 1117, /* GL_PIXEL_MAP_G_TO_G_SIZE */ 1115, /* GL_PIXEL_MAP_B_TO_B_SIZE */ 1113, /* GL_PIXEL_MAP_A_TO_A_SIZE */ - 1782, /* GL_UNPACK_SWAP_BYTES */ - 1777, /* GL_UNPACK_LSB_FIRST */ - 1778, /* GL_UNPACK_ROW_LENGTH */ - 1781, /* GL_UNPACK_SKIP_ROWS */ - 1780, /* GL_UNPACK_SKIP_PIXELS */ - 1775, /* GL_UNPACK_ALIGNMENT */ + 1781, /* GL_UNPACK_SWAP_BYTES */ + 1776, /* GL_UNPACK_LSB_FIRST */ + 1777, /* GL_UNPACK_ROW_LENGTH */ + 1780, /* GL_UNPACK_SKIP_ROWS */ + 1779, /* GL_UNPACK_SKIP_PIXELS */ + 1774, /* GL_UNPACK_ALIGNMENT */ 1099, /* GL_PACK_SWAP_BYTES */ 1094, /* GL_PACK_LSB_FIRST */ 1095, /* GL_PACK_ROW_LENGTH */ @@ -4034,8 +4032,8 @@ static const unsigned reduced_enums[1351] = 641, /* GL_INDEX_OFFSET */ 1317, /* GL_RED_SCALE */ 1315, /* GL_RED_BIAS */ - 1883, /* GL_ZOOM_X */ - 1884, /* GL_ZOOM_Y */ + 1882, /* GL_ZOOM_X */ + 1883, /* GL_ZOOM_Y */ 603, /* GL_GREEN_SCALE */ 601, /* GL_GREEN_BIAS */ 93, /* GL_BLUE_SCALE */ @@ -4120,11 +4118,11 @@ static const unsigned reduced_enums[1351] = 244, /* GL_COMPILE */ 245, /* GL_COMPILE_AND_EXECUTE */ 120, /* GL_BYTE */ - 1784, /* GL_UNSIGNED_BYTE */ + 1783, /* GL_UNSIGNED_BYTE */ 1441, /* GL_SHORT */ - 1796, /* GL_UNSIGNED_SHORT */ + 1795, /* GL_UNSIGNED_SHORT */ 645, /* GL_INT */ - 1787, /* GL_UNSIGNED_INT */ + 1786, /* GL_UNSIGNED_INT */ 489, /* GL_FLOAT */ 1, /* GL_2_BYTES */ 5, /* GL_3_BYTES */ @@ -4136,7 +4134,7 @@ static const unsigned reduced_enums[1351] = 299, /* GL_COPY */ 51, /* GL_AND_INVERTED */ 1023, /* GL_NOOP */ - 1879, /* GL_XOR */ + 1878, /* GL_XOR */ 1086, /* GL_OR */ 1024, /* GL_NOR */ 470, /* GL_EQUIV */ @@ -4180,9 +4178,9 @@ static const unsigned reduced_enums[1351] = 1343, /* GL_REPLACE */ 627, /* GL_INCR */ 342, /* GL_DECR */ - 1811, /* GL_VENDOR */ + 1810, /* GL_VENDOR */ 1340, /* GL_RENDERER */ - 1812, /* GL_VERSION */ + 1811, /* GL_VERSION */ 474, /* GL_EXTENSIONS */ 1391, /* GL_S */ 1557, /* GL_T */ @@ -4215,8 +4213,8 @@ static const unsigned reduced_enums[1351] = 1178, /* GL_POLYGON_OFFSET_POINT */ 1177, /* GL_POLYGON_OFFSET_LINE */ 1301, /* GL_R3_G3_B2 */ - 1808, /* GL_V2F */ - 1809, /* GL_V3F */ + 1807, /* GL_V2F */ + 1808, /* GL_V3F */ 123, /* GL_C4UB_V2F */ 124, /* GL_C4UB_V3F */ 121, /* GL_C3F_V3F */ @@ -4289,11 +4287,11 @@ static const unsigned reduced_enums[1351] = 951, /* GL_MINMAX_FORMAT */ 953, /* GL_MINMAX_SINK */ 1565, /* GL_TABLE_TOO_LARGE_EXT */ - 1786, /* GL_UNSIGNED_BYTE_3_3_2 */ - 1798, /* GL_UNSIGNED_SHORT_4_4_4_4 */ - 1800, /* GL_UNSIGNED_SHORT_5_5_5_1 */ - 1793, /* GL_UNSIGNED_INT_8_8_8_8 */ - 1788, /* GL_UNSIGNED_INT_10_10_10_2 */ + 1785, /* GL_UNSIGNED_BYTE_3_3_2 */ + 1797, /* GL_UNSIGNED_SHORT_4_4_4_4 */ + 1799, /* GL_UNSIGNED_SHORT_5_5_5_1 */ + 1792, /* GL_UNSIGNED_INT_8_8_8_8 */ + 1787, /* GL_UNSIGNED_INT_10_10_10_2 */ 1176, /* GL_POLYGON_OFFSET_FILL */ 1175, /* GL_POLYGON_OFFSET_FACTOR */ 1174, /* GL_POLYGON_OFFSET_BIAS */ @@ -4348,22 +4346,22 @@ static const unsigned reduced_enums[1351] = 1643, /* GL_TEXTURE_BINDING_3D */ 1096, /* GL_PACK_SKIP_IMAGES */ 1092, /* GL_PACK_IMAGE_HEIGHT */ - 1779, /* GL_UNPACK_SKIP_IMAGES */ - 1776, /* GL_UNPACK_IMAGE_HEIGHT */ + 1778, /* GL_UNPACK_SKIP_IMAGES */ + 1775, /* GL_UNPACK_IMAGE_HEIGHT */ 1635, /* GL_TEXTURE_3D */ 1277, /* GL_PROXY_TEXTURE_3D */ 1698, /* GL_TEXTURE_DEPTH */ 1751, /* GL_TEXTURE_WRAP_R */ 856, /* GL_MAX_3D_TEXTURE_SIZE */ - 1813, /* GL_VERTEX_ARRAY */ + 1812, /* GL_VERTEX_ARRAY */ 1026, /* GL_NORMAL_ARRAY */ 148, /* GL_COLOR_ARRAY */ 631, /* GL_INDEX_ARRAY */ 1676, /* GL_TEXTURE_COORD_ARRAY */ 459, /* GL_EDGE_FLAG_ARRAY */ - 1819, /* GL_VERTEX_ARRAY_SIZE */ - 1821, /* GL_VERTEX_ARRAY_TYPE */ - 1820, /* GL_VERTEX_ARRAY_STRIDE */ + 1818, /* GL_VERTEX_ARRAY_SIZE */ + 1820, /* GL_VERTEX_ARRAY_TYPE */ + 1819, /* GL_VERTEX_ARRAY_STRIDE */ 1031, /* GL_NORMAL_ARRAY_TYPE */ 1030, /* GL_NORMAL_ARRAY_STRIDE */ 152, /* GL_COLOR_ARRAY_SIZE */ @@ -4375,7 +4373,7 @@ static const unsigned reduced_enums[1351] = 1682, /* GL_TEXTURE_COORD_ARRAY_TYPE */ 1681, /* GL_TEXTURE_COORD_ARRAY_STRIDE */ 463, /* GL_EDGE_FLAG_ARRAY_STRIDE */ - 1818, /* GL_VERTEX_ARRAY_POINTER */ + 1817, /* GL_VERTEX_ARRAY_POINTER */ 1029, /* GL_NORMAL_ARRAY_POINTER */ 151, /* GL_COLOR_ARRAY_POINTER */ 634, /* GL_INDEX_ARRAY_POINTER */ @@ -4475,7 +4473,7 @@ static const unsigned reduced_enums[1351] = 306, /* GL_CULL_VERTEX_EXT */ 308, /* GL_CULL_VERTEX_OBJECT_POSITION_EXT */ 307, /* GL_CULL_VERTEX_EYE_POSITION_EXT */ - 1876, /* GL_WRAP_BORDER_SUN */ + 1875, /* GL_WRAP_BORDER_SUN */ 1660, /* GL_TEXTURE_COLOR_WRITEMASK_SGIS */ 690, /* GL_LIGHT_MODEL_COLOR_CONTROL */ 1444, /* GL_SINGLE_COLOR */ @@ -4493,13 +4491,13 @@ static const unsigned reduced_enums[1351] = 580, /* GL_FRAMEBUFFER_UNDEFINED */ 373, /* GL_DEPTH_STENCIL_ATTACHMENT */ 630, /* GL_INDEX */ - 1785, /* GL_UNSIGNED_BYTE_2_3_3_REV */ - 1801, /* GL_UNSIGNED_SHORT_5_6_5 */ - 1802, /* GL_UNSIGNED_SHORT_5_6_5_REV */ - 1799, /* GL_UNSIGNED_SHORT_4_4_4_4_REV */ - 1797, /* GL_UNSIGNED_SHORT_1_5_5_5_REV */ - 1794, /* GL_UNSIGNED_INT_8_8_8_8_REV */ - 1792, /* GL_UNSIGNED_INT_2_10_10_10_REV */ + 1784, /* GL_UNSIGNED_BYTE_2_3_3_REV */ + 1800, /* GL_UNSIGNED_SHORT_5_6_5 */ + 1801, /* GL_UNSIGNED_SHORT_5_6_5_REV */ + 1798, /* GL_UNSIGNED_SHORT_4_4_4_4_REV */ + 1796, /* GL_UNSIGNED_SHORT_1_5_5_5_REV */ + 1793, /* GL_UNSIGNED_INT_8_8_8_8_REV */ + 1791, /* GL_UNSIGNED_INT_2_10_10_10_REV */ 1730, /* GL_TEXTURE_MAX_CLAMP_S_SGIX */ 1731, /* GL_TEXTURE_MAX_CLAMP_T_SGIX */ 1729, /* GL_TEXTURE_MAX_CLAMP_R_SGIX */ @@ -4570,10 +4568,10 @@ static const unsigned reduced_enums[1351] = 18, /* GL_ACTIVE_TEXTURE */ 133, /* GL_CLIENT_ACTIVE_TEXTURE */ 934, /* GL_MAX_TEXTURE_UNITS */ - 1763, /* GL_TRANSPOSE_MODELVIEW_MATRIX */ - 1766, /* GL_TRANSPOSE_PROJECTION_MATRIX */ - 1768, /* GL_TRANSPOSE_TEXTURE_MATRIX */ - 1760, /* GL_TRANSPOSE_COLOR_MATRIX */ + 1762, /* GL_TRANSPOSE_MODELVIEW_MATRIX */ + 1765, /* GL_TRANSPOSE_PROJECTION_MATRIX */ + 1767, /* GL_TRANSPOSE_TEXTURE_MATRIX */ + 1759, /* GL_TRANSPOSE_COLOR_MATRIX */ 1549, /* GL_SUBTRACT */ 919, /* GL_MAX_RENDERBUFFER_SIZE */ 247, /* GL_COMPRESSED_ALPHA */ @@ -4588,7 +4586,7 @@ static const unsigned reduced_enums[1351] = 1281, /* GL_PROXY_TEXTURE_RECTANGLE_ARB */ 917, /* GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB */ 372, /* GL_DEPTH_STENCIL */ - 1789, /* GL_UNSIGNED_INT_24_8 */ + 1788, /* GL_UNSIGNED_INT_24_8 */ 930, /* GL_MAX_TEXTURE_LOD_BIAS */ 1728, /* GL_TEXTURE_MAX_ANISOTROPY_EXT */ 931, /* GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT */ @@ -4641,32 +4639,32 @@ static const unsigned reduced_enums[1351] = 1072, /* GL_OPERAND1_ALPHA */ 1078, /* GL_OPERAND2_ALPHA */ 1084, /* GL_OPERAND3_ALPHA_NV */ - 1814, /* GL_VERTEX_ARRAY_BINDING */ + 1813, /* GL_VERTEX_ARRAY_BINDING */ 1737, /* GL_TEXTURE_RANGE_LENGTH_APPLE */ 1738, /* GL_TEXTURE_RANGE_POINTER_APPLE */ - 1880, /* GL_YCBCR_422_APPLE */ - 1803, /* GL_UNSIGNED_SHORT_8_8_APPLE */ - 1805, /* GL_UNSIGNED_SHORT_8_8_REV_APPLE */ + 1879, /* GL_YCBCR_422_APPLE */ + 1802, /* GL_UNSIGNED_SHORT_8_8_APPLE */ + 1804, /* GL_UNSIGNED_SHORT_8_8_REV_APPLE */ 1747, /* GL_TEXTURE_STORAGE_HINT_APPLE */ 1540, /* GL_STORAGE_PRIVATE_APPLE */ 1539, /* GL_STORAGE_CACHED_APPLE */ 1541, /* GL_STORAGE_SHARED_APPLE */ 1446, /* GL_SLICE_ACCUM_SUN */ 1288, /* GL_QUAD_MESH_SUN */ - 1772, /* GL_TRIANGLE_MESH_SUN */ - 1853, /* GL_VERTEX_PROGRAM_ARB */ - 1864, /* GL_VERTEX_STATE_PROGRAM_NV */ - 1840, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED */ - 1846, /* GL_VERTEX_ATTRIB_ARRAY_SIZE */ - 1848, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE */ - 1850, /* GL_VERTEX_ATTRIB_ARRAY_TYPE */ + 1771, /* GL_TRIANGLE_MESH_SUN */ + 1852, /* GL_VERTEX_PROGRAM_ARB */ + 1863, /* GL_VERTEX_STATE_PROGRAM_NV */ + 1839, /* GL_VERTEX_ATTRIB_ARRAY_ENABLED */ + 1845, /* GL_VERTEX_ATTRIB_ARRAY_SIZE */ + 1847, /* GL_VERTEX_ATTRIB_ARRAY_STRIDE */ + 1849, /* GL_VERTEX_ATTRIB_ARRAY_TYPE */ 334, /* GL_CURRENT_VERTEX_ATTRIB */ 1240, /* GL_PROGRAM_LENGTH_ARB */ 1254, /* GL_PROGRAM_STRING_ARB */ 998, /* GL_MODELVIEW_PROJECTION_NV */ 623, /* GL_IDENTITY_NV */ 670, /* GL_INVERSE_NV */ - 1765, /* GL_TRANSPOSE_NV */ + 1764, /* GL_TRANSPOSE_NV */ 671, /* GL_INVERSE_TRANSPOSE_NV */ 903, /* GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB */ 902, /* GL_MAX_PROGRAM_MATRICES_ARB */ @@ -4680,33 +4678,33 @@ static const unsigned reduced_enums[1351] = 845, /* GL_MATRIX7_NV */ 318, /* GL_CURRENT_MATRIX_STACK_DEPTH_ARB */ 315, /* GL_CURRENT_MATRIX_ARB */ - 1856, /* GL_VERTEX_PROGRAM_POINT_SIZE */ - 1859, /* GL_VERTEX_PROGRAM_TWO_SIDE */ + 1855, /* GL_VERTEX_PROGRAM_POINT_SIZE */ + 1858, /* GL_VERTEX_PROGRAM_TWO_SIDE */ 1252, /* GL_PROGRAM_PARAMETER_NV */ - 1844, /* GL_VERTEX_ATTRIB_ARRAY_POINTER */ + 1843, /* GL_VERTEX_ATTRIB_ARRAY_POINTER */ 1256, /* GL_PROGRAM_TARGET_NV */ 1253, /* GL_PROGRAM_RESIDENT_NV */ - 1757, /* GL_TRACK_MATRIX_NV */ - 1758, /* GL_TRACK_MATRIX_TRANSFORM_NV */ - 1854, /* GL_VERTEX_PROGRAM_BINDING_NV */ + 1756, /* GL_TRACK_MATRIX_NV */ + 1757, /* GL_TRACK_MATRIX_TRANSFORM_NV */ + 1853, /* GL_VERTEX_PROGRAM_BINDING_NV */ 1234, /* GL_PROGRAM_ERROR_POSITION_ARB */ 356, /* GL_DEPTH_CLAMP */ - 1822, /* GL_VERTEX_ATTRIB_ARRAY0_NV */ - 1829, /* GL_VERTEX_ATTRIB_ARRAY1_NV */ - 1830, /* GL_VERTEX_ATTRIB_ARRAY2_NV */ - 1831, /* GL_VERTEX_ATTRIB_ARRAY3_NV */ - 1832, /* GL_VERTEX_ATTRIB_ARRAY4_NV */ - 1833, /* GL_VERTEX_ATTRIB_ARRAY5_NV */ - 1834, /* GL_VERTEX_ATTRIB_ARRAY6_NV */ - 1835, /* GL_VERTEX_ATTRIB_ARRAY7_NV */ - 1836, /* GL_VERTEX_ATTRIB_ARRAY8_NV */ - 1837, /* GL_VERTEX_ATTRIB_ARRAY9_NV */ - 1823, /* GL_VERTEX_ATTRIB_ARRAY10_NV */ - 1824, /* GL_VERTEX_ATTRIB_ARRAY11_NV */ - 1825, /* GL_VERTEX_ATTRIB_ARRAY12_NV */ - 1826, /* GL_VERTEX_ATTRIB_ARRAY13_NV */ - 1827, /* GL_VERTEX_ATTRIB_ARRAY14_NV */ - 1828, /* GL_VERTEX_ATTRIB_ARRAY15_NV */ + 1821, /* GL_VERTEX_ATTRIB_ARRAY0_NV */ + 1828, /* GL_VERTEX_ATTRIB_ARRAY1_NV */ + 1829, /* GL_VERTEX_ATTRIB_ARRAY2_NV */ + 1830, /* GL_VERTEX_ATTRIB_ARRAY3_NV */ + 1831, /* GL_VERTEX_ATTRIB_ARRAY4_NV */ + 1832, /* GL_VERTEX_ATTRIB_ARRAY5_NV */ + 1833, /* GL_VERTEX_ATTRIB_ARRAY6_NV */ + 1834, /* GL_VERTEX_ATTRIB_ARRAY7_NV */ + 1835, /* GL_VERTEX_ATTRIB_ARRAY8_NV */ + 1836, /* GL_VERTEX_ATTRIB_ARRAY9_NV */ + 1822, /* GL_VERTEX_ATTRIB_ARRAY10_NV */ + 1823, /* GL_VERTEX_ATTRIB_ARRAY11_NV */ + 1824, /* GL_VERTEX_ATTRIB_ARRAY12_NV */ + 1825, /* GL_VERTEX_ATTRIB_ARRAY13_NV */ + 1826, /* GL_VERTEX_ATTRIB_ARRAY14_NV */ + 1827, /* GL_VERTEX_ATTRIB_ARRAY15_NV */ 757, /* GL_MAP1_VERTEX_ATTRIB0_4_NV */ 764, /* GL_MAP1_VERTEX_ATTRIB1_4_NV */ 765, /* GL_MAP1_VERTEX_ATTRIB2_4_NV */ @@ -4745,14 +4743,14 @@ static const unsigned reduced_enums[1351] = 269, /* GL_COMPRESSED_TEXTURE_FORMATS */ 946, /* GL_MAX_VERTEX_UNITS_ARB */ 22, /* GL_ACTIVE_VERTEX_UNITS_ARB */ - 1875, /* GL_WEIGHT_SUM_UNITY_ARB */ - 1852, /* GL_VERTEX_BLEND_ARB */ + 1874, /* GL_WEIGHT_SUM_UNITY_ARB */ + 1851, /* GL_VERTEX_BLEND_ARB */ 336, /* GL_CURRENT_WEIGHT_ARB */ - 1874, /* GL_WEIGHT_ARRAY_TYPE_ARB */ - 1873, /* GL_WEIGHT_ARRAY_STRIDE_ARB */ - 1872, /* GL_WEIGHT_ARRAY_SIZE_ARB */ - 1871, /* GL_WEIGHT_ARRAY_POINTER_ARB */ - 1868, /* GL_WEIGHT_ARRAY_ARB */ + 1873, /* GL_WEIGHT_ARRAY_TYPE_ARB */ + 1872, /* GL_WEIGHT_ARRAY_STRIDE_ARB */ + 1871, /* GL_WEIGHT_ARRAY_SIZE_ARB */ + 1870, /* GL_WEIGHT_ARRAY_POINTER_ARB */ + 1867, /* GL_WEIGHT_ARRAY_ARB */ 386, /* GL_DOT3_RGB */ 387, /* GL_DOT3_RGBA */ 263, /* GL_COMPRESSED_RGB_FXT1_3DFX */ @@ -4797,7 +4795,7 @@ static const unsigned reduced_enums[1351] = 1001, /* GL_MODULATE_ADD_ATI */ 1002, /* GL_MODULATE_SIGNED_ADD_ATI */ 1003, /* GL_MODULATE_SUBTRACT_ATI */ - 1881, /* GL_YCBCR_MESA */ + 1880, /* GL_YCBCR_MESA */ 1093, /* GL_PACK_INVERT_MESA */ 339, /* GL_DEBUG_OBJECT_MESA */ 340, /* GL_DEBUG_PRINT_MESA */ @@ -4870,7 +4868,7 @@ static const unsigned reduced_enums[1351] = 1295, /* GL_QUERY_RESULT */ 1297, /* GL_QUERY_RESULT_AVAILABLE */ 940, /* GL_MAX_VERTEX_ATTRIBS */ - 1842, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED */ + 1841, /* GL_VERTEX_ATTRIB_ARRAY_NORMALIZED */ 377, /* GL_DEPTH_STENCIL_TO_RGBA_NV */ 376, /* GL_DEPTH_STENCIL_TO_BGRA_NV */ 926, /* GL_MAX_TEXTURE_COORDS */ @@ -4885,7 +4883,7 @@ static const unsigned reduced_enums[1351] = 464, /* GL_ELEMENT_ARRAY_BUFFER */ 54, /* GL_ARRAY_BUFFER_BINDING */ 465, /* GL_ELEMENT_ARRAY_BUFFER_BINDING */ - 1816, /* GL_VERTEX_ARRAY_BUFFER_BINDING */ + 1815, /* GL_VERTEX_ARRAY_BUFFER_BINDING */ 1027, /* GL_NORMAL_ARRAY_BUFFER_BINDING */ 149, /* GL_COLOR_ARRAY_BUFFER_BINDING */ 632, /* GL_INDEX_ARRAY_BUFFER_BINDING */ @@ -4893,8 +4891,8 @@ static const unsigned reduced_enums[1351] = 460, /* GL_EDGE_FLAG_ARRAY_BUFFER_BINDING */ 1420, /* GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING */ 514, /* GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING */ - 1869, /* GL_WEIGHT_ARRAY_BUFFER_BINDING */ - 1838, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING */ + 1868, /* GL_WEIGHT_ARRAY_BUFFER_BINDING */ + 1837, /* GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING */ 1239, /* GL_PROGRAM_INSTRUCTIONS_ARB */ 898, /* GL_MAX_PROGRAM_INSTRUCTIONS_ARB */ 1245, /* GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB */ @@ -4918,14 +4916,14 @@ static const unsigned reduced_enums[1351] = 899, /* GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB */ 895, /* GL_MAX_PROGRAM_ENV_PARAMETERS_ARB */ 1260, /* GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB */ - 1762, /* GL_TRANSPOSE_CURRENT_MATRIX_ARB */ + 1761, /* GL_TRANSPOSE_CURRENT_MATRIX_ARB */ 1308, /* GL_READ_ONLY */ - 1877, /* GL_WRITE_ONLY */ + 1876, /* GL_WRITE_ONLY */ 1310, /* GL_READ_WRITE */ 102, /* GL_BUFFER_ACCESS */ 105, /* GL_BUFFER_MAPPED */ 107, /* GL_BUFFER_MAP_POINTER */ - 1756, /* GL_TIME_ELAPSED_EXT */ + 1755, /* GL_TIME_ELAPSED_EXT */ 808, /* GL_MATRIX0_ARB */ 820, /* GL_MATRIX1_ARB */ 832, /* GL_MATRIX2_ARB */ @@ -4986,7 +4984,7 @@ static const unsigned reduced_enums[1351] = 109, /* GL_BUFFER_SERIALIZED_MODIFY_APPLE */ 104, /* GL_BUFFER_FLUSHING_UNMAP_APPLE */ 537, /* GL_FRAGMENT_SHADER */ - 1862, /* GL_VERTEX_SHADER */ + 1861, /* GL_VERTEX_SHADER */ 1250, /* GL_PROGRAM_OBJECT_ARB */ 1433, /* GL_SHADER_OBJECT_ARB */ 882, /* GL_MAX_FRAGMENT_UNIFORM_COMPONENTS */ @@ -5024,7 +5022,7 @@ static const unsigned reduced_enums[1351] = 345, /* GL_DELETE_STATUS */ 246, /* GL_COMPILE_STATUS */ 715, /* GL_LINK_STATUS */ - 1810, /* GL_VALIDATE_STATUS */ + 1809, /* GL_VALIDATE_STATUS */ 644, /* GL_INFO_LOG_LENGTH */ 56, /* GL_ATTACHED_SHADERS */ 20, /* GL_ACTIVE_UNIFORMS */ @@ -5047,7 +5045,7 @@ static const unsigned reduced_enums[1351] = 1106, /* GL_PALETTE8_RGB5_A1_OES */ 626, /* GL_IMPLEMENTATION_COLOR_READ_TYPE_OES */ 625, /* GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES */ - 1795, /* GL_UNSIGNED_NORMALIZED */ + 1794, /* GL_UNSIGNED_NORMALIZED */ 1632, /* GL_TEXTURE_1D_ARRAY_EXT */ 1272, /* GL_PROXY_TEXTURE_1D_ARRAY_EXT */ 1634, /* GL_TEXTURE_2D_ARRAY_EXT */ @@ -5068,7 +5066,7 @@ static const unsigned reduced_enums[1351] = 266, /* GL_COMPRESSED_SLUMINANCE_ALPHA */ 1167, /* GL_POINT_SPRITE_COORD_ORIGIN */ 723, /* GL_LOWER_LEFT */ - 1807, /* GL_UPPER_LEFT */ + 1806, /* GL_UPPER_LEFT */ 1513, /* GL_STENCIL_BACK_REF */ 1514, /* GL_STENCIL_BACK_VALUE_MASK */ 1515, /* GL_STENCIL_BACK_WRITEMASK */ @@ -5150,12 +5148,12 @@ static const unsigned reduced_enums[1351] = 1553, /* GL_SYNC_FLAGS */ 1552, /* GL_SYNC_FENCE */ 1555, /* GL_SYNC_GPU_COMMANDS_COMPLETE */ - 1783, /* GL_UNSIGNALED */ + 1782, /* GL_UNSIGNALED */ 1442, /* GL_SIGNALED */ 46, /* GL_ALREADY_SIGNALED */ 1754, /* GL_TIMEOUT_EXPIRED */ 270, /* GL_CONDITION_SATISFIED */ - 1867, /* GL_WAIT_FAILED */ + 1866, /* GL_WAIT_FAILED */ 471, /* GL_EVAL_BIT */ 1302, /* GL_RASTER_POSITION_UNCLIPPED_IBM */ 717, /* GL_LIST_BIT */ @@ -5164,7 +5162,6 @@ static const unsigned reduced_enums[1351] = 29, /* GL_ALL_ATTRIB_BITS */ 1008, /* GL_MULTISAMPLE_BIT */ 30, /* GL_ALL_CLIENT_ATTRIB_BITS */ - 1755, /* GL_TIMEOUT_IGNORED */ }; typedef int (*cfunc)(const void *, const void *); diff --git a/src/mesa/main/get.c b/src/mesa/main/get.c index 618b5411cc..22cf75f79d 100644 --- a/src/mesa/main/get.c +++ b/src/mesa/main/get.c @@ -1902,6 +1902,12 @@ _mesa_GetBooleanv( GLenum pname, GLboolean *params ) case GL_NUM_EXTENSIONS: params[0] = INT_TO_BOOLEAN(_mesa_get_extension_count(ctx)); break; + case GL_MAJOR_VERSION: + params[0] = INT_TO_BOOLEAN(ctx->VersionMajor); + break; + case GL_MINOR_VERSION: + params[0] = INT_TO_BOOLEAN(ctx->VersionMinor); + break; default: _mesa_error(ctx, GL_INVALID_ENUM, "glGetBooleanv(pname=0x%x)", pname); } @@ -3740,6 +3746,12 @@ _mesa_GetFloatv( GLenum pname, GLfloat *params ) case GL_NUM_EXTENSIONS: params[0] = (GLfloat)(_mesa_get_extension_count(ctx)); break; + case GL_MAJOR_VERSION: + params[0] = (GLfloat)(ctx->VersionMajor); + break; + case GL_MINOR_VERSION: + params[0] = (GLfloat)(ctx->VersionMinor); + break; default: _mesa_error(ctx, GL_INVALID_ENUM, "glGetFloatv(pname=0x%x)", pname); } @@ -5578,6 +5590,12 @@ _mesa_GetIntegerv( GLenum pname, GLint *params ) case GL_NUM_EXTENSIONS: params[0] = _mesa_get_extension_count(ctx); break; + case GL_MAJOR_VERSION: + params[0] = ctx->VersionMajor; + break; + case GL_MINOR_VERSION: + params[0] = ctx->VersionMinor; + break; default: _mesa_error(ctx, GL_INVALID_ENUM, "glGetIntegerv(pname=0x%x)", pname); } @@ -7417,6 +7435,12 @@ _mesa_GetInteger64v( GLenum pname, GLint64 *params ) case GL_NUM_EXTENSIONS: params[0] = (GLint64)(_mesa_get_extension_count(ctx)); break; + case GL_MAJOR_VERSION: + params[0] = (GLint64)(ctx->VersionMajor); + break; + case GL_MINOR_VERSION: + params[0] = (GLint64)(ctx->VersionMinor); + break; default: _mesa_error(ctx, GL_INVALID_ENUM, "glGetInteger64v(pname=0x%x)", pname); } diff --git a/src/mesa/main/get_gen.py b/src/mesa/main/get_gen.py index 7540661187..b0beb59207 100644 --- a/src/mesa/main/get_gen.py +++ b/src/mesa/main/get_gen.py @@ -1033,6 +1033,8 @@ StateVars = [ # GL3 ( "GL_NUM_EXTENSIONS", GLint, ["_mesa_get_extension_count(ctx)"], "", None ), + ( "GL_MAJOR_VERSION", GLint, ["ctx->VersionMajor"], "", None ), + ( "GL_MINOR_VERSION", GLint, ["ctx->VersionMinor"], "", None ) ] diff --git a/src/mesa/main/getstring.c b/src/mesa/main/getstring.c index cac5eef1cb..e76a790d0a 100644 --- a/src/mesa/main/getstring.c +++ b/src/mesa/main/getstring.c @@ -33,85 +33,6 @@ /** - * Examine enabled GL extensions to determine GL version. - * \return version string - */ -static const char * -compute_version(const GLcontext *ctx) -{ - static const char *version_1_2 = "1.2 Mesa " MESA_VERSION_STRING; - static const char *version_1_3 = "1.3 Mesa " MESA_VERSION_STRING; - static const char *version_1_4 = "1.4 Mesa " MESA_VERSION_STRING; - static const char *version_1_5 = "1.5 Mesa " MESA_VERSION_STRING; - static const char *version_2_0 = "2.0 Mesa " MESA_VERSION_STRING; - static const char *version_2_1 = "2.1 Mesa " MESA_VERSION_STRING; - - const GLboolean ver_1_3 = (ctx->Extensions.ARB_multisample && - ctx->Extensions.ARB_multitexture && - ctx->Extensions.ARB_texture_border_clamp && - ctx->Extensions.ARB_texture_compression && - ctx->Extensions.ARB_texture_cube_map && - ctx->Extensions.EXT_texture_env_add && - ctx->Extensions.ARB_texture_env_combine && - ctx->Extensions.ARB_texture_env_dot3); - const GLboolean ver_1_4 = (ver_1_3 && - ctx->Extensions.ARB_depth_texture && - ctx->Extensions.ARB_shadow && - ctx->Extensions.ARB_texture_env_crossbar && - ctx->Extensions.ARB_texture_mirrored_repeat && - ctx->Extensions.ARB_window_pos && - ctx->Extensions.EXT_blend_color && - ctx->Extensions.EXT_blend_func_separate && - ctx->Extensions.EXT_blend_minmax && - ctx->Extensions.EXT_blend_subtract && - ctx->Extensions.EXT_fog_coord && - ctx->Extensions.EXT_multi_draw_arrays && - ctx->Extensions.EXT_point_parameters && - ctx->Extensions.EXT_secondary_color && - ctx->Extensions.EXT_stencil_wrap && - ctx->Extensions.EXT_texture_lod_bias && - ctx->Extensions.SGIS_generate_mipmap); - const GLboolean ver_1_5 = (ver_1_4 && - ctx->Extensions.ARB_occlusion_query && - ctx->Extensions.ARB_vertex_buffer_object && - ctx->Extensions.EXT_shadow_funcs); - const GLboolean ver_2_0 = (ver_1_5 && - ctx->Extensions.ARB_draw_buffers && - ctx->Extensions.ARB_point_sprite && - ctx->Extensions.ARB_shader_objects && - ctx->Extensions.ARB_vertex_shader && - ctx->Extensions.ARB_fragment_shader && - ctx->Extensions.ARB_texture_non_power_of_two && - ctx->Extensions.EXT_blend_equation_separate && - - /* Technically, 2.0 requires the functionality - * of the EXT version. Enable 2.0 if either - * extension is available, and assume that a - * driver that only exposes the ATI extension - * will fallback to software when necessary. - */ - (ctx->Extensions.EXT_stencil_two_side - || ctx->Extensions.ATI_separate_stencil)); - const GLboolean ver_2_1 = (ver_2_0 && - ctx->Extensions.ARB_shading_language_120 && - ctx->Extensions.EXT_pixel_buffer_object && - ctx->Extensions.EXT_texture_sRGB); - if (ver_2_1) - return version_2_1; - if (ver_2_0) - return version_2_0; - if (ver_1_5) - return version_1_5; - if (ver_1_4) - return version_1_4; - if (ver_1_3) - return version_1_3; - return version_1_2; -} - - - -/** * Query string-valued state. The return value should _not_ be freed by * the caller. * @@ -149,7 +70,7 @@ _mesa_GetString( GLenum name ) case GL_RENDERER: return (const GLubyte *) renderer; case GL_VERSION: - return (const GLubyte *) compute_version(ctx); + return (const GLubyte *) ctx->VersionString; case GL_EXTENSIONS: if (!ctx->Extensions.String) ctx->Extensions.String = _mesa_make_extension_string(ctx); diff --git a/src/mesa/main/image.c b/src/mesa/main/image.c index 139e56a96b..fc278bb8af 100644 --- a/src/mesa/main/image.c +++ b/src/mesa/main/image.c @@ -33,6 +33,7 @@ #include "glheader.h" #include "colormac.h" #include "context.h" +#include "enums.h" #include "image.h" #include "imports.h" #include "macros.h" @@ -3228,6 +3229,7 @@ extract_float_rgba(GLuint n, GLfloat rgba[][4], srcFormat == GL_RGBA || srcFormat == GL_BGRA || srcFormat == GL_ABGR_EXT || + srcFormat == GL_DU8DV8_ATI || srcFormat == GL_DUDV_ATI); ASSERT(srcType == GL_UNSIGNED_BYTE || @@ -3343,6 +3345,7 @@ extract_float_rgba(GLuint n, GLfloat rgba[][4], aComp = 0; stride = 4; break; + case GL_DU8DV8_ATI: case GL_DUDV_ATI: redIndex = 0; greenIndex = 1; @@ -3351,7 +3354,8 @@ extract_float_rgba(GLuint n, GLfloat rgba[][4], stride = 2; break; default: - _mesa_problem(NULL, "bad srcFormat in extract float data"); + _mesa_problem(NULL, "bad srcFormat %s in extract float data", + _mesa_lookup_enum_by_nr(srcFormat)); return; } diff --git a/src/mesa/main/mtypes.h b/src/mesa/main/mtypes.h index a7f70a1875..5227565f87 100644 --- a/src/mesa/main/mtypes.h +++ b/src/mesa/main/mtypes.h @@ -1217,7 +1217,11 @@ struct gl_texture_object GLuint Name; /**< the user-visible texture object ID */ GLenum Target; /**< GL_TEXTURE_1D, GL_TEXTURE_2D, etc. */ GLfloat Priority; /**< in [0,1] */ - GLfloat BorderColor[4]; /**< unclamped */ + union { + GLfloat f[4]; + GLuint ui[4]; + GLint i[4]; + } BorderColor; /**< Interpreted according to texture format */ GLenum WrapS; /**< S-axis texture image wrap mode */ GLenum WrapT; /**< T-axis texture image wrap mode */ GLenum WrapR; /**< R-axis texture image wrap mode */ @@ -2860,6 +2864,10 @@ struct __GLcontextRec /** Extension information */ struct gl_extensions Extensions; + /** Version info */ + GLuint VersionMajor, VersionMinor; + char *VersionString; + /** \name State attribute stack (for glPush/PopAttrib) */ /*@{*/ GLuint AttribStackDepth; diff --git a/src/mesa/main/texobj.c b/src/mesa/main/texobj.c index 09fe7b85ba..7f0a246025 100644 --- a/src/mesa/main/texobj.c +++ b/src/mesa/main/texobj.c @@ -228,10 +228,10 @@ _mesa_copy_texture_object( struct gl_texture_object *dest, dest->Target = src->Target; dest->Name = src->Name; dest->Priority = src->Priority; - dest->BorderColor[0] = src->BorderColor[0]; - dest->BorderColor[1] = src->BorderColor[1]; - dest->BorderColor[2] = src->BorderColor[2]; - dest->BorderColor[3] = src->BorderColor[3]; + dest->BorderColor.f[0] = src->BorderColor.f[0]; + dest->BorderColor.f[1] = src->BorderColor.f[1]; + dest->BorderColor.f[2] = src->BorderColor.f[2]; + dest->BorderColor.f[3] = src->BorderColor.f[3]; dest->WrapS = src->WrapS; dest->WrapT = src->WrapT; dest->WrapR = src->WrapR; diff --git a/src/mesa/main/texparam.c b/src/mesa/main/texparam.c index db4c7a5eda..d917e21e74 100644 --- a/src/mesa/main/texparam.c +++ b/src/mesa/main/texparam.c @@ -78,17 +78,19 @@ validate_texture_wrap_mode(GLcontext * ctx, GLenum target, GLenum wrap) /** * Get current texture object for given target. - * Return NULL if any error. + * Return NULL if any error (and record the error). * Note that this is different from _mesa_select_tex_object() in that proxy * targets are not accepted. + * Only the glGetTexLevelParameter() functions accept proxy targets. */ static struct gl_texture_object * -get_texobj(GLcontext *ctx, GLenum target) +get_texobj(GLcontext *ctx, GLenum target, GLboolean get) { struct gl_texture_unit *texUnit; if (ctx->Texture.CurrentUnit >= ctx->Const.MaxTextureImageUnits) { - _mesa_error(ctx, GL_INVALID_OPERATION, "glTexParameter(current unit)"); + _mesa_error(ctx, GL_INVALID_OPERATION, + "gl%sTexParameter(current unit)", get ? "Get" : ""); return NULL; } @@ -125,7 +127,8 @@ get_texobj(GLcontext *ctx, GLenum target) ; } - _mesa_error(ctx, GL_INVALID_ENUM, "glTexParameter(target)"); + _mesa_error(ctx, GL_INVALID_ENUM, + "gl%sTexParameter(target)", get ? "Get" : ""); return NULL; } @@ -508,10 +511,10 @@ set_tex_parameterf(GLcontext *ctx, case GL_TEXTURE_BORDER_COLOR: flush(ctx, texObj); - texObj->BorderColor[RCOMP] = params[0]; - texObj->BorderColor[GCOMP] = params[1]; - texObj->BorderColor[BCOMP] = params[2]; - texObj->BorderColor[ACOMP] = params[3]; + texObj->BorderColor.f[RCOMP] = params[0]; + texObj->BorderColor.f[GCOMP] = params[1]; + texObj->BorderColor.f[BCOMP] = params[2]; + texObj->BorderColor.f[ACOMP] = params[3]; return GL_TRUE; default: @@ -529,7 +532,7 @@ _mesa_TexParameterf(GLenum target, GLenum pname, GLfloat param) GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - texObj = get_texobj(ctx, target); + texObj = get_texobj(ctx, target, GL_FALSE); if (!texObj) return; @@ -577,7 +580,7 @@ _mesa_TexParameterfv(GLenum target, GLenum pname, const GLfloat *params) GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - texObj = get_texobj(ctx, target); + texObj = get_texobj(ctx, target, GL_FALSE); if (!texObj) return; @@ -635,7 +638,7 @@ _mesa_TexParameteri(GLenum target, GLenum pname, GLint param) GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - texObj = get_texobj(ctx, target); + texObj = get_texobj(ctx, target, GL_FALSE); if (!texObj) return; @@ -679,7 +682,7 @@ _mesa_TexParameteriv(GLenum target, GLenum pname, const GLint *params) GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - texObj = get_texobj(ctx, target); + texObj = get_texobj(ctx, target, GL_FALSE); if (!texObj) return; @@ -728,6 +731,68 @@ _mesa_TexParameteriv(GLenum target, GLenum pname, const GLint *params) } +/** + * Set tex parameter to integer value(s). Primarily intended to set + * integer-valued texture border color (for integer-valued textures). + * New in GL 3.0. + */ +void GLAPIENTRY +_mesa_TexParameterIiv(GLenum target, GLenum pname, const GLint *params) +{ + struct gl_texture_object *texObj; + GET_CURRENT_CONTEXT(ctx); + ASSERT_OUTSIDE_BEGIN_END(ctx); + + texObj = get_texobj(ctx, target, GL_FALSE); + if (!texObj) + return; + + switch (pname) { + case GL_TEXTURE_BORDER_COLOR: + FLUSH_VERTICES(ctx, _NEW_TEXTURE); + /* set the integer-valued border color */ + COPY_4V(texObj->BorderColor.i, params); + break; + default: + _mesa_TexParameteriv(target, pname, params); + break; + } + /* XXX no driver hook for TexParameterIiv() yet */ +} + + +/** + * Set tex parameter to unsigned integer value(s). Primarily intended to set + * uint-valued texture border color (for integer-valued textures). + * New in GL 3.0 + */ +void GLAPIENTRY +_mesa_TexParameterIuiv(GLenum target, GLenum pname, const GLuint *params) +{ + struct gl_texture_object *texObj; + GET_CURRENT_CONTEXT(ctx); + ASSERT_OUTSIDE_BEGIN_END(ctx); + + texObj = get_texobj(ctx, target, GL_FALSE); + if (!texObj) + return; + + switch (pname) { + case GL_TEXTURE_BORDER_COLOR: + FLUSH_VERTICES(ctx, _NEW_TEXTURE); + /* set the unsigned integer-valued border color */ + COPY_4V(texObj->BorderColor.ui, params); + break; + default: + _mesa_TexParameteriv(target, pname, (const GLint *) params); + break; + } + /* XXX no driver hook for TexParameterIuiv() yet */ +} + + + + void GLAPIENTRY _mesa_GetTexLevelParameterfv( GLenum target, GLint level, GLenum pname, GLfloat *params ) @@ -978,25 +1043,14 @@ _mesa_GetTexLevelParameteriv( GLenum target, GLint level, void GLAPIENTRY _mesa_GetTexParameterfv( GLenum target, GLenum pname, GLfloat *params ) { - struct gl_texture_unit *texUnit; struct gl_texture_object *obj; GLboolean error = GL_FALSE; GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - if (ctx->Texture.CurrentUnit >= ctx->Const.MaxTextureImageUnits) { - _mesa_error(ctx, GL_INVALID_OPERATION, - "glGetTexParameterfv(current unit)"); - return; - } - - texUnit = _mesa_get_current_tex_unit(ctx); - - obj = _mesa_select_tex_object(ctx, texUnit, target); - if (!obj) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetTexParameterfv(target)"); + obj = get_texobj(ctx, target, GL_TRUE); + if (!obj) return; - } _mesa_lock_texture(ctx, obj); switch (pname) { @@ -1016,10 +1070,10 @@ _mesa_GetTexParameterfv( GLenum target, GLenum pname, GLfloat *params ) *params = ENUM_TO_FLOAT(obj->WrapR); break; case GL_TEXTURE_BORDER_COLOR: - params[0] = CLAMP(obj->BorderColor[0], 0.0F, 1.0F); - params[1] = CLAMP(obj->BorderColor[1], 0.0F, 1.0F); - params[2] = CLAMP(obj->BorderColor[2], 0.0F, 1.0F); - params[3] = CLAMP(obj->BorderColor[3], 0.0F, 1.0F); + params[0] = CLAMP(obj->BorderColor.f[0], 0.0F, 1.0F); + params[1] = CLAMP(obj->BorderColor.f[1], 0.0F, 1.0F); + params[2] = CLAMP(obj->BorderColor.f[2], 0.0F, 1.0F); + params[3] = CLAMP(obj->BorderColor.f[3], 0.0F, 1.0F); break; case GL_TEXTURE_RESIDENT: { @@ -1145,26 +1199,16 @@ _mesa_GetTexParameterfv( GLenum target, GLenum pname, GLfloat *params ) void GLAPIENTRY _mesa_GetTexParameteriv( GLenum target, GLenum pname, GLint *params ) { - struct gl_texture_unit *texUnit; struct gl_texture_object *obj; GLboolean error = GL_FALSE; GET_CURRENT_CONTEXT(ctx); ASSERT_OUTSIDE_BEGIN_END(ctx); - if (ctx->Texture.CurrentUnit >= ctx->Const.MaxTextureImageUnits) { - _mesa_error(ctx, GL_INVALID_OPERATION, - "glGetTexParameteriv(current unit)"); - return; - } - - texUnit = _mesa_get_current_tex_unit(ctx); - - obj = _mesa_select_tex_object(ctx, texUnit, target); - if (!obj) { - _mesa_error(ctx, GL_INVALID_ENUM, "glGetTexParameteriv(target)"); - return; - } + obj = get_texobj(ctx, target, GL_TRUE); + if (!obj) + return; + _mesa_lock_texture(ctx, obj); switch (pname) { case GL_TEXTURE_MAG_FILTER: *params = (GLint) obj->MagFilter; @@ -1184,10 +1228,10 @@ _mesa_GetTexParameteriv( GLenum target, GLenum pname, GLint *params ) case GL_TEXTURE_BORDER_COLOR: { GLfloat b[4]; - b[0] = CLAMP(obj->BorderColor[0], 0.0F, 1.0F); - b[1] = CLAMP(obj->BorderColor[1], 0.0F, 1.0F); - b[2] = CLAMP(obj->BorderColor[2], 0.0F, 1.0F); - b[3] = CLAMP(obj->BorderColor[3], 0.0F, 1.0F); + b[0] = CLAMP(obj->BorderColor.f[0], 0.0F, 1.0F); + b[1] = CLAMP(obj->BorderColor.f[1], 0.0F, 1.0F); + b[2] = CLAMP(obj->BorderColor.f[2], 0.0F, 1.0F); + b[3] = CLAMP(obj->BorderColor.f[3], 0.0F, 1.0F); params[0] = FLOAT_TO_INT(b[0]); params[1] = FLOAT_TO_INT(b[1]); params[2] = FLOAT_TO_INT(b[2]); @@ -1315,3 +1359,53 @@ _mesa_GetTexParameteriv( GLenum target, GLenum pname, GLint *params ) _mesa_unlock_texture(ctx, obj); } + + +/** New in GL 3.0 */ +void GLAPIENTRY +_mesa_GetTexParameterIiv(GLenum target, GLenum pname, GLint *params) +{ + struct gl_texture_object *texObj; + GET_CURRENT_CONTEXT(ctx); + ASSERT_OUTSIDE_BEGIN_END(ctx); + + texObj = get_texobj(ctx, target, GL_TRUE); + + switch (pname) { + case GL_TEXTURE_BORDER_COLOR: + COPY_4V(params, texObj->BorderColor.i); + break; + default: + _mesa_GetTexParameteriv(target, pname, params); + } +} + + +/** New in GL 3.0 */ +void GLAPIENTRY +_mesa_GetTexParameterIuiv(GLenum target, GLenum pname, GLuint *params) +{ + struct gl_texture_object *texObj; + GET_CURRENT_CONTEXT(ctx); + ASSERT_OUTSIDE_BEGIN_END(ctx); + + texObj = get_texobj(ctx, target, GL_TRUE); + + switch (pname) { + case GL_TEXTURE_BORDER_COLOR: + COPY_4V(params, texObj->BorderColor.i); + break; + default: + { + GLint ip[4]; + _mesa_GetTexParameteriv(target, pname, ip); + params[0] = ip[0]; + if (pname == GL_TEXTURE_SWIZZLE_RGBA_EXT || + pname == GL_TEXTURE_CROP_RECT_OES) { + params[1] = ip[1]; + params[2] = ip[2]; + params[3] = ip[3]; + } + } + } +} diff --git a/src/mesa/main/texparam.h b/src/mesa/main/texparam.h index 454b96350e..19b4116c0b 100644 --- a/src/mesa/main/texparam.h +++ b/src/mesa/main/texparam.h @@ -44,6 +44,11 @@ _mesa_GetTexParameterfv( GLenum target, GLenum pname, GLfloat *params ); extern void GLAPIENTRY _mesa_GetTexParameteriv( GLenum target, GLenum pname, GLint *params ); +extern void GLAPIENTRY +_mesa_GetTexParameterIiv(GLenum target, GLenum pname, GLint *params); + +extern void GLAPIENTRY +_mesa_GetTexParameterIuiv(GLenum target, GLenum pname, GLuint *params); extern void GLAPIENTRY @@ -60,4 +65,11 @@ extern void GLAPIENTRY _mesa_TexParameteriv( GLenum target, GLenum pname, const GLint *params ); +extern void GLAPIENTRY +_mesa_TexParameterIiv(GLenum target, GLenum pname, const GLint *params); + +extern void GLAPIENTRY +_mesa_TexParameterIuiv(GLenum target, GLenum pname, const GLuint *params); + + #endif /* TEXPARAM_H */ diff --git a/src/mesa/main/version.c b/src/mesa/main/version.c new file mode 100644 index 0000000000..9d23c577bd --- /dev/null +++ b/src/mesa/main/version.c @@ -0,0 +1,130 @@ +/* + * Mesa 3-D graphics library + * + * Copyright (C) 2010 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the "Software"), + * to deal in the Software without restriction, including without limitation + * the rights to use, copy, modify, merge, publish, distribute, sublicense, + * and/or sell copies of the Software, and to permit persons to whom the + * Software is furnished to do so, subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL + * THE AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN + * AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN + * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + */ + + +#include "context.h" +#include "version.h" + + + +/** + * Examine enabled GL extensions to determine GL version. + * Return major and minor version numbers. + */ +static void +compute_version(const GLcontext *ctx, GLuint *major, GLuint *minor) +{ + const GLboolean ver_1_3 = (ctx->Extensions.ARB_multisample && + ctx->Extensions.ARB_multitexture && + ctx->Extensions.ARB_texture_border_clamp && + ctx->Extensions.ARB_texture_compression && + ctx->Extensions.ARB_texture_cube_map && + ctx->Extensions.EXT_texture_env_add && + ctx->Extensions.ARB_texture_env_combine && + ctx->Extensions.ARB_texture_env_dot3); + const GLboolean ver_1_4 = (ver_1_3 && + ctx->Extensions.ARB_depth_texture && + ctx->Extensions.ARB_shadow && + ctx->Extensions.ARB_texture_env_crossbar && + ctx->Extensions.ARB_texture_mirrored_repeat && + ctx->Extensions.ARB_window_pos && + ctx->Extensions.EXT_blend_color && + ctx->Extensions.EXT_blend_func_separate && + ctx->Extensions.EXT_blend_minmax && + ctx->Extensions.EXT_blend_subtract && + ctx->Extensions.EXT_fog_coord && + ctx->Extensions.EXT_multi_draw_arrays && + ctx->Extensions.EXT_point_parameters && + ctx->Extensions.EXT_secondary_color && + ctx->Extensions.EXT_stencil_wrap && + ctx->Extensions.EXT_texture_lod_bias && + ctx->Extensions.SGIS_generate_mipmap); + const GLboolean ver_1_5 = (ver_1_4 && + ctx->Extensions.ARB_occlusion_query && + ctx->Extensions.ARB_vertex_buffer_object && + ctx->Extensions.EXT_shadow_funcs); + const GLboolean ver_2_0 = (ver_1_5 && + ctx->Extensions.ARB_draw_buffers && + ctx->Extensions.ARB_point_sprite && + ctx->Extensions.ARB_shader_objects && + ctx->Extensions.ARB_vertex_shader && + ctx->Extensions.ARB_fragment_shader && + ctx->Extensions.ARB_texture_non_power_of_two && + ctx->Extensions.EXT_blend_equation_separate && + + /* Technically, 2.0 requires the functionality + * of the EXT version. Enable 2.0 if either + * extension is available, and assume that a + * driver that only exposes the ATI extension + * will fallback to software when necessary. + */ + (ctx->Extensions.EXT_stencil_two_side + || ctx->Extensions.ATI_separate_stencil)); + const GLboolean ver_2_1 = (ver_2_0 && + ctx->Extensions.ARB_shading_language_120 && + ctx->Extensions.EXT_pixel_buffer_object && + ctx->Extensions.EXT_texture_sRGB); + if (ver_2_1) { + *major = 2; + *minor = 1; + } + else if (ver_2_0) { + *major = 2; + *minor = 0; + } + else if (ver_1_5) { + *major = 1; + *minor = 5; + } + else if (ver_1_4) { + *major = 1; + *minor = 4; + } + else if (ver_1_3) { + *major = 1; + *minor = 3; + } + else { + *major = 1; + *minor = 2; + } +} + + +/** + * Set the context's VersionMajor, VersionMinor, VersionString fields. + * This should only be called once as part of context initialization. + */ +void +_mesa_compute_version(GLcontext *ctx) +{ + static const int max = 100; + + compute_version(ctx, &ctx->VersionMajor, &ctx->VersionMinor); + + ctx->VersionString = (char *) _mesa_malloc(max); + if (ctx->VersionString) { + _mesa_snprintf(ctx->VersionString, max, "%u.%u Mesa " MESA_VERSION_STRING, + ctx->VersionMajor, ctx->VersionMinor); + } +} diff --git a/src/mesa/main/version.h b/src/mesa/main/version.h index dc55cb7ccc..d521569f8d 100644 --- a/src/mesa/main/version.h +++ b/src/mesa/main/version.h @@ -28,6 +28,9 @@ #define VERSION_H +#include "mtypes.h" + + /* Mesa version */ #define MESA_MAJOR 7 #define MESA_MINOR 8 @@ -50,4 +53,8 @@ #define OPENGL_VERSION_CODE OPENGL_VERSION(OPENGL_MAJOR, OPENGL_MINOR, OPENGL_PATCH) +extern void +_mesa_compute_version(GLcontext *ctx); + + #endif /* VERSION_H */ diff --git a/src/mesa/shader/nvfragparse.c b/src/mesa/shader/nvfragparse.c index b739a6aa07..8ee7c93062 100644 --- a/src/mesa/shader/nvfragparse.c +++ b/src/mesa/shader/nvfragparse.c @@ -642,7 +642,7 @@ Parse_SwizzleSuffix(const GLubyte *token, GLuint swizzle[4]) else { /* 4-component swizzle (vector) */ GLint k; - for (k = 0; token[k] && k < 4; k++) { + for (k = 0; k < 4 && token[k]; k++) { if (token[k] == 'x') swizzle[k] = 0; else if (token[k] == 'y') diff --git a/src/mesa/shader/prog_optimize.c b/src/mesa/shader/prog_optimize.c index 83d119e031..ce411731b2 100644 --- a/src/mesa/shader/prog_optimize.c +++ b/src/mesa/shader/prog_optimize.c @@ -577,7 +577,7 @@ _mesa_remove_extra_moves(struct gl_program *prog) /* get pointer to previous instruction */ prevI = i - 1; - while (removeInst[prevI] && prevI > 0) + while (prevI > 0 && removeInst[prevI]) prevI--; prevInst = prog->Instructions + prevI; diff --git a/src/mesa/shader/prog_parameter.c b/src/mesa/shader/prog_parameter.c index f22492e029..5822510701 100644 --- a/src/mesa/shader/prog_parameter.c +++ b/src/mesa/shader/prog_parameter.c @@ -230,9 +230,8 @@ _mesa_add_named_constant(struct gl_program_parameter_list *paramList, * Add a new unnamed constant to the parameter list. This will be used * when a fragment/vertex program contains something like this: * MOV r, { 0, 1, 2, 3 }; - * We'll search the parameter list for an existing instance of the - * constant. If swizzleOut is non-null, we'll try swizzling when - * looking for a match. + * If swizzleOut is non-null we'll search the parameter list for an + * existing instance of the constant which matches with a swizzle. * * \param paramList the parameter list * \param values four float values @@ -248,7 +247,8 @@ _mesa_add_unnamed_constant(struct gl_program_parameter_list *paramList, ASSERT(size >= 1); ASSERT(size <= 4); - if (_mesa_lookup_parameter_constant(paramList, values, + if (swizzleOut && + _mesa_lookup_parameter_constant(paramList, values, size, &pos, swizzleOut)) { return pos; } diff --git a/src/mesa/shader/prog_parameter_layout.c b/src/mesa/shader/prog_parameter_layout.c index 1c37b3a7a5..a888573832 100644 --- a/src/mesa/shader/prog_parameter_layout.c +++ b/src/mesa/shader/prog_parameter_layout.c @@ -72,14 +72,11 @@ copy_indirect_accessed_array(struct gl_program_parameter_list *src, unsigned first, unsigned count) { const int base = dst->NumParameters; - unsigned i; - unsigned j; - + unsigned i, j; for (i = first; i < (first + count); i++) { struct gl_program_parameter *curr = & src->Parameters[i]; - if (curr->Type == PROGRAM_CONSTANT) { j = dst->NumParameters; } else { @@ -93,10 +90,15 @@ copy_indirect_accessed_array(struct gl_program_parameter_list *src, assert(j == dst->NumParameters); + /* copy src parameter [i] to dest parameter [j] */ memcpy(& dst->Parameters[j], curr, sizeof(dst->Parameters[j])); memcpy(dst->ParameterValues[j], src->ParameterValues[i], sizeof(GLfloat) * 4); + + /* Pointer to the string name was copied. Null-out src param name + * to prevent double free later. + */ curr->Name = NULL; dst->NumParameters++; @@ -117,11 +119,9 @@ _mesa_layout_parameters(struct asm_parser_state *state) struct asm_instruction *inst; unsigned i; - layout = _mesa_new_parameter_list_sized(state->prog->Parameters->NumParameters); - /* PASS 1: Move any parameters that are accessed indirectly from the * original parameter list to the new parameter list. */ @@ -155,7 +155,6 @@ _mesa_layout_parameters(struct asm_parser_state *state) } } - /* PASS 2: Move any parameters that are not accessed indirectly from the * original parameter list to the new parameter list. */ @@ -165,7 +164,6 @@ _mesa_layout_parameters(struct asm_parser_state *state) const int idx = inst->SrcReg[i].Base.Index; unsigned swizzle = SWIZZLE_NOOP; - /* All relative addressed operands were processed on the first * pass. Just skip them here. */ @@ -173,7 +171,6 @@ _mesa_layout_parameters(struct asm_parser_state *state) continue; } - if ((inst->SrcReg[i].Base.File <= PROGRAM_VARYING ) || (inst->SrcReg[i].Base.File >= PROGRAM_WRITE_ONLY)) { continue; @@ -209,7 +206,6 @@ _mesa_layout_parameters(struct asm_parser_state *state) } } - _mesa_free_parameter_list(state->prog->Parameters); state->prog->Parameters = layout; diff --git a/src/mesa/shader/program_parse.tab.c b/src/mesa/shader/program_parse.tab.c index a1e69b8450..b12dcee9df 100644 --- a/src/mesa/shader/program_parse.tab.c +++ b/src/mesa/shader/program_parse.tab.c @@ -123,7 +123,8 @@ static int initialize_symbol_from_param(struct gl_program *prog, struct asm_symbol *param_var, const gl_state_index tokens[STATE_LENGTH]); static int initialize_symbol_from_const(struct gl_program *prog, - struct asm_symbol *param_var, const struct asm_vector *vec); + struct asm_symbol *param_var, const struct asm_vector *vec, + GLboolean allowSwizzle); static int yyparse(struct asm_parser_state *state); @@ -188,7 +189,7 @@ static struct asm_instruction *asm_instruction_copy_ctor( /* Line 189 of yacc.c */ -#line 192 "program_parse.tab.c" +#line 193 "program_parse.tab.c" /* Enabling traces. */ #ifndef YYDEBUG @@ -330,7 +331,7 @@ typedef union YYSTYPE { /* Line 214 of yacc.c */ -#line 125 "program_parse.y" +#line 126 "program_parse.y" struct asm_instruction *inst; struct asm_symbol *sym; @@ -359,7 +360,7 @@ typedef union YYSTYPE /* Line 214 of yacc.c */ -#line 363 "program_parse.tab.c" +#line 364 "program_parse.tab.c" } YYSTYPE; # define YYSTYPE_IS_TRIVIAL 1 # define yystype YYSTYPE /* obsolescent; will be withdrawn */ @@ -383,14 +384,14 @@ typedef struct YYLTYPE /* Copy the second part of user declarations. */ /* Line 264 of yacc.c */ -#line 270 "program_parse.y" +#line 271 "program_parse.y" extern int yylex(YYSTYPE *yylval_param, YYLTYPE *yylloc_param, void *yyscanner); /* Line 264 of yacc.c */ -#line 394 "program_parse.tab.c" +#line 395 "program_parse.tab.c" #ifdef short # undef short @@ -791,35 +792,35 @@ static const yytype_int16 yyrhs[] = /* YYRLINE[YYN] -- source line where rule number YYN was defined. */ static const yytype_uint16 yyrline[] = { - 0, 277, 277, 280, 288, 300, 301, 304, 328, 329, - 332, 347, 350, 355, 362, 363, 364, 365, 366, 367, - 368, 371, 372, 373, 376, 382, 388, 394, 401, 407, - 414, 458, 463, 473, 517, 523, 524, 525, 526, 527, - 528, 529, 530, 531, 532, 533, 534, 537, 549, 557, - 574, 581, 600, 611, 631, 656, 663, 696, 703, 718, - 773, 816, 825, 846, 856, 860, 889, 908, 908, 910, - 917, 929, 930, 931, 934, 948, 962, 982, 993, 1005, - 1007, 1008, 1009, 1010, 1013, 1013, 1013, 1013, 1014, 1017, - 1021, 1026, 1033, 1040, 1047, 1070, 1093, 1094, 1095, 1096, - 1097, 1098, 1101, 1120, 1124, 1130, 1134, 1138, 1142, 1151, - 1160, 1164, 1169, 1175, 1186, 1186, 1187, 1189, 1193, 1197, - 1201, 1207, 1207, 1209, 1227, 1253, 1256, 1267, 1273, 1279, - 1280, 1287, 1293, 1299, 1307, 1313, 1319, 1327, 1333, 1339, - 1347, 1348, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, - 1359, 1360, 1361, 1364, 1373, 1377, 1381, 1387, 1396, 1400, - 1404, 1413, 1417, 1423, 1429, 1436, 1441, 1449, 1459, 1461, - 1469, 1475, 1479, 1483, 1489, 1500, 1509, 1513, 1518, 1522, - 1526, 1530, 1536, 1543, 1547, 1553, 1561, 1572, 1579, 1583, - 1589, 1599, 1610, 1614, 1632, 1641, 1644, 1650, 1654, 1658, - 1664, 1675, 1680, 1685, 1690, 1695, 1700, 1708, 1711, 1716, - 1729, 1737, 1748, 1756, 1756, 1758, 1758, 1760, 1770, 1775, - 1782, 1792, 1801, 1806, 1813, 1823, 1833, 1845, 1845, 1846, - 1846, 1848, 1858, 1866, 1876, 1884, 1892, 1901, 1912, 1916, - 1922, 1923, 1924, 1927, 1927, 1930, 1965, 1969, 1969, 1972, - 1979, 1988, 2002, 2011, 2020, 2024, 2033, 2042, 2053, 2060, - 2065, 2074, 2086, 2089, 2098, 2109, 2110, 2111, 2114, 2115, - 2116, 2119, 2120, 2123, 2124, 2127, 2128, 2131, 2142, 2153, - 2164, 2190, 2191 + 0, 278, 278, 281, 289, 301, 302, 305, 329, 330, + 333, 348, 351, 356, 363, 364, 365, 366, 367, 368, + 369, 372, 373, 374, 377, 383, 389, 395, 402, 408, + 415, 459, 464, 474, 518, 524, 525, 526, 527, 528, + 529, 530, 531, 532, 533, 534, 535, 538, 550, 558, + 575, 582, 601, 612, 632, 657, 664, 697, 704, 719, + 774, 817, 826, 847, 857, 861, 890, 909, 909, 911, + 918, 930, 931, 932, 935, 949, 963, 983, 994, 1006, + 1008, 1009, 1010, 1011, 1014, 1014, 1014, 1014, 1015, 1018, + 1022, 1027, 1034, 1041, 1048, 1071, 1094, 1095, 1096, 1097, + 1098, 1099, 1102, 1121, 1125, 1131, 1135, 1139, 1143, 1152, + 1161, 1165, 1170, 1176, 1187, 1187, 1188, 1190, 1194, 1198, + 1202, 1208, 1208, 1210, 1228, 1254, 1257, 1268, 1274, 1280, + 1281, 1288, 1294, 1300, 1308, 1314, 1320, 1328, 1334, 1340, + 1348, 1349, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359, + 1360, 1361, 1362, 1365, 1374, 1378, 1382, 1388, 1397, 1401, + 1405, 1414, 1418, 1424, 1430, 1437, 1442, 1450, 1460, 1462, + 1470, 1476, 1480, 1484, 1490, 1501, 1510, 1514, 1519, 1523, + 1527, 1531, 1537, 1544, 1548, 1554, 1562, 1573, 1580, 1584, + 1590, 1600, 1611, 1615, 1633, 1642, 1645, 1651, 1655, 1659, + 1665, 1676, 1681, 1686, 1691, 1696, 1701, 1709, 1712, 1717, + 1730, 1738, 1749, 1757, 1757, 1759, 1759, 1761, 1771, 1776, + 1783, 1793, 1802, 1807, 1814, 1824, 1834, 1846, 1846, 1847, + 1847, 1849, 1859, 1867, 1877, 1885, 1893, 1902, 1913, 1917, + 1923, 1924, 1925, 1928, 1928, 1931, 1966, 1970, 1970, 1973, + 1980, 1989, 2003, 2012, 2021, 2025, 2034, 2043, 2054, 2061, + 2066, 2075, 2087, 2090, 2099, 2110, 2111, 2112, 2115, 2116, + 2117, 2120, 2121, 2124, 2125, 2128, 2129, 2132, 2143, 2154, + 2165, 2191, 2192 }; #endif @@ -2128,7 +2129,7 @@ yyreduce: case 3: /* Line 1455 of yacc.c */ -#line 281 "program_parse.y" +#line 282 "program_parse.y" { if (state->prog->Target != GL_VERTEX_PROGRAM_ARB) { yyerror(& (yylsp[(1) - (1)]), state, "invalid fragment program header"); @@ -2141,7 +2142,7 @@ yyreduce: case 4: /* Line 1455 of yacc.c */ -#line 289 "program_parse.y" +#line 290 "program_parse.y" { if (state->prog->Target != GL_FRAGMENT_PROGRAM_ARB) { yyerror(& (yylsp[(1) - (1)]), state, "invalid vertex program header"); @@ -2156,7 +2157,7 @@ yyreduce: case 7: /* Line 1455 of yacc.c */ -#line 305 "program_parse.y" +#line 306 "program_parse.y" { int valid = 0; @@ -2183,7 +2184,7 @@ yyreduce: case 10: /* Line 1455 of yacc.c */ -#line 333 "program_parse.y" +#line 334 "program_parse.y" { if ((yyvsp[(1) - (2)].inst) != NULL) { if (state->inst_tail == NULL) { @@ -2203,7 +2204,7 @@ yyreduce: case 12: /* Line 1455 of yacc.c */ -#line 351 "program_parse.y" +#line 352 "program_parse.y" { (yyval.inst) = (yyvsp[(1) - (1)].inst); state->prog->NumAluInstructions++; @@ -2213,7 +2214,7 @@ yyreduce: case 13: /* Line 1455 of yacc.c */ -#line 356 "program_parse.y" +#line 357 "program_parse.y" { (yyval.inst) = (yyvsp[(1) - (1)].inst); state->prog->NumTexInstructions++; @@ -2223,7 +2224,7 @@ yyreduce: case 24: /* Line 1455 of yacc.c */ -#line 377 "program_parse.y" +#line 378 "program_parse.y" { (yyval.inst) = asm_instruction_ctor(OPCODE_ARL, & (yyvsp[(2) - (4)].dst_reg), & (yyvsp[(4) - (4)].src_reg), NULL, NULL); ;} @@ -2232,7 +2233,7 @@ yyreduce: case 25: /* Line 1455 of yacc.c */ -#line 383 "program_parse.y" +#line 384 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (4)].temp_inst), & (yyvsp[(2) - (4)].dst_reg), & (yyvsp[(4) - (4)].src_reg), NULL, NULL); ;} @@ -2241,7 +2242,7 @@ yyreduce: case 26: /* Line 1455 of yacc.c */ -#line 389 "program_parse.y" +#line 390 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (4)].temp_inst), & (yyvsp[(2) - (4)].dst_reg), & (yyvsp[(4) - (4)].src_reg), NULL, NULL); ;} @@ -2250,7 +2251,7 @@ yyreduce: case 27: /* Line 1455 of yacc.c */ -#line 395 "program_parse.y" +#line 396 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (6)].temp_inst), & (yyvsp[(2) - (6)].dst_reg), & (yyvsp[(4) - (6)].src_reg), & (yyvsp[(6) - (6)].src_reg), NULL); ;} @@ -2259,7 +2260,7 @@ yyreduce: case 28: /* Line 1455 of yacc.c */ -#line 402 "program_parse.y" +#line 403 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (6)].temp_inst), & (yyvsp[(2) - (6)].dst_reg), & (yyvsp[(4) - (6)].src_reg), & (yyvsp[(6) - (6)].src_reg), NULL); ;} @@ -2268,7 +2269,7 @@ yyreduce: case 29: /* Line 1455 of yacc.c */ -#line 409 "program_parse.y" +#line 410 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (8)].temp_inst), & (yyvsp[(2) - (8)].dst_reg), & (yyvsp[(4) - (8)].src_reg), & (yyvsp[(6) - (8)].src_reg), & (yyvsp[(8) - (8)].src_reg)); ;} @@ -2277,7 +2278,7 @@ yyreduce: case 30: /* Line 1455 of yacc.c */ -#line 415 "program_parse.y" +#line 416 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (8)].temp_inst), & (yyvsp[(2) - (8)].dst_reg), & (yyvsp[(4) - (8)].src_reg), NULL, NULL); if ((yyval.inst) != NULL) { @@ -2324,7 +2325,7 @@ yyreduce: case 31: /* Line 1455 of yacc.c */ -#line 459 "program_parse.y" +#line 460 "program_parse.y" { (yyval.inst) = asm_instruction_ctor(OPCODE_KIL, NULL, & (yyvsp[(2) - (2)].src_reg), NULL, NULL); state->fragment.UsesKill = 1; @@ -2334,7 +2335,7 @@ yyreduce: case 32: /* Line 1455 of yacc.c */ -#line 464 "program_parse.y" +#line 465 "program_parse.y" { (yyval.inst) = asm_instruction_ctor(OPCODE_KIL_NV, NULL, NULL, NULL, NULL); (yyval.inst)->Base.DstReg.CondMask = (yyvsp[(2) - (2)].dst_reg).CondMask; @@ -2347,7 +2348,7 @@ yyreduce: case 33: /* Line 1455 of yacc.c */ -#line 474 "program_parse.y" +#line 475 "program_parse.y" { (yyval.inst) = asm_instruction_copy_ctor(& (yyvsp[(1) - (12)].temp_inst), & (yyvsp[(2) - (12)].dst_reg), & (yyvsp[(4) - (12)].src_reg), & (yyvsp[(6) - (12)].src_reg), & (yyvsp[(8) - (12)].src_reg)); if ((yyval.inst) != NULL) { @@ -2394,7 +2395,7 @@ yyreduce: case 34: /* Line 1455 of yacc.c */ -#line 518 "program_parse.y" +#line 519 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (2)].integer); ;} @@ -2403,91 +2404,91 @@ yyreduce: case 35: /* Line 1455 of yacc.c */ -#line 523 "program_parse.y" +#line 524 "program_parse.y" { (yyval.integer) = TEXTURE_1D_INDEX; ;} break; case 36: /* Line 1455 of yacc.c */ -#line 524 "program_parse.y" +#line 525 "program_parse.y" { (yyval.integer) = TEXTURE_2D_INDEX; ;} break; case 37: /* Line 1455 of yacc.c */ -#line 525 "program_parse.y" +#line 526 "program_parse.y" { (yyval.integer) = TEXTURE_3D_INDEX; ;} break; case 38: /* Line 1455 of yacc.c */ -#line 526 "program_parse.y" +#line 527 "program_parse.y" { (yyval.integer) = TEXTURE_CUBE_INDEX; ;} break; case 39: /* Line 1455 of yacc.c */ -#line 527 "program_parse.y" +#line 528 "program_parse.y" { (yyval.integer) = TEXTURE_RECT_INDEX; ;} break; case 40: /* Line 1455 of yacc.c */ -#line 528 "program_parse.y" +#line 529 "program_parse.y" { (yyval.integer) = -TEXTURE_1D_INDEX; ;} break; case 41: /* Line 1455 of yacc.c */ -#line 529 "program_parse.y" +#line 530 "program_parse.y" { (yyval.integer) = -TEXTURE_2D_INDEX; ;} break; case 42: /* Line 1455 of yacc.c */ -#line 530 "program_parse.y" +#line 531 "program_parse.y" { (yyval.integer) = -TEXTURE_RECT_INDEX; ;} break; case 43: /* Line 1455 of yacc.c */ -#line 531 "program_parse.y" +#line 532 "program_parse.y" { (yyval.integer) = TEXTURE_1D_ARRAY_INDEX; ;} break; case 44: /* Line 1455 of yacc.c */ -#line 532 "program_parse.y" +#line 533 "program_parse.y" { (yyval.integer) = TEXTURE_2D_ARRAY_INDEX; ;} break; case 45: /* Line 1455 of yacc.c */ -#line 533 "program_parse.y" +#line 534 "program_parse.y" { (yyval.integer) = -TEXTURE_1D_ARRAY_INDEX; ;} break; case 46: /* Line 1455 of yacc.c */ -#line 534 "program_parse.y" +#line 535 "program_parse.y" { (yyval.integer) = -TEXTURE_2D_ARRAY_INDEX; ;} break; case 47: /* Line 1455 of yacc.c */ -#line 538 "program_parse.y" +#line 539 "program_parse.y" { /* FIXME: Is this correct? Should the extenedSwizzle be applied * FIXME: to the existing swizzle? @@ -2502,7 +2503,7 @@ yyreduce: case 48: /* Line 1455 of yacc.c */ -#line 550 "program_parse.y" +#line 551 "program_parse.y" { (yyval.src_reg) = (yyvsp[(2) - (2)].src_reg); @@ -2515,7 +2516,7 @@ yyreduce: case 49: /* Line 1455 of yacc.c */ -#line 558 "program_parse.y" +#line 559 "program_parse.y" { (yyval.src_reg) = (yyvsp[(3) - (4)].src_reg); @@ -2535,7 +2536,7 @@ yyreduce: case 50: /* Line 1455 of yacc.c */ -#line 575 "program_parse.y" +#line 576 "program_parse.y" { (yyval.src_reg) = (yyvsp[(1) - (2)].src_reg); @@ -2547,7 +2548,7 @@ yyreduce: case 51: /* Line 1455 of yacc.c */ -#line 582 "program_parse.y" +#line 583 "program_parse.y" { struct asm_symbol temp_sym; @@ -2558,7 +2559,7 @@ yyreduce: memset(& temp_sym, 0, sizeof(temp_sym)); temp_sym.param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & temp_sym, & (yyvsp[(1) - (1)].vector)); + initialize_symbol_from_const(state->prog, & temp_sym, & (yyvsp[(1) - (1)].vector), GL_TRUE); set_src_reg_swz(& (yyval.src_reg), PROGRAM_CONSTANT, temp_sym.param_binding_begin, @@ -2569,7 +2570,7 @@ yyreduce: case 52: /* Line 1455 of yacc.c */ -#line 601 "program_parse.y" +#line 602 "program_parse.y" { (yyval.src_reg) = (yyvsp[(2) - (3)].src_reg); @@ -2585,7 +2586,7 @@ yyreduce: case 53: /* Line 1455 of yacc.c */ -#line 612 "program_parse.y" +#line 613 "program_parse.y" { (yyval.src_reg) = (yyvsp[(3) - (5)].src_reg); @@ -2607,7 +2608,7 @@ yyreduce: case 54: /* Line 1455 of yacc.c */ -#line 632 "program_parse.y" +#line 633 "program_parse.y" { (yyval.dst_reg) = (yyvsp[(1) - (3)].dst_reg); (yyval.dst_reg).WriteMask = (yyvsp[(2) - (3)].swiz_mask).mask; @@ -2635,7 +2636,7 @@ yyreduce: case 55: /* Line 1455 of yacc.c */ -#line 657 "program_parse.y" +#line 658 "program_parse.y" { set_dst_reg(& (yyval.dst_reg), PROGRAM_ADDRESS, 0); (yyval.dst_reg).WriteMask = (yyvsp[(2) - (2)].swiz_mask).mask; @@ -2645,7 +2646,7 @@ yyreduce: case 56: /* Line 1455 of yacc.c */ -#line 664 "program_parse.y" +#line 665 "program_parse.y" { const unsigned xyzw_valid = ((yyvsp[(1) - (7)].ext_swizzle).xyzw_valid << 0) @@ -2681,7 +2682,7 @@ yyreduce: case 57: /* Line 1455 of yacc.c */ -#line 697 "program_parse.y" +#line 698 "program_parse.y" { (yyval.ext_swizzle) = (yyvsp[(2) - (2)].ext_swizzle); (yyval.ext_swizzle).negate = ((yyvsp[(1) - (2)].negate)) ? 1 : 0; @@ -2691,7 +2692,7 @@ yyreduce: case 58: /* Line 1455 of yacc.c */ -#line 704 "program_parse.y" +#line 705 "program_parse.y" { if (((yyvsp[(1) - (1)].integer) != 0) && ((yyvsp[(1) - (1)].integer) != 1)) { yyerror(& (yylsp[(1) - (1)]), state, "invalid extended swizzle selector"); @@ -2711,7 +2712,7 @@ yyreduce: case 59: /* Line 1455 of yacc.c */ -#line 719 "program_parse.y" +#line 720 "program_parse.y" { char s; @@ -2769,7 +2770,7 @@ yyreduce: case 60: /* Line 1455 of yacc.c */ -#line 774 "program_parse.y" +#line 775 "program_parse.y" { struct asm_symbol *const s = (struct asm_symbol *) _mesa_symbol_table_find_symbol(state->st, 0, (yyvsp[(1) - (1)].string)); @@ -2817,7 +2818,7 @@ yyreduce: case 61: /* Line 1455 of yacc.c */ -#line 817 "program_parse.y" +#line 818 "program_parse.y" { set_src_reg(& (yyval.src_reg), PROGRAM_INPUT, (yyvsp[(1) - (1)].attrib)); state->prog->InputsRead |= (1U << (yyval.src_reg).Base.Index); @@ -2831,7 +2832,7 @@ yyreduce: case 62: /* Line 1455 of yacc.c */ -#line 826 "program_parse.y" +#line 827 "program_parse.y" { if (! (yyvsp[(3) - (4)].src_reg).Base.RelAddr && ((unsigned) (yyvsp[(3) - (4)].src_reg).Base.Index >= (yyvsp[(1) - (4)].sym)->param_binding_length)) { @@ -2857,7 +2858,7 @@ yyreduce: case 63: /* Line 1455 of yacc.c */ -#line 847 "program_parse.y" +#line 848 "program_parse.y" { gl_register_file file = ((yyvsp[(1) - (1)].temp_sym).name != NULL) ? (yyvsp[(1) - (1)].temp_sym).param_binding_type @@ -2870,7 +2871,7 @@ yyreduce: case 64: /* Line 1455 of yacc.c */ -#line 857 "program_parse.y" +#line 858 "program_parse.y" { set_dst_reg(& (yyval.dst_reg), PROGRAM_OUTPUT, (yyvsp[(1) - (1)].result)); ;} @@ -2879,7 +2880,7 @@ yyreduce: case 65: /* Line 1455 of yacc.c */ -#line 861 "program_parse.y" +#line 862 "program_parse.y" { struct asm_symbol *const s = (struct asm_symbol *) _mesa_symbol_table_find_symbol(state->st, 0, (yyvsp[(1) - (1)].string)); @@ -2911,7 +2912,7 @@ yyreduce: case 66: /* Line 1455 of yacc.c */ -#line 890 "program_parse.y" +#line 891 "program_parse.y" { struct asm_symbol *const s = (struct asm_symbol *) _mesa_symbol_table_find_symbol(state->st, 0, (yyvsp[(1) - (1)].string)); @@ -2933,7 +2934,7 @@ yyreduce: case 69: /* Line 1455 of yacc.c */ -#line 911 "program_parse.y" +#line 912 "program_parse.y" { init_src_reg(& (yyval.src_reg)); (yyval.src_reg).Base.Index = (yyvsp[(1) - (1)].integer); @@ -2943,7 +2944,7 @@ yyreduce: case 70: /* Line 1455 of yacc.c */ -#line 918 "program_parse.y" +#line 919 "program_parse.y" { /* FINISHME: Add support for multiple address registers. */ @@ -2958,28 +2959,28 @@ yyreduce: case 71: /* Line 1455 of yacc.c */ -#line 929 "program_parse.y" +#line 930 "program_parse.y" { (yyval.integer) = 0; ;} break; case 72: /* Line 1455 of yacc.c */ -#line 930 "program_parse.y" +#line 931 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (2)].integer); ;} break; case 73: /* Line 1455 of yacc.c */ -#line 931 "program_parse.y" +#line 932 "program_parse.y" { (yyval.integer) = -(yyvsp[(2) - (2)].integer); ;} break; case 74: /* Line 1455 of yacc.c */ -#line 935 "program_parse.y" +#line 936 "program_parse.y" { if (((yyvsp[(1) - (1)].integer) < 0) || ((yyvsp[(1) - (1)].integer) > 63)) { char s[100]; @@ -2996,7 +2997,7 @@ yyreduce: case 75: /* Line 1455 of yacc.c */ -#line 949 "program_parse.y" +#line 950 "program_parse.y" { if (((yyvsp[(1) - (1)].integer) < 0) || ((yyvsp[(1) - (1)].integer) > 64)) { char s[100]; @@ -3013,7 +3014,7 @@ yyreduce: case 76: /* Line 1455 of yacc.c */ -#line 963 "program_parse.y" +#line 964 "program_parse.y" { struct asm_symbol *const s = (struct asm_symbol *) _mesa_symbol_table_find_symbol(state->st, 0, (yyvsp[(1) - (1)].string)); @@ -3036,7 +3037,7 @@ yyreduce: case 77: /* Line 1455 of yacc.c */ -#line 983 "program_parse.y" +#line 984 "program_parse.y" { if ((yyvsp[(1) - (1)].swiz_mask).mask != WRITEMASK_X) { yyerror(& (yylsp[(1) - (1)]), state, "invalid address component selector"); @@ -3050,7 +3051,7 @@ yyreduce: case 78: /* Line 1455 of yacc.c */ -#line 994 "program_parse.y" +#line 995 "program_parse.y" { if ((yyvsp[(1) - (1)].swiz_mask).mask != WRITEMASK_X) { yyerror(& (yylsp[(1) - (1)]), state, @@ -3065,21 +3066,21 @@ yyreduce: case 83: /* Line 1455 of yacc.c */ -#line 1010 "program_parse.y" +#line 1011 "program_parse.y" { (yyval.swiz_mask).swizzle = SWIZZLE_NOOP; (yyval.swiz_mask).mask = WRITEMASK_XYZW; ;} break; case 88: /* Line 1455 of yacc.c */ -#line 1014 "program_parse.y" +#line 1015 "program_parse.y" { (yyval.swiz_mask).swizzle = SWIZZLE_NOOP; (yyval.swiz_mask).mask = WRITEMASK_XYZW; ;} break; case 89: /* Line 1455 of yacc.c */ -#line 1018 "program_parse.y" +#line 1019 "program_parse.y" { (yyval.dst_reg) = (yyvsp[(2) - (3)].dst_reg); ;} @@ -3088,7 +3089,7 @@ yyreduce: case 90: /* Line 1455 of yacc.c */ -#line 1022 "program_parse.y" +#line 1023 "program_parse.y" { (yyval.dst_reg) = (yyvsp[(2) - (3)].dst_reg); ;} @@ -3097,7 +3098,7 @@ yyreduce: case 91: /* Line 1455 of yacc.c */ -#line 1026 "program_parse.y" +#line 1027 "program_parse.y" { (yyval.dst_reg).CondMask = COND_TR; (yyval.dst_reg).CondSwizzle = SWIZZLE_NOOP; @@ -3108,7 +3109,7 @@ yyreduce: case 92: /* Line 1455 of yacc.c */ -#line 1034 "program_parse.y" +#line 1035 "program_parse.y" { (yyval.dst_reg) = (yyvsp[(1) - (2)].dst_reg); (yyval.dst_reg).CondSwizzle = (yyvsp[(2) - (2)].swiz_mask).swizzle; @@ -3118,7 +3119,7 @@ yyreduce: case 93: /* Line 1455 of yacc.c */ -#line 1041 "program_parse.y" +#line 1042 "program_parse.y" { (yyval.dst_reg) = (yyvsp[(1) - (2)].dst_reg); (yyval.dst_reg).CondSwizzle = (yyvsp[(2) - (2)].swiz_mask).swizzle; @@ -3128,7 +3129,7 @@ yyreduce: case 94: /* Line 1455 of yacc.c */ -#line 1048 "program_parse.y" +#line 1049 "program_parse.y" { const int cond = _mesa_parse_cc((yyvsp[(1) - (1)].string)); if ((cond == 0) || ((yyvsp[(1) - (1)].string)[2] != '\0')) { @@ -3154,7 +3155,7 @@ yyreduce: case 95: /* Line 1455 of yacc.c */ -#line 1071 "program_parse.y" +#line 1072 "program_parse.y" { const int cond = _mesa_parse_cc((yyvsp[(1) - (1)].string)); if ((cond == 0) || ((yyvsp[(1) - (1)].string)[2] != '\0')) { @@ -3180,7 +3181,7 @@ yyreduce: case 102: /* Line 1455 of yacc.c */ -#line 1102 "program_parse.y" +#line 1103 "program_parse.y" { struct asm_symbol *const s = declare_variable(state, (yyvsp[(2) - (4)].string), at_attrib, & (yylsp[(2) - (4)])); @@ -3202,7 +3203,7 @@ yyreduce: case 103: /* Line 1455 of yacc.c */ -#line 1121 "program_parse.y" +#line 1122 "program_parse.y" { (yyval.attrib) = (yyvsp[(2) - (2)].attrib); ;} @@ -3211,7 +3212,7 @@ yyreduce: case 104: /* Line 1455 of yacc.c */ -#line 1125 "program_parse.y" +#line 1126 "program_parse.y" { (yyval.attrib) = (yyvsp[(2) - (2)].attrib); ;} @@ -3220,7 +3221,7 @@ yyreduce: case 105: /* Line 1455 of yacc.c */ -#line 1131 "program_parse.y" +#line 1132 "program_parse.y" { (yyval.attrib) = VERT_ATTRIB_POS; ;} @@ -3229,7 +3230,7 @@ yyreduce: case 106: /* Line 1455 of yacc.c */ -#line 1135 "program_parse.y" +#line 1136 "program_parse.y" { (yyval.attrib) = VERT_ATTRIB_WEIGHT; ;} @@ -3238,7 +3239,7 @@ yyreduce: case 107: /* Line 1455 of yacc.c */ -#line 1139 "program_parse.y" +#line 1140 "program_parse.y" { (yyval.attrib) = VERT_ATTRIB_NORMAL; ;} @@ -3247,7 +3248,7 @@ yyreduce: case 108: /* Line 1455 of yacc.c */ -#line 1143 "program_parse.y" +#line 1144 "program_parse.y" { if (!state->ctx->Extensions.EXT_secondary_color) { yyerror(& (yylsp[(2) - (2)]), state, "GL_EXT_secondary_color not supported"); @@ -3261,7 +3262,7 @@ yyreduce: case 109: /* Line 1455 of yacc.c */ -#line 1152 "program_parse.y" +#line 1153 "program_parse.y" { if (!state->ctx->Extensions.EXT_fog_coord) { yyerror(& (yylsp[(1) - (1)]), state, "GL_EXT_fog_coord not supported"); @@ -3275,7 +3276,7 @@ yyreduce: case 110: /* Line 1455 of yacc.c */ -#line 1161 "program_parse.y" +#line 1162 "program_parse.y" { (yyval.attrib) = VERT_ATTRIB_TEX0 + (yyvsp[(2) - (2)].integer); ;} @@ -3284,7 +3285,7 @@ yyreduce: case 111: /* Line 1455 of yacc.c */ -#line 1165 "program_parse.y" +#line 1166 "program_parse.y" { yyerror(& (yylsp[(1) - (4)]), state, "GL_ARB_matrix_palette not supported"); YYERROR; @@ -3294,7 +3295,7 @@ yyreduce: case 112: /* Line 1455 of yacc.c */ -#line 1170 "program_parse.y" +#line 1171 "program_parse.y" { (yyval.attrib) = VERT_ATTRIB_GENERIC0 + (yyvsp[(3) - (4)].integer); ;} @@ -3303,7 +3304,7 @@ yyreduce: case 113: /* Line 1455 of yacc.c */ -#line 1176 "program_parse.y" +#line 1177 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->limits->MaxAttribs) { yyerror(& (yylsp[(1) - (1)]), state, "invalid vertex attribute reference"); @@ -3317,7 +3318,7 @@ yyreduce: case 117: /* Line 1455 of yacc.c */ -#line 1190 "program_parse.y" +#line 1191 "program_parse.y" { (yyval.attrib) = FRAG_ATTRIB_WPOS; ;} @@ -3326,7 +3327,7 @@ yyreduce: case 118: /* Line 1455 of yacc.c */ -#line 1194 "program_parse.y" +#line 1195 "program_parse.y" { (yyval.attrib) = FRAG_ATTRIB_COL0 + (yyvsp[(2) - (2)].integer); ;} @@ -3335,7 +3336,7 @@ yyreduce: case 119: /* Line 1455 of yacc.c */ -#line 1198 "program_parse.y" +#line 1199 "program_parse.y" { (yyval.attrib) = FRAG_ATTRIB_FOGC; ;} @@ -3344,7 +3345,7 @@ yyreduce: case 120: /* Line 1455 of yacc.c */ -#line 1202 "program_parse.y" +#line 1203 "program_parse.y" { (yyval.attrib) = FRAG_ATTRIB_TEX0 + (yyvsp[(2) - (2)].integer); ;} @@ -3353,7 +3354,7 @@ yyreduce: case 123: /* Line 1455 of yacc.c */ -#line 1210 "program_parse.y" +#line 1211 "program_parse.y" { struct asm_symbol *const s = declare_variable(state, (yyvsp[(2) - (3)].string), at_param, & (yylsp[(2) - (3)])); @@ -3374,7 +3375,7 @@ yyreduce: case 124: /* Line 1455 of yacc.c */ -#line 1228 "program_parse.y" +#line 1229 "program_parse.y" { if (((yyvsp[(4) - (6)].integer) != 0) && ((unsigned) (yyvsp[(4) - (6)].integer) != (yyvsp[(6) - (6)].temp_sym).param_binding_length)) { free((yyvsp[(2) - (6)].string)); @@ -3402,7 +3403,7 @@ yyreduce: case 125: /* Line 1455 of yacc.c */ -#line 1253 "program_parse.y" +#line 1254 "program_parse.y" { (yyval.integer) = 0; ;} @@ -3411,7 +3412,7 @@ yyreduce: case 126: /* Line 1455 of yacc.c */ -#line 1257 "program_parse.y" +#line 1258 "program_parse.y" { if (((yyvsp[(1) - (1)].integer) < 1) || ((unsigned) (yyvsp[(1) - (1)].integer) > state->limits->MaxParameters)) { yyerror(& (yylsp[(1) - (1)]), state, "invalid parameter array size"); @@ -3425,7 +3426,7 @@ yyreduce: case 127: /* Line 1455 of yacc.c */ -#line 1268 "program_parse.y" +#line 1269 "program_parse.y" { (yyval.temp_sym) = (yyvsp[(2) - (2)].temp_sym); ;} @@ -3434,7 +3435,7 @@ yyreduce: case 128: /* Line 1455 of yacc.c */ -#line 1274 "program_parse.y" +#line 1275 "program_parse.y" { (yyval.temp_sym) = (yyvsp[(3) - (4)].temp_sym); ;} @@ -3443,7 +3444,7 @@ yyreduce: case 130: /* Line 1455 of yacc.c */ -#line 1281 "program_parse.y" +#line 1282 "program_parse.y" { (yyvsp[(1) - (3)].temp_sym).param_binding_length += (yyvsp[(3) - (3)].temp_sym).param_binding_length; (yyval.temp_sym) = (yyvsp[(1) - (3)].temp_sym); @@ -3453,7 +3454,7 @@ yyreduce: case 131: /* Line 1455 of yacc.c */ -#line 1288 "program_parse.y" +#line 1289 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3464,7 +3465,7 @@ yyreduce: case 132: /* Line 1455 of yacc.c */ -#line 1294 "program_parse.y" +#line 1295 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3475,18 +3476,18 @@ yyreduce: case 133: /* Line 1455 of yacc.c */ -#line 1300 "program_parse.y" +#line 1301 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector)); + initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector), GL_TRUE); ;} break; case 134: /* Line 1455 of yacc.c */ -#line 1308 "program_parse.y" +#line 1309 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3497,7 +3498,7 @@ yyreduce: case 135: /* Line 1455 of yacc.c */ -#line 1314 "program_parse.y" +#line 1315 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3508,18 +3509,18 @@ yyreduce: case 136: /* Line 1455 of yacc.c */ -#line 1320 "program_parse.y" +#line 1321 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector)); + initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector), GL_TRUE); ;} break; case 137: /* Line 1455 of yacc.c */ -#line 1328 "program_parse.y" +#line 1329 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3530,7 +3531,7 @@ yyreduce: case 138: /* Line 1455 of yacc.c */ -#line 1334 "program_parse.y" +#line 1335 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; @@ -3541,109 +3542,109 @@ yyreduce: case 139: /* Line 1455 of yacc.c */ -#line 1340 "program_parse.y" +#line 1341 "program_parse.y" { memset(& (yyval.temp_sym), 0, sizeof((yyval.temp_sym))); (yyval.temp_sym).param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector)); + initialize_symbol_from_const(state->prog, & (yyval.temp_sym), & (yyvsp[(1) - (1)].vector), GL_FALSE); ;} break; case 140: /* Line 1455 of yacc.c */ -#line 1347 "program_parse.y" +#line 1348 "program_parse.y" { memcpy((yyval.state), (yyvsp[(1) - (1)].state), sizeof((yyval.state))); ;} break; case 141: /* Line 1455 of yacc.c */ -#line 1348 "program_parse.y" +#line 1349 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 142: /* Line 1455 of yacc.c */ -#line 1351 "program_parse.y" +#line 1352 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 143: /* Line 1455 of yacc.c */ -#line 1352 "program_parse.y" +#line 1353 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 144: /* Line 1455 of yacc.c */ -#line 1353 "program_parse.y" +#line 1354 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 145: /* Line 1455 of yacc.c */ -#line 1354 "program_parse.y" +#line 1355 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 146: /* Line 1455 of yacc.c */ -#line 1355 "program_parse.y" +#line 1356 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 147: /* Line 1455 of yacc.c */ -#line 1356 "program_parse.y" +#line 1357 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 148: /* Line 1455 of yacc.c */ -#line 1357 "program_parse.y" +#line 1358 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 149: /* Line 1455 of yacc.c */ -#line 1358 "program_parse.y" +#line 1359 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 150: /* Line 1455 of yacc.c */ -#line 1359 "program_parse.y" +#line 1360 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 151: /* Line 1455 of yacc.c */ -#line 1360 "program_parse.y" +#line 1361 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 152: /* Line 1455 of yacc.c */ -#line 1361 "program_parse.y" +#line 1362 "program_parse.y" { memcpy((yyval.state), (yyvsp[(2) - (2)].state), sizeof((yyval.state))); ;} break; case 153: /* Line 1455 of yacc.c */ -#line 1365 "program_parse.y" +#line 1366 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_MATERIAL; @@ -3655,7 +3656,7 @@ yyreduce: case 154: /* Line 1455 of yacc.c */ -#line 1374 "program_parse.y" +#line 1375 "program_parse.y" { (yyval.integer) = (yyvsp[(1) - (1)].integer); ;} @@ -3664,7 +3665,7 @@ yyreduce: case 155: /* Line 1455 of yacc.c */ -#line 1378 "program_parse.y" +#line 1379 "program_parse.y" { (yyval.integer) = STATE_EMISSION; ;} @@ -3673,7 +3674,7 @@ yyreduce: case 156: /* Line 1455 of yacc.c */ -#line 1382 "program_parse.y" +#line 1383 "program_parse.y" { (yyval.integer) = STATE_SHININESS; ;} @@ -3682,7 +3683,7 @@ yyreduce: case 157: /* Line 1455 of yacc.c */ -#line 1388 "program_parse.y" +#line 1389 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_LIGHT; @@ -3694,7 +3695,7 @@ yyreduce: case 158: /* Line 1455 of yacc.c */ -#line 1397 "program_parse.y" +#line 1398 "program_parse.y" { (yyval.integer) = (yyvsp[(1) - (1)].integer); ;} @@ -3703,7 +3704,7 @@ yyreduce: case 159: /* Line 1455 of yacc.c */ -#line 1401 "program_parse.y" +#line 1402 "program_parse.y" { (yyval.integer) = STATE_POSITION; ;} @@ -3712,7 +3713,7 @@ yyreduce: case 160: /* Line 1455 of yacc.c */ -#line 1405 "program_parse.y" +#line 1406 "program_parse.y" { if (!state->ctx->Extensions.EXT_point_parameters) { yyerror(& (yylsp[(1) - (1)]), state, "GL_ARB_point_parameters not supported"); @@ -3726,7 +3727,7 @@ yyreduce: case 161: /* Line 1455 of yacc.c */ -#line 1414 "program_parse.y" +#line 1415 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (2)].integer); ;} @@ -3735,7 +3736,7 @@ yyreduce: case 162: /* Line 1455 of yacc.c */ -#line 1418 "program_parse.y" +#line 1419 "program_parse.y" { (yyval.integer) = STATE_HALF_VECTOR; ;} @@ -3744,7 +3745,7 @@ yyreduce: case 163: /* Line 1455 of yacc.c */ -#line 1424 "program_parse.y" +#line 1425 "program_parse.y" { (yyval.integer) = STATE_SPOT_DIRECTION; ;} @@ -3753,7 +3754,7 @@ yyreduce: case 164: /* Line 1455 of yacc.c */ -#line 1430 "program_parse.y" +#line 1431 "program_parse.y" { (yyval.state)[0] = (yyvsp[(2) - (2)].state)[0]; (yyval.state)[1] = (yyvsp[(2) - (2)].state)[1]; @@ -3763,7 +3764,7 @@ yyreduce: case 165: /* Line 1455 of yacc.c */ -#line 1437 "program_parse.y" +#line 1438 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_LIGHTMODEL_AMBIENT; @@ -3773,7 +3774,7 @@ yyreduce: case 166: /* Line 1455 of yacc.c */ -#line 1442 "program_parse.y" +#line 1443 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_LIGHTMODEL_SCENECOLOR; @@ -3784,7 +3785,7 @@ yyreduce: case 167: /* Line 1455 of yacc.c */ -#line 1450 "program_parse.y" +#line 1451 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_LIGHTPROD; @@ -3797,7 +3798,7 @@ yyreduce: case 169: /* Line 1455 of yacc.c */ -#line 1462 "program_parse.y" +#line 1463 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = (yyvsp[(3) - (3)].integer); @@ -3808,7 +3809,7 @@ yyreduce: case 170: /* Line 1455 of yacc.c */ -#line 1470 "program_parse.y" +#line 1471 "program_parse.y" { (yyval.integer) = STATE_TEXENV_COLOR; ;} @@ -3817,7 +3818,7 @@ yyreduce: case 171: /* Line 1455 of yacc.c */ -#line 1476 "program_parse.y" +#line 1477 "program_parse.y" { (yyval.integer) = STATE_AMBIENT; ;} @@ -3826,7 +3827,7 @@ yyreduce: case 172: /* Line 1455 of yacc.c */ -#line 1480 "program_parse.y" +#line 1481 "program_parse.y" { (yyval.integer) = STATE_DIFFUSE; ;} @@ -3835,7 +3836,7 @@ yyreduce: case 173: /* Line 1455 of yacc.c */ -#line 1484 "program_parse.y" +#line 1485 "program_parse.y" { (yyval.integer) = STATE_SPECULAR; ;} @@ -3844,7 +3845,7 @@ yyreduce: case 174: /* Line 1455 of yacc.c */ -#line 1490 "program_parse.y" +#line 1491 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxLights) { yyerror(& (yylsp[(1) - (1)]), state, "invalid light selector"); @@ -3858,7 +3859,7 @@ yyreduce: case 175: /* Line 1455 of yacc.c */ -#line 1501 "program_parse.y" +#line 1502 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_TEXGEN; @@ -3870,7 +3871,7 @@ yyreduce: case 176: /* Line 1455 of yacc.c */ -#line 1510 "program_parse.y" +#line 1511 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_EYE_S; ;} @@ -3879,7 +3880,7 @@ yyreduce: case 177: /* Line 1455 of yacc.c */ -#line 1514 "program_parse.y" +#line 1515 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_OBJECT_S; ;} @@ -3888,7 +3889,7 @@ yyreduce: case 178: /* Line 1455 of yacc.c */ -#line 1519 "program_parse.y" +#line 1520 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_EYE_S - STATE_TEXGEN_EYE_S; ;} @@ -3897,7 +3898,7 @@ yyreduce: case 179: /* Line 1455 of yacc.c */ -#line 1523 "program_parse.y" +#line 1524 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_EYE_T - STATE_TEXGEN_EYE_S; ;} @@ -3906,7 +3907,7 @@ yyreduce: case 180: /* Line 1455 of yacc.c */ -#line 1527 "program_parse.y" +#line 1528 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_EYE_R - STATE_TEXGEN_EYE_S; ;} @@ -3915,7 +3916,7 @@ yyreduce: case 181: /* Line 1455 of yacc.c */ -#line 1531 "program_parse.y" +#line 1532 "program_parse.y" { (yyval.integer) = STATE_TEXGEN_EYE_Q - STATE_TEXGEN_EYE_S; ;} @@ -3924,7 +3925,7 @@ yyreduce: case 182: /* Line 1455 of yacc.c */ -#line 1537 "program_parse.y" +#line 1538 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = (yyvsp[(2) - (2)].integer); @@ -3934,7 +3935,7 @@ yyreduce: case 183: /* Line 1455 of yacc.c */ -#line 1544 "program_parse.y" +#line 1545 "program_parse.y" { (yyval.integer) = STATE_FOG_COLOR; ;} @@ -3943,7 +3944,7 @@ yyreduce: case 184: /* Line 1455 of yacc.c */ -#line 1548 "program_parse.y" +#line 1549 "program_parse.y" { (yyval.integer) = STATE_FOG_PARAMS; ;} @@ -3952,7 +3953,7 @@ yyreduce: case 185: /* Line 1455 of yacc.c */ -#line 1554 "program_parse.y" +#line 1555 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_CLIPPLANE; @@ -3963,7 +3964,7 @@ yyreduce: case 186: /* Line 1455 of yacc.c */ -#line 1562 "program_parse.y" +#line 1563 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxClipPlanes) { yyerror(& (yylsp[(1) - (1)]), state, "invalid clip plane selector"); @@ -3977,7 +3978,7 @@ yyreduce: case 187: /* Line 1455 of yacc.c */ -#line 1573 "program_parse.y" +#line 1574 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = (yyvsp[(2) - (2)].integer); @@ -3987,7 +3988,7 @@ yyreduce: case 188: /* Line 1455 of yacc.c */ -#line 1580 "program_parse.y" +#line 1581 "program_parse.y" { (yyval.integer) = STATE_POINT_SIZE; ;} @@ -3996,7 +3997,7 @@ yyreduce: case 189: /* Line 1455 of yacc.c */ -#line 1584 "program_parse.y" +#line 1585 "program_parse.y" { (yyval.integer) = STATE_POINT_ATTENUATION; ;} @@ -4005,7 +4006,7 @@ yyreduce: case 190: /* Line 1455 of yacc.c */ -#line 1590 "program_parse.y" +#line 1591 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (5)].state)[0]; (yyval.state)[1] = (yyvsp[(1) - (5)].state)[1]; @@ -4018,7 +4019,7 @@ yyreduce: case 191: /* Line 1455 of yacc.c */ -#line 1600 "program_parse.y" +#line 1601 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (2)].state)[0]; (yyval.state)[1] = (yyvsp[(1) - (2)].state)[1]; @@ -4031,7 +4032,7 @@ yyreduce: case 192: /* Line 1455 of yacc.c */ -#line 1610 "program_parse.y" +#line 1611 "program_parse.y" { (yyval.state)[2] = 0; (yyval.state)[3] = 3; @@ -4041,7 +4042,7 @@ yyreduce: case 193: /* Line 1455 of yacc.c */ -#line 1615 "program_parse.y" +#line 1616 "program_parse.y" { /* It seems logical that the matrix row range specifier would have * to specify a range or more than one row (i.e., $5 > $3). @@ -4062,7 +4063,7 @@ yyreduce: case 194: /* Line 1455 of yacc.c */ -#line 1633 "program_parse.y" +#line 1634 "program_parse.y" { (yyval.state)[0] = (yyvsp[(2) - (3)].state)[0]; (yyval.state)[1] = (yyvsp[(2) - (3)].state)[1]; @@ -4073,7 +4074,7 @@ yyreduce: case 195: /* Line 1455 of yacc.c */ -#line 1641 "program_parse.y" +#line 1642 "program_parse.y" { (yyval.integer) = 0; ;} @@ -4082,7 +4083,7 @@ yyreduce: case 196: /* Line 1455 of yacc.c */ -#line 1645 "program_parse.y" +#line 1646 "program_parse.y" { (yyval.integer) = (yyvsp[(1) - (1)].integer); ;} @@ -4091,7 +4092,7 @@ yyreduce: case 197: /* Line 1455 of yacc.c */ -#line 1651 "program_parse.y" +#line 1652 "program_parse.y" { (yyval.integer) = STATE_MATRIX_INVERSE; ;} @@ -4100,7 +4101,7 @@ yyreduce: case 198: /* Line 1455 of yacc.c */ -#line 1655 "program_parse.y" +#line 1656 "program_parse.y" { (yyval.integer) = STATE_MATRIX_TRANSPOSE; ;} @@ -4109,7 +4110,7 @@ yyreduce: case 199: /* Line 1455 of yacc.c */ -#line 1659 "program_parse.y" +#line 1660 "program_parse.y" { (yyval.integer) = STATE_MATRIX_INVTRANS; ;} @@ -4118,7 +4119,7 @@ yyreduce: case 200: /* Line 1455 of yacc.c */ -#line 1665 "program_parse.y" +#line 1666 "program_parse.y" { if ((yyvsp[(1) - (1)].integer) > 3) { yyerror(& (yylsp[(1) - (1)]), state, "invalid matrix row reference"); @@ -4132,7 +4133,7 @@ yyreduce: case 201: /* Line 1455 of yacc.c */ -#line 1676 "program_parse.y" +#line 1677 "program_parse.y" { (yyval.state)[0] = STATE_MODELVIEW_MATRIX; (yyval.state)[1] = (yyvsp[(2) - (2)].integer); @@ -4142,7 +4143,7 @@ yyreduce: case 202: /* Line 1455 of yacc.c */ -#line 1681 "program_parse.y" +#line 1682 "program_parse.y" { (yyval.state)[0] = STATE_PROJECTION_MATRIX; (yyval.state)[1] = 0; @@ -4152,7 +4153,7 @@ yyreduce: case 203: /* Line 1455 of yacc.c */ -#line 1686 "program_parse.y" +#line 1687 "program_parse.y" { (yyval.state)[0] = STATE_MVP_MATRIX; (yyval.state)[1] = 0; @@ -4162,7 +4163,7 @@ yyreduce: case 204: /* Line 1455 of yacc.c */ -#line 1691 "program_parse.y" +#line 1692 "program_parse.y" { (yyval.state)[0] = STATE_TEXTURE_MATRIX; (yyval.state)[1] = (yyvsp[(2) - (2)].integer); @@ -4172,7 +4173,7 @@ yyreduce: case 205: /* Line 1455 of yacc.c */ -#line 1696 "program_parse.y" +#line 1697 "program_parse.y" { yyerror(& (yylsp[(1) - (4)]), state, "GL_ARB_matrix_palette not supported"); YYERROR; @@ -4182,7 +4183,7 @@ yyreduce: case 206: /* Line 1455 of yacc.c */ -#line 1701 "program_parse.y" +#line 1702 "program_parse.y" { (yyval.state)[0] = STATE_PROGRAM_MATRIX; (yyval.state)[1] = (yyvsp[(3) - (4)].integer); @@ -4192,7 +4193,7 @@ yyreduce: case 207: /* Line 1455 of yacc.c */ -#line 1708 "program_parse.y" +#line 1709 "program_parse.y" { (yyval.integer) = 0; ;} @@ -4201,7 +4202,7 @@ yyreduce: case 208: /* Line 1455 of yacc.c */ -#line 1712 "program_parse.y" +#line 1713 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (3)].integer); ;} @@ -4210,7 +4211,7 @@ yyreduce: case 209: /* Line 1455 of yacc.c */ -#line 1717 "program_parse.y" +#line 1718 "program_parse.y" { /* Since GL_ARB_vertex_blend isn't supported, only modelview matrix * zero is valid. @@ -4227,7 +4228,7 @@ yyreduce: case 210: /* Line 1455 of yacc.c */ -#line 1730 "program_parse.y" +#line 1731 "program_parse.y" { /* Since GL_ARB_matrix_palette isn't supported, just let any value * through here. The error will be generated later. @@ -4239,7 +4240,7 @@ yyreduce: case 211: /* Line 1455 of yacc.c */ -#line 1738 "program_parse.y" +#line 1739 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxProgramMatrices) { yyerror(& (yylsp[(1) - (1)]), state, "invalid program matrix selector"); @@ -4253,7 +4254,7 @@ yyreduce: case 212: /* Line 1455 of yacc.c */ -#line 1749 "program_parse.y" +#line 1750 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = STATE_DEPTH_RANGE; @@ -4263,7 +4264,7 @@ yyreduce: case 217: /* Line 1455 of yacc.c */ -#line 1761 "program_parse.y" +#line 1762 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = state->state_param_enum; @@ -4276,7 +4277,7 @@ yyreduce: case 218: /* Line 1455 of yacc.c */ -#line 1771 "program_parse.y" +#line 1772 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (1)].integer); (yyval.state)[1] = (yyvsp[(1) - (1)].integer); @@ -4286,7 +4287,7 @@ yyreduce: case 219: /* Line 1455 of yacc.c */ -#line 1776 "program_parse.y" +#line 1777 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (3)].integer); (yyval.state)[1] = (yyvsp[(3) - (3)].integer); @@ -4296,7 +4297,7 @@ yyreduce: case 220: /* Line 1455 of yacc.c */ -#line 1783 "program_parse.y" +#line 1784 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = state->state_param_enum; @@ -4309,7 +4310,7 @@ yyreduce: case 221: /* Line 1455 of yacc.c */ -#line 1793 "program_parse.y" +#line 1794 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = state->state_param_enum; @@ -4322,7 +4323,7 @@ yyreduce: case 222: /* Line 1455 of yacc.c */ -#line 1802 "program_parse.y" +#line 1803 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (1)].integer); (yyval.state)[1] = (yyvsp[(1) - (1)].integer); @@ -4332,7 +4333,7 @@ yyreduce: case 223: /* Line 1455 of yacc.c */ -#line 1807 "program_parse.y" +#line 1808 "program_parse.y" { (yyval.state)[0] = (yyvsp[(1) - (3)].integer); (yyval.state)[1] = (yyvsp[(3) - (3)].integer); @@ -4342,7 +4343,7 @@ yyreduce: case 224: /* Line 1455 of yacc.c */ -#line 1814 "program_parse.y" +#line 1815 "program_parse.y" { memset((yyval.state), 0, sizeof((yyval.state))); (yyval.state)[0] = state->state_param_enum; @@ -4355,7 +4356,7 @@ yyreduce: case 225: /* Line 1455 of yacc.c */ -#line 1824 "program_parse.y" +#line 1825 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->limits->MaxEnvParams) { yyerror(& (yylsp[(1) - (1)]), state, "invalid environment parameter reference"); @@ -4368,7 +4369,7 @@ yyreduce: case 226: /* Line 1455 of yacc.c */ -#line 1834 "program_parse.y" +#line 1835 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->limits->MaxLocalParams) { yyerror(& (yylsp[(1) - (1)]), state, "invalid local parameter reference"); @@ -4381,7 +4382,7 @@ yyreduce: case 231: /* Line 1455 of yacc.c */ -#line 1849 "program_parse.y" +#line 1850 "program_parse.y" { (yyval.vector).count = 4; (yyval.vector).data[0] = (yyvsp[(1) - (1)].real); @@ -4394,7 +4395,7 @@ yyreduce: case 232: /* Line 1455 of yacc.c */ -#line 1859 "program_parse.y" +#line 1860 "program_parse.y" { (yyval.vector).count = 1; (yyval.vector).data[0] = (yyvsp[(1) - (1)].real); @@ -4407,7 +4408,7 @@ yyreduce: case 233: /* Line 1455 of yacc.c */ -#line 1867 "program_parse.y" +#line 1868 "program_parse.y" { (yyval.vector).count = 1; (yyval.vector).data[0] = (float) (yyvsp[(1) - (1)].integer); @@ -4420,7 +4421,7 @@ yyreduce: case 234: /* Line 1455 of yacc.c */ -#line 1877 "program_parse.y" +#line 1878 "program_parse.y" { (yyval.vector).count = 4; (yyval.vector).data[0] = (yyvsp[(2) - (3)].real); @@ -4433,7 +4434,7 @@ yyreduce: case 235: /* Line 1455 of yacc.c */ -#line 1885 "program_parse.y" +#line 1886 "program_parse.y" { (yyval.vector).count = 4; (yyval.vector).data[0] = (yyvsp[(2) - (5)].real); @@ -4446,7 +4447,7 @@ yyreduce: case 236: /* Line 1455 of yacc.c */ -#line 1894 "program_parse.y" +#line 1895 "program_parse.y" { (yyval.vector).count = 4; (yyval.vector).data[0] = (yyvsp[(2) - (7)].real); @@ -4459,7 +4460,7 @@ yyreduce: case 237: /* Line 1455 of yacc.c */ -#line 1903 "program_parse.y" +#line 1904 "program_parse.y" { (yyval.vector).count = 4; (yyval.vector).data[0] = (yyvsp[(2) - (9)].real); @@ -4472,7 +4473,7 @@ yyreduce: case 238: /* Line 1455 of yacc.c */ -#line 1913 "program_parse.y" +#line 1914 "program_parse.y" { (yyval.real) = ((yyvsp[(1) - (2)].negate)) ? -(yyvsp[(2) - (2)].real) : (yyvsp[(2) - (2)].real); ;} @@ -4481,7 +4482,7 @@ yyreduce: case 239: /* Line 1455 of yacc.c */ -#line 1917 "program_parse.y" +#line 1918 "program_parse.y" { (yyval.real) = (float)(((yyvsp[(1) - (2)].negate)) ? -(yyvsp[(2) - (2)].integer) : (yyvsp[(2) - (2)].integer)); ;} @@ -4490,35 +4491,35 @@ yyreduce: case 240: /* Line 1455 of yacc.c */ -#line 1922 "program_parse.y" +#line 1923 "program_parse.y" { (yyval.negate) = FALSE; ;} break; case 241: /* Line 1455 of yacc.c */ -#line 1923 "program_parse.y" +#line 1924 "program_parse.y" { (yyval.negate) = TRUE; ;} break; case 242: /* Line 1455 of yacc.c */ -#line 1924 "program_parse.y" +#line 1925 "program_parse.y" { (yyval.negate) = FALSE; ;} break; case 243: /* Line 1455 of yacc.c */ -#line 1927 "program_parse.y" +#line 1928 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (2)].integer); ;} break; case 245: /* Line 1455 of yacc.c */ -#line 1931 "program_parse.y" +#line 1932 "program_parse.y" { /* NV_fragment_program_option defines the size qualifiers in a * fairly broken way. "SHORT" or "LONG" can optionally be used @@ -4557,7 +4558,7 @@ yyreduce: case 246: /* Line 1455 of yacc.c */ -#line 1965 "program_parse.y" +#line 1966 "program_parse.y" { ;} break; @@ -4565,14 +4566,14 @@ yyreduce: case 247: /* Line 1455 of yacc.c */ -#line 1969 "program_parse.y" +#line 1970 "program_parse.y" { (yyval.integer) = (yyvsp[(1) - (1)].integer); ;} break; case 249: /* Line 1455 of yacc.c */ -#line 1973 "program_parse.y" +#line 1974 "program_parse.y" { if (!declare_variable(state, (yyvsp[(3) - (3)].string), (yyvsp[(0) - (3)].integer), & (yylsp[(3) - (3)]))) { free((yyvsp[(3) - (3)].string)); @@ -4584,7 +4585,7 @@ yyreduce: case 250: /* Line 1455 of yacc.c */ -#line 1980 "program_parse.y" +#line 1981 "program_parse.y" { if (!declare_variable(state, (yyvsp[(1) - (1)].string), (yyvsp[(0) - (1)].integer), & (yylsp[(1) - (1)]))) { free((yyvsp[(1) - (1)].string)); @@ -4596,7 +4597,7 @@ yyreduce: case 251: /* Line 1455 of yacc.c */ -#line 1989 "program_parse.y" +#line 1990 "program_parse.y" { struct asm_symbol *const s = declare_variable(state, (yyvsp[(3) - (5)].string), at_output, & (yylsp[(3) - (5)])); @@ -4613,7 +4614,7 @@ yyreduce: case 252: /* Line 1455 of yacc.c */ -#line 2003 "program_parse.y" +#line 2004 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.result) = VERT_RESULT_HPOS; @@ -4627,7 +4628,7 @@ yyreduce: case 253: /* Line 1455 of yacc.c */ -#line 2012 "program_parse.y" +#line 2013 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.result) = VERT_RESULT_FOGC; @@ -4641,7 +4642,7 @@ yyreduce: case 254: /* Line 1455 of yacc.c */ -#line 2021 "program_parse.y" +#line 2022 "program_parse.y" { (yyval.result) = (yyvsp[(2) - (2)].result); ;} @@ -4650,7 +4651,7 @@ yyreduce: case 255: /* Line 1455 of yacc.c */ -#line 2025 "program_parse.y" +#line 2026 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.result) = VERT_RESULT_PSIZ; @@ -4664,7 +4665,7 @@ yyreduce: case 256: /* Line 1455 of yacc.c */ -#line 2034 "program_parse.y" +#line 2035 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.result) = VERT_RESULT_TEX0 + (yyvsp[(3) - (3)].integer); @@ -4678,7 +4679,7 @@ yyreduce: case 257: /* Line 1455 of yacc.c */ -#line 2043 "program_parse.y" +#line 2044 "program_parse.y" { if (state->mode == ARB_fragment) { (yyval.result) = FRAG_RESULT_DEPTH; @@ -4692,7 +4693,7 @@ yyreduce: case 258: /* Line 1455 of yacc.c */ -#line 2054 "program_parse.y" +#line 2055 "program_parse.y" { (yyval.result) = (yyvsp[(2) - (3)].integer) + (yyvsp[(3) - (3)].integer); ;} @@ -4701,7 +4702,7 @@ yyreduce: case 259: /* Line 1455 of yacc.c */ -#line 2060 "program_parse.y" +#line 2061 "program_parse.y" { (yyval.integer) = (state->mode == ARB_vertex) ? VERT_RESULT_COL0 @@ -4712,7 +4713,7 @@ yyreduce: case 260: /* Line 1455 of yacc.c */ -#line 2066 "program_parse.y" +#line 2067 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.integer) = VERT_RESULT_COL0; @@ -4726,7 +4727,7 @@ yyreduce: case 261: /* Line 1455 of yacc.c */ -#line 2075 "program_parse.y" +#line 2076 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.integer) = VERT_RESULT_BFC0; @@ -4740,7 +4741,7 @@ yyreduce: case 262: /* Line 1455 of yacc.c */ -#line 2086 "program_parse.y" +#line 2087 "program_parse.y" { (yyval.integer) = 0; ;} @@ -4749,7 +4750,7 @@ yyreduce: case 263: /* Line 1455 of yacc.c */ -#line 2090 "program_parse.y" +#line 2091 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.integer) = 0; @@ -4763,7 +4764,7 @@ yyreduce: case 264: /* Line 1455 of yacc.c */ -#line 2099 "program_parse.y" +#line 2100 "program_parse.y" { if (state->mode == ARB_vertex) { (yyval.integer) = 1; @@ -4777,91 +4778,91 @@ yyreduce: case 265: /* Line 1455 of yacc.c */ -#line 2109 "program_parse.y" +#line 2110 "program_parse.y" { (yyval.integer) = 0; ;} break; case 266: /* Line 1455 of yacc.c */ -#line 2110 "program_parse.y" +#line 2111 "program_parse.y" { (yyval.integer) = 0; ;} break; case 267: /* Line 1455 of yacc.c */ -#line 2111 "program_parse.y" +#line 2112 "program_parse.y" { (yyval.integer) = 1; ;} break; case 268: /* Line 1455 of yacc.c */ -#line 2114 "program_parse.y" +#line 2115 "program_parse.y" { (yyval.integer) = 0; ;} break; case 269: /* Line 1455 of yacc.c */ -#line 2115 "program_parse.y" +#line 2116 "program_parse.y" { (yyval.integer) = 0; ;} break; case 270: /* Line 1455 of yacc.c */ -#line 2116 "program_parse.y" +#line 2117 "program_parse.y" { (yyval.integer) = 1; ;} break; case 271: /* Line 1455 of yacc.c */ -#line 2119 "program_parse.y" +#line 2120 "program_parse.y" { (yyval.integer) = 0; ;} break; case 272: /* Line 1455 of yacc.c */ -#line 2120 "program_parse.y" +#line 2121 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (3)].integer); ;} break; case 273: /* Line 1455 of yacc.c */ -#line 2123 "program_parse.y" +#line 2124 "program_parse.y" { (yyval.integer) = 0; ;} break; case 274: /* Line 1455 of yacc.c */ -#line 2124 "program_parse.y" +#line 2125 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (3)].integer); ;} break; case 275: /* Line 1455 of yacc.c */ -#line 2127 "program_parse.y" +#line 2128 "program_parse.y" { (yyval.integer) = 0; ;} break; case 276: /* Line 1455 of yacc.c */ -#line 2128 "program_parse.y" +#line 2129 "program_parse.y" { (yyval.integer) = (yyvsp[(2) - (3)].integer); ;} break; case 277: /* Line 1455 of yacc.c */ -#line 2132 "program_parse.y" +#line 2133 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxTextureCoordUnits) { yyerror(& (yylsp[(1) - (1)]), state, "invalid texture coordinate unit selector"); @@ -4875,7 +4876,7 @@ yyreduce: case 278: /* Line 1455 of yacc.c */ -#line 2143 "program_parse.y" +#line 2144 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxTextureImageUnits) { yyerror(& (yylsp[(1) - (1)]), state, "invalid texture image unit selector"); @@ -4889,7 +4890,7 @@ yyreduce: case 279: /* Line 1455 of yacc.c */ -#line 2154 "program_parse.y" +#line 2155 "program_parse.y" { if ((unsigned) (yyvsp[(1) - (1)].integer) >= state->MaxTextureUnits) { yyerror(& (yylsp[(1) - (1)]), state, "invalid texture unit selector"); @@ -4903,7 +4904,7 @@ yyreduce: case 280: /* Line 1455 of yacc.c */ -#line 2165 "program_parse.y" +#line 2166 "program_parse.y" { struct asm_symbol *exist = (struct asm_symbol *) _mesa_symbol_table_find_symbol(state->st, 0, (yyvsp[(2) - (4)].string)); @@ -4932,7 +4933,7 @@ yyreduce: /* Line 1455 of yacc.c */ -#line 4936 "program_parse.tab.c" +#line 4937 "program_parse.tab.c" default: break; } YY_SYMBOL_PRINT ("-> $$ =", yyr1[yyn], &yyval, &yyloc); @@ -5151,7 +5152,7 @@ yyreturn: /* Line 1675 of yacc.c */ -#line 2194 "program_parse.y" +#line 2195 "program_parse.y" void @@ -5258,7 +5259,9 @@ set_dst_reg(struct prog_dst_register *r, gl_register_file file, GLint index) const GLint maxIndex = 1 << INST_INDEX_BITS; const GLint minIndex = 0; ASSERT(index >= minIndex); + (void) minIndex; ASSERT(index <= maxIndex); + (void) maxIndex; ASSERT(file == PROGRAM_TEMPORARY || file == PROGRAM_ADDRESS || file == PROGRAM_OUTPUT); @@ -5299,7 +5302,9 @@ set_src_reg_swz(struct asm_src_register *r, gl_register_file file, GLint index, const GLint minIndex = -(1 << INST_INDEX_BITS); ASSERT(file < PROGRAM_FILE_MAX); ASSERT(index >= minIndex); + (void) minIndex; ASSERT(index <= maxIndex); + (void) maxIndex; memset(r, 0, sizeof(*r)); r->Base.File = file; r->Base.Index = index; @@ -5472,9 +5477,12 @@ initialize_symbol_from_param(struct gl_program *prog, assert((state_tokens[1] == STATE_ENV) || (state_tokens[1] == STATE_LOCAL)); + /* + * The param type is STATE_VAR. The program parameter entry will + * effectively be a pointer into the LOCAL or ENV parameter array. + */ param_var->type = at_param; - param_var->param_binding_type = (state_tokens[1] == STATE_ENV) - ? PROGRAM_ENV_PARAM : PROGRAM_LOCAL_PARAM; + param_var->param_binding_type = PROGRAM_STATE_VAR; /* If we are adding a STATE_ENV or STATE_LOCAL that has multiple elements, * we need to unroll it and call add_state_reference() for each row @@ -5513,23 +5521,28 @@ initialize_symbol_from_param(struct gl_program *prog, * \param param_var returns info about the parameter/constant's location, * binding, type, etc. * \param vec the vector/constant to add + * \param allowSwizzle if true, try to consolidate constants which only differ + * by a swizzle. We don't want to do this when building + * arrays of constants that may be indexed indirectly. * \return index of the constant in the parameter list. */ int initialize_symbol_from_const(struct gl_program *prog, struct asm_symbol *param_var, - const struct asm_vector *vec) + const struct asm_vector *vec, + GLboolean allowSwizzle) { unsigned swizzle; const int idx = _mesa_add_unnamed_constant(prog->Parameters, - vec->data, vec->count, &swizzle); + vec->data, vec->count, + allowSwizzle ? &swizzle : NULL); param_var->type = at_param; param_var->param_binding_type = PROGRAM_CONSTANT; if (param_var->param_binding_begin == ~0U) { param_var->param_binding_begin = idx; - param_var->param_binding_swizzle = swizzle; + param_var->param_binding_swizzle = allowSwizzle ? swizzle : SWIZZLE_XYZW; } param_var->param_binding_length++; diff --git a/src/mesa/shader/program_parse.tab.h b/src/mesa/shader/program_parse.tab.h index d8712b7268..045241d9e7 100644 --- a/src/mesa/shader/program_parse.tab.h +++ b/src/mesa/shader/program_parse.tab.h @@ -154,7 +154,7 @@ typedef union YYSTYPE { /* Line 1676 of yacc.c */ -#line 125 "program_parse.y" +#line 126 "program_parse.y" struct asm_instruction *inst; struct asm_symbol *sym; diff --git a/src/mesa/shader/program_parse.y b/src/mesa/shader/program_parse.y index 3f1a350c24..5c5d8d7590 100644 --- a/src/mesa/shader/program_parse.y +++ b/src/mesa/shader/program_parse.y @@ -52,7 +52,8 @@ static int initialize_symbol_from_param(struct gl_program *prog, struct asm_symbol *param_var, const gl_state_index tokens[STATE_LENGTH]); static int initialize_symbol_from_const(struct gl_program *prog, - struct asm_symbol *param_var, const struct asm_vector *vec); + struct asm_symbol *param_var, const struct asm_vector *vec, + GLboolean allowSwizzle); static int yyparse(struct asm_parser_state *state); @@ -589,7 +590,7 @@ scalarUse: srcReg scalarSuffix memset(& temp_sym, 0, sizeof(temp_sym)); temp_sym.param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & temp_sym, & $1); + initialize_symbol_from_const(state->prog, & temp_sym, & $1, GL_TRUE); set_src_reg_swz(& $$, PROGRAM_CONSTANT, temp_sym.param_binding_begin, @@ -1300,7 +1301,7 @@ paramSingleItemDecl: stateSingleItem { memset(& $$, 0, sizeof($$)); $$.param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & $$, & $1); + initialize_symbol_from_const(state->prog, & $$, & $1, GL_TRUE); } ; @@ -1320,7 +1321,7 @@ paramSingleItemUse: stateSingleItem { memset(& $$, 0, sizeof($$)); $$.param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & $$, & $1); + initialize_symbol_from_const(state->prog, & $$, & $1, GL_TRUE); } ; @@ -1340,7 +1341,7 @@ paramMultipleItem: stateMultipleItem { memset(& $$, 0, sizeof($$)); $$.param_binding_begin = ~0; - initialize_symbol_from_const(state->prog, & $$, & $1); + initialize_symbol_from_const(state->prog, & $$, & $1, GL_FALSE); } ; @@ -2297,7 +2298,9 @@ set_dst_reg(struct prog_dst_register *r, gl_register_file file, GLint index) const GLint maxIndex = 1 << INST_INDEX_BITS; const GLint minIndex = 0; ASSERT(index >= minIndex); + (void) minIndex; ASSERT(index <= maxIndex); + (void) maxIndex; ASSERT(file == PROGRAM_TEMPORARY || file == PROGRAM_ADDRESS || file == PROGRAM_OUTPUT); @@ -2338,7 +2341,9 @@ set_src_reg_swz(struct asm_src_register *r, gl_register_file file, GLint index, const GLint minIndex = -(1 << INST_INDEX_BITS); ASSERT(file < PROGRAM_FILE_MAX); ASSERT(index >= minIndex); + (void) minIndex; ASSERT(index <= maxIndex); + (void) maxIndex; memset(r, 0, sizeof(*r)); r->Base.File = file; r->Base.Index = index; @@ -2511,9 +2516,12 @@ initialize_symbol_from_param(struct gl_program *prog, assert((state_tokens[1] == STATE_ENV) || (state_tokens[1] == STATE_LOCAL)); + /* + * The param type is STATE_VAR. The program parameter entry will + * effectively be a pointer into the LOCAL or ENV parameter array. + */ param_var->type = at_param; - param_var->param_binding_type = (state_tokens[1] == STATE_ENV) - ? PROGRAM_ENV_PARAM : PROGRAM_LOCAL_PARAM; + param_var->param_binding_type = PROGRAM_STATE_VAR; /* If we are adding a STATE_ENV or STATE_LOCAL that has multiple elements, * we need to unroll it and call add_state_reference() for each row @@ -2552,23 +2560,28 @@ initialize_symbol_from_param(struct gl_program *prog, * \param param_var returns info about the parameter/constant's location, * binding, type, etc. * \param vec the vector/constant to add + * \param allowSwizzle if true, try to consolidate constants which only differ + * by a swizzle. We don't want to do this when building + * arrays of constants that may be indexed indirectly. * \return index of the constant in the parameter list. */ int initialize_symbol_from_const(struct gl_program *prog, struct asm_symbol *param_var, - const struct asm_vector *vec) + const struct asm_vector *vec, + GLboolean allowSwizzle) { unsigned swizzle; const int idx = _mesa_add_unnamed_constant(prog->Parameters, - vec->data, vec->count, &swizzle); + vec->data, vec->count, + allowSwizzle ? &swizzle : NULL); param_var->type = at_param; param_var->param_binding_type = PROGRAM_CONSTANT; if (param_var->param_binding_begin == ~0U) { param_var->param_binding_begin = idx; - param_var->param_binding_swizzle = swizzle; + param_var->param_binding_swizzle = allowSwizzle ? swizzle : SWIZZLE_XYZW; } param_var->param_binding_length++; diff --git a/src/mesa/shader/slang/slang_codegen.c b/src/mesa/shader/slang/slang_codegen.c index b62cfc36af..372a9acdd0 100644 --- a/src/mesa/shader/slang/slang_codegen.c +++ b/src/mesa/shader/slang/slang_codegen.c @@ -4249,14 +4249,15 @@ _slang_gen_assignment(slang_assemble_ctx * A, slang_operation *oper) if (oper->children[0].type == SLANG_OPER_IDENTIFIER) { /* Check that var is writeable */ + const char *varName = (char *) oper->children[0].a_id; slang_variable *var = _slang_variable_locate(oper->children[0].locals, oper->children[0].a_id, GL_TRUE); if (!var) { - slang_info_log_error(A->log, "undefined variable '%s'", - (char *) oper->children[0].a_id); + slang_info_log_error(A->log, "undefined variable '%s'", varName); return NULL; } + if (var->type.qualifier == SLANG_QUAL_CONST || var->type.qualifier == SLANG_QUAL_ATTRIBUTE || var->type.qualifier == SLANG_QUAL_UNIFORM || @@ -4264,7 +4265,7 @@ _slang_gen_assignment(slang_assemble_ctx * A, slang_operation *oper) A->program->Target == GL_FRAGMENT_PROGRAM_ARB)) { slang_info_log_error(A->log, "illegal assignment to read-only variable '%s'", - (char *) oper->children[0].a_id); + varName); return NULL; } diff --git a/src/mesa/sources.mak b/src/mesa/sources.mak index ba56df5418..c42f61af5e 100644 --- a/src/mesa/sources.mak +++ b/src/mesa/sources.mak @@ -81,6 +81,7 @@ MAIN_SOURCES = \ main/texstate.c \ main/texstore.c \ main/varray.c \ + main/version.c \ main/viewport.c \ main/vtxfmt.c @@ -191,6 +192,7 @@ STATETRACKER_SOURCES = \ state_tracker/st_cb_blit.c \ state_tracker/st_cb_bufferobjects.c \ state_tracker/st_cb_clear.c \ + state_tracker/st_cb_condrender.c \ state_tracker/st_cb_flush.c \ state_tracker/st_cb_drawpixels.c \ state_tracker/st_cb_fbo.c \ diff --git a/src/mesa/state_tracker/st_atom_sampler.c b/src/mesa/state_tracker/st_atom_sampler.c index d6e3a3e561..7b84a86ba4 100644 --- a/src/mesa/state_tracker/st_atom_sampler.c +++ b/src/mesa/state_tracker/st_atom_sampler.c @@ -208,15 +208,11 @@ update_samplers(struct st_context *st) assert(sampler->min_lod <= sampler->max_lod); } - xlate_border_color(texobj->BorderColor, + xlate_border_color(texobj->BorderColor.f, teximg ? teximg->_BaseFormat : GL_RGBA, sampler->border_color); sampler->max_anisotropy = texobj->MaxAnisotropy; - if (sampler->max_anisotropy > 1.0) { - sampler->min_img_filter = PIPE_TEX_FILTER_ANISO; - sampler->mag_img_filter = PIPE_TEX_FILTER_ANISO; - } /* only care about ARB_shadow, not SGI shadow */ if (texobj->CompareMode == GL_COMPARE_R_TO_TEXTURE) { diff --git a/src/mesa/state_tracker/st_cb_bufferobjects.c b/src/mesa/state_tracker/st_cb_bufferobjects.c index 494a3a99c8..0102d8a6f7 100644 --- a/src/mesa/state_tracker/st_cb_bufferobjects.c +++ b/src/mesa/state_tracker/st_cb_bufferobjects.c @@ -103,6 +103,17 @@ st_bufferobj_subdata(GLcontext *ctx, ASSERT(size >= 0); ASSERT(offset + size <= obj->Size); + if (!size) + return; + + /* + * According to ARB_vertex_buffer_object specification, if data is null, + * then the contents of the buffer object's data store is undefined. We just + * ignore, and leave it unchanged. + */ + if (!data) + return; + st_cond_flush_pipe_buffer_write(st_context(ctx), st_obj->buffer, offset, size, data); } @@ -125,6 +136,9 @@ st_bufferobj_get_subdata(GLcontext *ctx, ASSERT(size >= 0); ASSERT(offset + size <= obj->Size); + if (!size) + return; + st_cond_flush_pipe_buffer_read(st_context(ctx), st_obj->buffer, offset, size, data); } @@ -223,6 +237,13 @@ st_bufferobj_map(GLcontext *ctx, GLenum target, GLenum access, /** + * Dummy data whose's pointer is used for zero length ranges. + */ +static long +st_bufferobj_zero_length_range = 0; + + +/** * Called via glMapBufferRange(). */ static void * @@ -257,14 +278,26 @@ st_bufferobj_map_range(GLcontext *ctx, GLenum target, assert(offset < obj->Size); assert(offset + length <= obj->Size); - obj->Pointer = pipe_buffer_map_range(pipe->screen, st_obj->buffer, offset, length, flags); + /* + * We go out of way here to hide the degenerate yet valid case of zero + * length range from the pipe driver. + */ + if (!length) { + obj->Pointer = &st_bufferobj_zero_length_range; + } + else { + obj->Pointer = pipe_buffer_map_range(pipe->screen, st_obj->buffer, offset, length, flags); + if (obj->Pointer) { + obj->Pointer = (ubyte *) obj->Pointer + offset; + } + } + if (obj->Pointer) { - obj->Pointer = (ubyte *) obj->Pointer + offset; obj->Offset = offset; obj->Length = length; obj->AccessFlags = access; } - + return obj->Pointer; } @@ -282,6 +315,9 @@ st_bufferobj_flush_mapped_range(GLcontext *ctx, GLenum target, assert(length >= 0); assert(offset + length <= obj->Length); + if (!length) + return; + pipe_buffer_flush_mapped_range(pipe->screen, st_obj->buffer, obj->Offset + offset, length); } @@ -296,7 +332,9 @@ st_bufferobj_unmap(GLcontext *ctx, GLenum target, struct gl_buffer_object *obj) struct pipe_context *pipe = st_context(ctx)->pipe; struct st_buffer_object *st_obj = st_buffer_object(obj); - pipe_buffer_unmap(pipe->screen, st_obj->buffer); + if(obj->Length) + pipe_buffer_unmap(pipe->screen, st_obj->buffer); + obj->Pointer = NULL; obj->Offset = 0; obj->Length = 0; @@ -319,6 +357,9 @@ st_copy_buffer_subdata(GLcontext *ctx, struct st_buffer_object *dstObj = st_buffer_object(dst); ubyte *srcPtr, *dstPtr; + if(!size) + return; + /* buffer should not already be mapped */ assert(!src->Pointer); assert(!dst->Pointer); diff --git a/src/mesa/state_tracker/st_cb_condrender.c b/src/mesa/state_tracker/st_cb_condrender.c new file mode 100644 index 0000000000..780b40c206 --- /dev/null +++ b/src/mesa/state_tracker/st_cb_condrender.c @@ -0,0 +1,95 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + + +/** + * glBegin/EndCondtionalRender functions + * + * \author Brian Paul + */ + + +#include "main/imports.h" +#include "main/context.h" + +#include "pipe/p_context.h" +#include "pipe/p_defines.h" +#include "st_context.h" +#include "st_cb_queryobj.h" +#include "st_cb_condrender.h" + + +/** + * Called via ctx->Driver.BeginConditionalRender() + */ +static void +st_BeginConditionalRender(GLcontext *ctx, struct gl_query_object *q, + GLenum mode) +{ + struct st_query_object *stq = st_query_object(q); + struct pipe_context *pipe = ctx->st->pipe; + uint m; + + switch (mode) { + case GL_QUERY_WAIT: + m = PIPE_RENDER_COND_WAIT; + break; + case GL_QUERY_NO_WAIT: + m = PIPE_RENDER_COND_NO_WAIT; + break; + case GL_QUERY_BY_REGION_WAIT: + m = PIPE_RENDER_COND_BY_REGION_WAIT; + break; + case GL_QUERY_BY_REGION_NO_WAIT: + m = PIPE_RENDER_COND_BY_REGION_NO_WAIT; + break; + default: + assert(0 && "bad mode in st_BeginConditionalRender"); + } + + pipe->render_condition(pipe, stq->pq, m); +} + + +/** + * Called via ctx->Driver.BeginConditionalRender() + */ +static void +st_EndConditionalRender(GLcontext *ctx, struct gl_query_object *q) +{ + struct pipe_context *pipe = ctx->st->pipe; + (void) q; + pipe->render_condition(pipe, NULL, 0); +} + + + +void st_init_cond_render_functions(struct dd_function_table *functions) +{ + functions->BeginConditionalRender = st_BeginConditionalRender; + functions->EndConditionalRender = st_EndConditionalRender; +} diff --git a/src/mesa/drivers/dri/intel/intel_swapbuffers.h b/src/mesa/state_tracker/st_cb_condrender.h index 75bb6242ff..891f1cbcd8 100644 --- a/src/mesa/drivers/dri/intel/intel_swapbuffers.h +++ b/src/mesa/state_tracker/st_cb_condrender.h @@ -1,7 +1,6 @@ - /************************************************************************** * - * Copyright 2006 Tungsten Graphics, Inc., Cedar Park, Texas. + * Copyright 2009 VMware, Inc. * All Rights Reserved. * * Permission is hereby granted, free of charge, to any person obtaining a @@ -19,34 +18,18 @@ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. - * IN NO EVENT SHALL TUNGSTEN GRAPHICS AND/OR ITS SUPPLIERS BE LIABLE FOR + * IN NO EVENT SHALL THE AUTHORS AND/OR ITS SUPPLIERS BE LIABLE FOR * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. * **************************************************************************/ -#ifndef INTEL_SWAPBUFFERS_H -#define INTEL_SWAPBUFFERS_H - -#include "dri_util.h" -#include "drm.h" - -struct intel_context; -struct intel_framebuffer; - - -extern void -intelSwapBuffers(__DRIdrawablePrivate * dPriv); - -extern void -intelCopySubBuffer(__DRIdrawablePrivate * dPriv, int x, int y, int w, int h); +#ifndef ST_CB_CONDRENDER_H +#define ST_CB_CONDRENDER_H -extern GLuint -intelFixupVblank(struct intel_context *intel, __DRIdrawablePrivate *dPriv); -extern void -intelWindowMoved(struct intel_context *intel); +extern void st_init_cond_render_functions(struct dd_function_table *functions); -#endif /* INTEL_SWAPBUFFERS_H */ +#endif diff --git a/src/mesa/state_tracker/st_cb_queryobj.c b/src/mesa/state_tracker/st_cb_queryobj.c index dcf4c38eb6..10629e9225 100644 --- a/src/mesa/state_tracker/st_cb_queryobj.c +++ b/src/mesa/state_tracker/st_cb_queryobj.c @@ -44,23 +44,6 @@ #include "st_public.h" -struct st_query_object -{ - struct gl_query_object base; - struct pipe_query *pq; -}; - - -/** - * Cast wrapper - */ -static struct st_query_object * -st_query_object(struct gl_query_object *q) -{ - return (struct st_query_object *) q; -} - - static struct gl_query_object * st_NewQueryObject(GLcontext *ctx, GLuint id) { diff --git a/src/mesa/state_tracker/st_cb_queryobj.h b/src/mesa/state_tracker/st_cb_queryobj.h index 9220a212b6..fa256b7182 100644 --- a/src/mesa/state_tracker/st_cb_queryobj.h +++ b/src/mesa/state_tracker/st_cb_queryobj.h @@ -29,6 +29,27 @@ #define ST_CB_QUERYOBJ_H +/** + * Subclass of gl_query_object + */ +struct st_query_object +{ + struct gl_query_object base; + struct pipe_query *pq; +}; + + +/** + * Cast wrapper + */ +static INLINE struct st_query_object * +st_query_object(struct gl_query_object *q) +{ + return (struct st_query_object *) q; +} + + + extern void st_init_query_functions(struct dd_function_table *functions); diff --git a/src/mesa/state_tracker/st_cb_texture.c b/src/mesa/state_tracker/st_cb_texture.c index 6e1ecb1c50..f01053cdac 100644 --- a/src/mesa/state_tracker/st_cb_texture.c +++ b/src/mesa/state_tracker/st_cb_texture.c @@ -680,7 +680,22 @@ st_TexImage(GLcontext * ctx, * conversion and copy: */ if (compressed_src) { - memcpy(texImage->Data, pixels, imageSize); + const GLuint srcImageStride = _mesa_format_row_stride(texImage->TexFormat, width); + if(dstRowStride == srcImageStride) + memcpy(texImage->Data, pixels, imageSize); + else + { + char *dst = texImage->Data; + const char *src = pixels; + int i; + + for(i = 0; i < height; ++i) + { + memcpy(dst, src, srcImageStride); + dst += dstRowStride; + src += srcImageStride; + } + } } else { const GLuint srcImageStride = @@ -1090,7 +1105,7 @@ st_TexSubimage(GLcontext *ctx, GLint dims, GLenum target, GLint level, done: _mesa_unmap_teximage_pbo(ctx, packing); - if (stImage->pt) { + if (stImage->pt && texImage->Data) { st_texture_image_unmap(ctx->st, stImage); texImage->Data = NULL; } diff --git a/src/mesa/state_tracker/st_cb_viewport.c b/src/mesa/state_tracker/st_cb_viewport.c index 75b0a219ce..ab11c5b4fe 100644 --- a/src/mesa/state_tracker/st_cb_viewport.c +++ b/src/mesa/state_tracker/st_cb_viewport.c @@ -42,8 +42,8 @@ static void st_viewport(GLcontext * ctx, GLint x, GLint y, { struct st_context *st = ctx->st; - if (st->pipe->winsys && st->pipe->winsys->update_buffer) - st->pipe->winsys->update_buffer( st->pipe->winsys, + if (st->pipe->screen && st->pipe->screen->update_buffer) + st->pipe->screen->update_buffer( st->pipe->screen, st->pipe->priv ); } diff --git a/src/mesa/state_tracker/st_context.c b/src/mesa/state_tracker/st_context.c index d18a25ab51..e4f18c842c 100644 --- a/src/mesa/state_tracker/st_context.c +++ b/src/mesa/state_tracker/st_context.c @@ -43,6 +43,7 @@ #include "st_cb_blit.h" #include "st_cb_bufferobjects.h" #include "st_cb_clear.h" +#include "st_cb_condrender.h" #if FEATURE_drawpix #include "st_cb_drawpixels.h" #include "st_cb_rasterpos.h" @@ -337,6 +338,7 @@ void st_init_driver_functions(struct dd_function_table *functions) #if FEATURE_queryobj st_init_query_functions(functions); #endif + st_init_cond_render_functions(functions); st_init_readpixels_functions(functions); st_init_texture_functions(functions); st_init_flush_functions(functions); diff --git a/src/mesa/state_tracker/st_extensions.c b/src/mesa/state_tracker/st_extensions.c index ef3cbc53ee..35e08749df 100644 --- a/src/mesa/state_tracker/st_extensions.c +++ b/src/mesa/state_tracker/st_extensions.c @@ -306,4 +306,8 @@ void st_init_extensions(struct st_context *st) /* we support always support GL_EXT_framebuffer_blit */ ctx->Extensions.ARB_framebuffer_object = GL_TRUE; } + + if (st->pipe->render_condition) { + ctx->Extensions.NV_conditional_render = GL_TRUE; + } } diff --git a/src/mesa/state_tracker/st_mesa_to_tgsi.c b/src/mesa/state_tracker/st_mesa_to_tgsi.c index 5c9be46a77..e788008dfe 100644 --- a/src/mesa/state_tracker/st_mesa_to_tgsi.c +++ b/src/mesa/state_tracker/st_mesa_to_tgsi.c @@ -160,13 +160,14 @@ dst_register( struct st_translate *t, static struct ureg_src src_register( struct st_translate *t, gl_register_file file, - GLuint index ) + GLint index ) { switch( file ) { case PROGRAM_UNDEFINED: return ureg_src_undef(); case PROGRAM_TEMPORARY: + ASSERT(index >= 0); if (ureg_dst_is_undef(t->temps[index])) t->temps[index] = ureg_DECL_temporary( t->ureg ); return ureg_src(t->temps[index]); @@ -174,9 +175,15 @@ src_register( struct st_translate *t, case PROGRAM_STATE_VAR: case PROGRAM_NAMED_PARAM: case PROGRAM_ENV_PARAM: + case PROGRAM_LOCAL_PARAM: case PROGRAM_UNIFORM: - case PROGRAM_CONSTANT: /* ie, immediate */ + ASSERT(index >= 0); return t->constants[index]; + case PROGRAM_CONSTANT: /* ie, immediate */ + if (index < 0) + return ureg_DECL_constant( t->ureg, 0 ); + else + return t->constants[index]; case PROGRAM_INPUT: return t->inputs[t->inputMapping[index]]; @@ -263,9 +270,14 @@ translate_src( struct st_translate *t, if (SrcReg->Abs) src = ureg_abs(src); - if (SrcReg->RelAddr) + if (SrcReg->RelAddr) { src = ureg_src_indirect( src, ureg_src(t->address[0])); - + /* If SrcReg->Index was negative, it was set to zero in + * src_register(). Reassign it now. + */ + src.Index = SrcReg->Index; + } + return src; } @@ -859,6 +871,7 @@ st_translate_mesa_program( for (i = 0; i < program->Parameters->NumParameters; i++) { switch (program->Parameters->Parameters[i].Type) { case PROGRAM_ENV_PARAM: + case PROGRAM_LOCAL_PARAM: case PROGRAM_STATE_VAR: case PROGRAM_NAMED_PARAM: case PROGRAM_UNIFORM: diff --git a/src/mesa/state_tracker/st_public.h b/src/mesa/state_tracker/st_public.h index a5fdac32d1..98c19817c8 100644 --- a/src/mesa/state_tracker/st_public.h +++ b/src/mesa/state_tracker/st_public.h @@ -56,15 +56,19 @@ struct pipe_surface; struct pipe_texture; +PUBLIC struct st_context *st_create_context(struct pipe_context *pipe, const __GLcontextModes *visual, struct st_context *share); +PUBLIC void st_destroy_context( struct st_context *st ); +PUBLIC void st_copy_context_state(struct st_context *dst, struct st_context *src, uint mask); +PUBLIC struct st_framebuffer *st_create_framebuffer( const __GLcontextModes *visual, enum pipe_format colorFormat, enum pipe_format depthFormat, @@ -72,50 +76,67 @@ struct st_framebuffer *st_create_framebuffer( const __GLcontextModes *visual, uint width, uint height, void *privateData); +PUBLIC void st_resize_framebuffer( struct st_framebuffer *stfb, uint width, uint height ); +PUBLIC void st_set_framebuffer_surface(struct st_framebuffer *stfb, uint surfIndex, struct pipe_surface *surf); +PUBLIC void st_get_framebuffer_dimensions( struct st_framebuffer *stfb, uint *width, uint *height); +PUBLIC int st_get_framebuffer_surface(struct st_framebuffer *stfb, uint surfIndex, struct pipe_surface **surface); +PUBLIC int st_get_framebuffer_texture(struct st_framebuffer *stfb, uint surfIndex, struct pipe_texture **texture); +PUBLIC void *st_framebuffer_private( struct st_framebuffer *stfb ); +PUBLIC void st_unreference_framebuffer( struct st_framebuffer *stfb ); +PUBLIC GLboolean st_make_current(struct st_context *st, struct st_framebuffer *draw, struct st_framebuffer *read); +PUBLIC struct st_context *st_get_current(void); +PUBLIC void st_flush( struct st_context *st, uint pipeFlushFlags, struct pipe_fence_handle **fence ); +PUBLIC void st_finish( struct st_context *st ); +PUBLIC void st_notify_swapbuffers(struct st_framebuffer *stfb); +PUBLIC void st_swapbuffers(struct st_framebuffer *stfb, struct pipe_surface **front_left, struct pipe_surface **front_right); +PUBLIC int st_bind_texture_surface(struct pipe_surface *ps, int target, int level, enum pipe_format format); +PUBLIC int st_unbind_texture_surface(struct pipe_surface *ps, int target, int level); /** Redirect rendering into stfb's surface to a texture image */ +PUBLIC int st_bind_teximage(struct st_framebuffer *stfb, uint surfIndex, int target, int format, int level); /** Undo surface-to-texture binding */ +PUBLIC int st_release_teximage(struct st_framebuffer *stfb, uint surfIndex, int target, int format, int level); @@ -123,6 +144,7 @@ int st_release_teximage(struct st_framebuffer *stfb, uint surfIndex, /** Generic function type */ typedef void (*st_proc)(); +PUBLIC st_proc st_get_proc_address(const char *procname); diff --git a/src/mesa/swrast/s_accum.c b/src/mesa/swrast/s_accum.c index 2d8c361e5d..0e0876efcb 100644 --- a/src/mesa/swrast/s_accum.c +++ b/src/mesa/swrast/s_accum.c @@ -436,10 +436,6 @@ accum_return(GLcontext *ctx, GLfloat value, struct gl_renderbuffer *accumRb = fb->Attachment[BUFFER_ACCUM].Renderbuffer; const GLboolean directAccess = (accumRb->GetPointer(ctx, accumRb, 0, 0) != NULL); - const GLboolean masking = (!ctx->Color.ColorMask[RCOMP] || - !ctx->Color.ColorMask[GCOMP] || - !ctx->Color.ColorMask[BCOMP] || - !ctx->Color.ColorMask[ACOMP]); static GLchan multTable[32768]; static GLfloat prevMult = 0.0; @@ -527,6 +523,10 @@ accum_return(GLcontext *ctx, GLfloat value, /* store colors */ for (buffer = 0; buffer < fb->_NumColorDrawBuffers; buffer++) { struct gl_renderbuffer *rb = fb->_ColorDrawBuffers[buffer]; + const GLboolean masking = (!ctx->Color.ColorMask[buffer][RCOMP] || + !ctx->Color.ColorMask[buffer][GCOMP] || + !ctx->Color.ColorMask[buffer][BCOMP] || + !ctx->Color.ColorMask[buffer][ACOMP]); if (masking) { _swrast_mask_rgba_span(ctx, rb, &span, buffer); } diff --git a/src/mesa/swrast/s_texfilter.c b/src/mesa/swrast/s_texfilter.c index 0bb988e3ef..76b65cc755 100644 --- a/src/mesa/swrast/s_texfilter.c +++ b/src/mesa/swrast/s_texfilter.c @@ -747,28 +747,28 @@ get_border_color(const struct gl_texture_object *tObj, { switch (img->_BaseFormat) { case GL_RGB: - rgba[0] = tObj->BorderColor[0]; - rgba[1] = tObj->BorderColor[1]; - rgba[2] = tObj->BorderColor[2]; + rgba[0] = tObj->BorderColor.f[0]; + rgba[1] = tObj->BorderColor.f[1]; + rgba[2] = tObj->BorderColor.f[2]; rgba[3] = 1.0F; break; case GL_ALPHA: rgba[0] = rgba[1] = rgba[2] = 0.0; - rgba[3] = tObj->BorderColor[3]; + rgba[3] = tObj->BorderColor.f[3]; break; case GL_LUMINANCE: - rgba[0] = rgba[1] = rgba[2] = tObj->BorderColor[0]; + rgba[0] = rgba[1] = rgba[2] = tObj->BorderColor.f[0]; rgba[3] = 1.0; break; case GL_LUMINANCE_ALPHA: - rgba[0] = rgba[1] = rgba[2] = tObj->BorderColor[0]; - rgba[3] = tObj->BorderColor[3]; + rgba[0] = rgba[1] = rgba[2] = tObj->BorderColor.f[0]; + rgba[3] = tObj->BorderColor.f[3]; break; case GL_INTENSITY: - rgba[0] = rgba[1] = rgba[2] = rgba[3] = tObj->BorderColor[0]; + rgba[0] = rgba[1] = rgba[2] = rgba[3] = tObj->BorderColor.f[0]; break; default: - COPY_4V(rgba, tObj->BorderColor); + COPY_4V(rgba, tObj->BorderColor.f); } } @@ -2331,7 +2331,7 @@ sample_2d_array_linear(GLcontext *ctx, array = clamp_rect_coord_nearest(tObj->WrapR, texcoord[2], depth); if (array < 0 || array >= depth) { - COPY_4V(rgba, tObj->BorderColor); + COPY_4V(rgba, tObj->BorderColor.f); } else { if (img->Border) { @@ -3002,7 +3002,7 @@ sample_depth_texture( GLcontext *ctx, img->FetchTexelf(img, col, row, slice, &depthSample); } else { - depthSample = tObj->BorderColor[0]; + depthSample = tObj->BorderColor.f[0]; } result = shadow_compare(function, texcoords[i][compare_coord], @@ -3053,21 +3053,21 @@ sample_depth_texture( GLcontext *ctx, } if (slice < 0 || slice >= (GLint) depth) { - depth00 = tObj->BorderColor[0]; - depth01 = tObj->BorderColor[0]; - depth10 = tObj->BorderColor[0]; - depth11 = tObj->BorderColor[0]; + depth00 = tObj->BorderColor.f[0]; + depth01 = tObj->BorderColor.f[0]; + depth10 = tObj->BorderColor.f[0]; + depth11 = tObj->BorderColor.f[0]; } else { /* get four depth samples from the texture */ if (useBorderTexel & (I0BIT | J0BIT)) { - depth00 = tObj->BorderColor[0]; + depth00 = tObj->BorderColor.f[0]; } else { img->FetchTexelf(img, i0, j0, slice, &depth00); } if (useBorderTexel & (I1BIT | J0BIT)) { - depth10 = tObj->BorderColor[0]; + depth10 = tObj->BorderColor.f[0]; } else { img->FetchTexelf(img, i1, j0, slice, &depth10); @@ -3075,13 +3075,13 @@ sample_depth_texture( GLcontext *ctx, if (tObj->Target != GL_TEXTURE_1D_ARRAY_EXT) { if (useBorderTexel & (I0BIT | J1BIT)) { - depth01 = tObj->BorderColor[0]; + depth01 = tObj->BorderColor.f[0]; } else { img->FetchTexelf(img, i0, j1, slice, &depth01); } if (useBorderTexel & (I1BIT | J1BIT)) { - depth11 = tObj->BorderColor[0]; + depth11 = tObj->BorderColor.f[0]; } else { img->FetchTexelf(img, i1, j1, slice, &depth11); diff --git a/src/mesa/tnl/t_vb_program.c b/src/mesa/tnl/t_vb_program.c index c289cdfbaa..15a8a67b91 100644 --- a/src/mesa/tnl/t_vb_program.c +++ b/src/mesa/tnl/t_vb_program.c @@ -390,6 +390,13 @@ run_vp( GLcontext *ctx, struct tnl_pipeline_stage *stage ) #endif COPY_4V(store->results[attr].data[i], machine.Outputs[attr]); } + + /* FOGC is a special case. Fragment shader expects (f,0,0,1) */ + if (program->Base.OutputsWritten & BITFIELD64_BIT(VERT_RESULT_FOGC)) { + store->results[VERT_RESULT_FOGC].data[i][1] = 0.0; + store->results[VERT_RESULT_FOGC].data[i][2] = 0.0; + store->results[VERT_RESULT_FOGC].data[i][3] = 1.0; + } #ifdef NAN_CHECK ASSERT(machine.Outputs[0][3] != 0.0F); #endif diff --git a/src/mesa/x86/gen_matypes.c b/src/mesa/x86/gen_matypes.c index 0d7e0f1f98..14cfa910aa 100644 --- a/src/mesa/x86/gen_matypes.c +++ b/src/mesa/x86/gen_matypes.c @@ -61,21 +61,11 @@ do { \ printf( "\n" ); \ } while (0) -#if defined(__BEOS__) || defined(__HAIKU__) || defined(_LP64) #define OFFSET( s, t, m ) \ - printf( "#define %s\t%ld\n", s, offsetof( t, m ) ); -#else -#define OFFSET( s, t, m ) \ - printf( "#define %s\t%d\n", s, offsetof( t, m ) ); -#endif + printf( "#define %s\t%lu\n", s, (unsigned long) offsetof( t, m ) ); -#if defined(__BEOS__) || defined(__HAIKU__) || defined(_LP64) -#define SIZEOF( s, t ) \ - printf( "#define %s\t%ld\n", s, sizeof(t) ); -#else #define SIZEOF( s, t ) \ - printf( "#define %s\t%d\n", s, sizeof(t) ); -#endif + printf( "#define %s\t%lu\n", s, (unsigned long) sizeof(t) ); #define DEFINE( s, d ) \ printf( "#define %s\t0x%x\n", s, d ); |
